Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|1776
Gene name
LocationContig_178:24608..25408
Strand-
Gene length (bp)800
Transcript length (bp)741
Coding sequence length (bp)741
Protein length (aa) 247

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF17777 RL10P_insert Insertion domain in 60S ribosomal protein L10P 1.1E-21 126 214
PF00466 Ribosomal_L10 Ribosomal protein L10 1.4E-20 18 120

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q7S302|MRT4_NEUCR Ribosome assembly factor mrt4 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=mrt4 PE=3 SV=1 1 238 2.0E-110
sp|G0S616|MRT4_CHATD Ribosome assembly factor mrt4 OS=Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) GN=CTHT_0025680 PE=1 SV=2 1 238 5.0E-104
sp|Q9USZ6|MRT4_SCHPO Ribosome assembly factor mrt4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mrt4 PE=3 SV=1 1 246 3.0E-64
sp|Q6FJ04|MRT4_CANGA Ribosome assembly factor mrt4 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=MRT4 PE=3 SV=1 1 238 7.0E-52
sp|Q9D0I8|MRT4_MOUSE mRNA turnover protein 4 homolog OS=Mus musculus GN=Mrto4 PE=1 SV=1 1 238 4.0E-51
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q7S302|MRT4_NEUCR Ribosome assembly factor mrt4 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=mrt4 PE=3 SV=1 1 238 2.0E-110
sp|G0S616|MRT4_CHATD Ribosome assembly factor mrt4 OS=Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) GN=CTHT_0025680 PE=1 SV=2 1 238 5.0E-104
sp|Q9USZ6|MRT4_SCHPO Ribosome assembly factor mrt4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mrt4 PE=3 SV=1 1 246 3.0E-64
sp|Q6FJ04|MRT4_CANGA Ribosome assembly factor mrt4 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=MRT4 PE=3 SV=1 1 238 7.0E-52
sp|Q9D0I8|MRT4_MOUSE mRNA turnover protein 4 homolog OS=Mus musculus GN=Mrto4 PE=1 SV=1 1 238 4.0E-51
sp|A4FV84|MRT4_BOVIN mRNA turnover protein 4 homolog OS=Bos taurus GN=MRTO4 PE=2 SV=1 1 237 2.0E-50
sp|P33201|MRT4_YEAST Ribosome assembly factor MRT4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MRT4 PE=1 SV=1 1 238 2.0E-50
sp|Q9UKD2|MRT4_HUMAN mRNA turnover protein 4 homolog OS=Homo sapiens GN=MRTO4 PE=1 SV=2 1 237 2.0E-49
sp|Q75DK9|MRT4_ASHGO Ribosome assembly factor mrt4 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=MRT4 PE=3 SV=1 1 237 1.0E-48
sp|Q86HD3|MRT4_DICDI Ribosome assembly factor mrt4 OS=Dictyostelium discoideum GN=mrt4 PE=3 SV=1 1 228 3.0E-36
sp|P50346|RLA0_SOYBN 60S acidic ribosomal protein P0 OS=Glycine max PE=2 SV=1 17 196 3.0E-09
sp|O74864|RLA0_SCHPO 60S acidic ribosomal protein P0 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rpp0 PE=3 SV=1 15 227 2.0E-08
sp|P57691|RLA03_ARATH 60S acidic ribosomal protein P0-3 OS=Arabidopsis thaliana GN=RPP0C PE=1 SV=1 17 196 2.0E-08
sp|Q42112|RLA02_ARATH 60S acidic ribosomal protein P0-2 OS=Arabidopsis thaliana GN=RPP0B PE=1 SV=2 17 196 3.0E-08
sp|P50345|RLA0_LUPLU 60S acidic ribosomal protein P0 OS=Lupinus luteus PE=2 SV=1 17 196 5.0E-08
sp|O04204|RLA01_ARATH 60S acidic ribosomal protein P0-1 OS=Arabidopsis thaliana GN=RPP0A PE=1 SV=1 17 196 1.0E-07
sp|Q94660|RLA0_PLAF8 60S acidic ribosomal protein P0 OS=Plasmodium falciparum (isolate 7G8) GN=RPLP0 PE=2 SV=2 12 180 3.0E-06
sp|Q8TX50|RL10_METKA 50S ribosomal protein L10 OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=rpl10 PE=3 SV=2 28 225 5.0E-06
sp|Q96TJ5|RLA0_NEUCR 60S acidic ribosomal protein P0 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=p0 PE=2 SV=1 27 217 5.0E-06
sp|Q6L1X8|RL10_PICTO 50S ribosomal protein L10 OS=Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828) GN=rpl10 PE=3 SV=1 42 210 9.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 22 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|1776
MPKSKRSKLVHLTKVSKKTRTQKDLLFQSIRTAVPDYQHILVFNVDGMRNSHLKSVRRELREDSRLFFGKTKLMV
KALGQSPAEAIAPGIDGLAPFLSGSVGLILTNRAPSAVLDYFAGMAKVDFARAGATASRSFTIPPGLVYSTAGEV
PPEHDVLLEHTIEPELRKLGVPTRMRKGKIVLGDEDGSGEGYLVCKENDVLDSRQTRLLKIFGVCLSEFRVKVLA
YWSAASEKVTQVDPSAMDGVE*
Coding >Ophun1|1776
ATGCCCAAATCCAAGCGATCCAAGCTCGTCCACCTCACAAAAGTCAGCAAAAAGACCCGAACCCAAAAAGATCTC
CTCTTCCAATCCATCCGCACCGCCGTACCAGATTACCAACACATCCTCGTCTTCAACGTCGATGGCATGCGCAAC
TCGCACCTCAAGAGCGTCAGGCGAGAGCTCCGCGAGGACAGCCGCCTCTTCTTCGGCAAGACCAAGCTCATGGTC
AAGGCCCTAGGGCAATCCCCCGCCGAGGCCATCGCTCCGGGCATCGACGGCCTCGCCCCCTTCCTCTCGGGATCT
GTCGGCTTGATCCTCACCAACCGGGCCCCCTCCGCCGTCTTGGATTACTTCGCCGGCATGGCAAAGGTTGACTTT
GCTCGCGCCGGTGCCACTGCCTCTCGCTCCTTCACCATCCCCCCAGGCCTCGTGTACAGCACCGCCGGCGAGGTG
CCGCCCGAGCACGACGTCCTCCTCGAGCACACCATCGAGCCCGAACTGCGCAAGTTGGGCGTTCCCACTCGCATG
CGCAAGGGCAAGATTGTACTCGGCGACGAAGACGGCTCGGGCGAGGGCTACCTCGTCTGCAAAGAGAATGACGTC
CTGGACTCGAGGCAGACCAGGCTCCTCAAGATTTTCGGCGTCTGCCTGAGCGAGTTCCGCGTCAAGGTTCTGGCG
TACTGGAGCGCAGCCAGCGAAAAAGTCACCCAAGTCGACCCTTCAGCCATGGATGGAGTGGAATGA
Transcript >Ophun1|1776
ATGCCCAAATCCAAGCGATCCAAGCTCGTCCACCTCACAAAAGTCAGCAAAAAGACCCGAACCCAAAAAGATCTC
CTCTTCCAATCCATCCGCACCGCCGTACCAGATTACCAACACATCCTCGTCTTCAACGTCGATGGCATGCGCAAC
TCGCACCTCAAGAGCGTCAGGCGAGAGCTCCGCGAGGACAGCCGCCTCTTCTTCGGCAAGACCAAGCTCATGGTC
AAGGCCCTAGGGCAATCCCCCGCCGAGGCCATCGCTCCGGGCATCGACGGCCTCGCCCCCTTCCTCTCGGGATCT
GTCGGCTTGATCCTCACCAACCGGGCCCCCTCCGCCGTCTTGGATTACTTCGCCGGCATGGCAAAGGTTGACTTT
GCTCGCGCCGGTGCCACTGCCTCTCGCTCCTTCACCATCCCCCCAGGCCTCGTGTACAGCACCGCCGGCGAGGTG
CCGCCCGAGCACGACGTCCTCCTCGAGCACACCATCGAGCCCGAACTGCGCAAGTTGGGCGTTCCCACTCGCATG
CGCAAGGGCAAGATTGTACTCGGCGACGAAGACGGCTCGGGCGAGGGCTACCTCGTCTGCAAAGAGAATGACGTC
CTGGACTCGAGGCAGACCAGGCTCCTCAAGATTTTCGGCGTCTGCCTGAGCGAGTTCCGCGTCAAGGTTCTGGCG
TACTGGAGCGCAGCCAGCGAAAAAGTCACCCAAGTCGACCCTTCAGCCATGGATGGAGTGGAATGA
Gene >Ophun1|1776
ATGCCCAAATCCAAGCGATCCAAGCTCGTCCACCTCACAAAAGTCAGCAAAAAGACCCGAACCCAAAAAGATCTC
CTCTTCCAATCCATCCGCACCGCCGTACCAGATTACCAACACATCCTCGTCTTCAACGTCGATGGCATGCGCAAC
TCGCACCTCAAGAGCGTCAGGCGAGAGCTCCGCGAGGACAGCCGCCTCTTCTTCGGCAAGACCAAGCTCATGGTC
AAGGCCCTAGGGCAATCCCCCGCCGAGGCCATCGCTCCGGGCATCGACGGCCTCGCCCCCTTCCTCTCGGGATCT
GTCGGCTTGATCCTCACCAACCGGGCCCCCTCCGCCGTCTTGGATTACTTCGCCGGCATGGCAAAGGTTGACTTT
GCTCGCGCCGGTGCCACTGCCTCTCGCTCCTTCACCATCCCCCCAGGCCTCGTGTACAGCACCGCCGGCGAGGTG
CCGCCCGAGCACGACGTCCTCCTCGAGCACACCATCGAGCCCGAACTGCGCAAGTTGGGCGTTCCCACTCGCATG
CGCAAGGGCAAGATTGTACTCGGCGACGAAGACGGCTCGGGCGAGGGCTACCTCGTCTGCAAAGAGAATGACGTC
CTGGACTCGAGGCAGACCAGGCTCCTCAAGATTTTCGGCGTCTGCCTGAGCGAGTTCCGCGTCAAGGTTCTGGCG
TAAGTTTCATCCTATTCACAACCTCTCGACCTTTGCGCGCGCTGACTTCTTCAATCAGGTACTGGAGCGCAGCCA
GCGAAAAAGTCACCCAAGTCGACCCTTCAGCCATGGATGGAGTGGAATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail