Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|1775
Gene name
LocationContig_178:22525..23879
Strand+
Gene length (bp)1354
Transcript length (bp)1233
Coding sequence length (bp)1233
Protein length (aa) 411

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12220 U1snRNP70_N U1 small nuclear ribonucleoprotein of 70kDa MW N terminal 6.6E-22 4 91
PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) 3.0E-14 129 205

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O13829|RU17_SCHPO U1 small nuclear ribonucleoprotein 70 kDa homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=usp101 PE=1 SV=1 1 251 2.0E-37
sp|P08621|RU17_HUMAN U1 small nuclear ribonucleoprotein 70 kDa OS=Homo sapiens GN=SNRNP70 PE=1 SV=2 1 217 1.0E-27
sp|Q62376|RU17_MOUSE U1 small nuclear ribonucleoprotein 70 kDa OS=Mus musculus GN=Snrnp70 PE=1 SV=2 1 217 2.0E-27
sp|Q1RMR2|RU17_BOVIN U1 small nuclear ribonucleoprotein 70 kDa OS=Bos taurus GN=SNRNP70 PE=2 SV=1 1 217 3.0E-27
sp|Q42404|RU17_ARATH U1 small nuclear ribonucleoprotein 70 kDa OS=Arabidopsis thaliana GN=RNU1 PE=1 SV=1 5 227 4.0E-27
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O13829|RU17_SCHPO U1 small nuclear ribonucleoprotein 70 kDa homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=usp101 PE=1 SV=1 1 251 2.0E-37
sp|P08621|RU17_HUMAN U1 small nuclear ribonucleoprotein 70 kDa OS=Homo sapiens GN=SNRNP70 PE=1 SV=2 1 217 1.0E-27
sp|Q62376|RU17_MOUSE U1 small nuclear ribonucleoprotein 70 kDa OS=Mus musculus GN=Snrnp70 PE=1 SV=2 1 217 2.0E-27
sp|Q1RMR2|RU17_BOVIN U1 small nuclear ribonucleoprotein 70 kDa OS=Bos taurus GN=SNRNP70 PE=2 SV=1 1 217 3.0E-27
sp|Q42404|RU17_ARATH U1 small nuclear ribonucleoprotein 70 kDa OS=Arabidopsis thaliana GN=RNU1 PE=1 SV=1 5 227 4.0E-27
sp|Q66II8|RU17_XENTR U1 small nuclear ribonucleoprotein 70 kDa OS=Xenopus tropicalis GN=snrnp70 PE=2 SV=1 1 217 1.0E-26
sp|P09406|RU17_XENLA U1 small nuclear ribonucleoprotein 70 kDa OS=Xenopus laevis GN=snrnp70 PE=2 SV=1 1 217 4.0E-26
sp|Q55FQ0|RU17_DICDI U1 small nuclear ribonucleoprotein 70 kDa OS=Dictyostelium discoideum GN=snrnp70 PE=3 SV=1 112 227 6.0E-24
sp|P17133|RU17_DROME U1 small nuclear ribonucleoprotein 70 kDa OS=Drosophila melanogaster GN=snRNP-U1-70K PE=1 SV=2 1 219 4.0E-22
sp|Q00916|RU17_YEAST U1 small nuclear ribonucleoprotein 70 kDa homolog OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SNP1 PE=1 SV=1 4 219 2.0E-18
sp|Q1LZH0|U1SBP_BOVIN U11/U12 small nuclear ribonucleoprotein 35 kDa protein OS=Bos taurus GN=SNRNP35 PE=2 SV=1 119 219 2.0E-09
sp|Q9D384|U1SBP_MOUSE U11/U12 small nuclear ribonucleoprotein 35 kDa protein OS=Mus musculus GN=Snrnp35 PE=2 SV=1 119 219 2.0E-09
sp|Q5U1W5|U1SBP_RAT U11/U12 small nuclear ribonucleoprotein 35 kDa protein OS=Rattus norvegicus GN=Snrnp35 PE=2 SV=1 119 219 5.0E-09
sp|W8E7I1|RBM3_CAPHI RNA-binding protein 3 OS=Capra hircus GN=RBM3 PE=2 SV=2 127 227 5.0E-09
sp|Q16560|U1SBP_HUMAN U11/U12 small nuclear ribonucleoprotein 35 kDa protein OS=Homo sapiens GN=SNRNP35 PE=1 SV=1 119 219 7.0E-09
sp|Q925G0|RBM3_RAT RNA-binding protein 3 OS=Rattus norvegicus GN=Rbm3 PE=1 SV=2 127 233 1.0E-08
sp|P98179|RBM3_HUMAN RNA-binding protein 3 OS=Homo sapiens GN=RBM3 PE=1 SV=1 127 207 1.0E-08
sp|O89086|RBM3_MOUSE RNA-binding protein 3 OS=Mus musculus GN=Rbm3 PE=1 SV=1 127 207 7.0E-08
sp|Q29RT0|RBMX_BOVIN RNA-binding motif protein, X chromosome OS=Bos taurus GN=RBMX PE=2 SV=1 119 206 8.0E-08
sp|Q4KMD3|U1SBP_DANRE U11/U12 small nuclear ribonucleoprotein 35 kDa protein OS=Danio rerio GN=snrnp35 PE=2 SV=1 119 223 9.0E-08
sp|Q9PTX2|CIRBP_LITCT Cold-inducible RNA-binding protein OS=Lithobates catesbeiana GN=cirbp PE=2 SV=1 127 207 1.0E-07
sp|Q5RF83|CIRBP_PONAB Cold-inducible RNA-binding protein OS=Pongo abelii GN=CIRBP PE=2 SV=1 127 207 1.0E-07
sp|Q14011|CIRBP_HUMAN Cold-inducible RNA-binding protein OS=Homo sapiens GN=CIRBP PE=1 SV=1 127 207 1.0E-07
sp|P60825|CIRBP_RAT Cold-inducible RNA-binding protein OS=Rattus norvegicus GN=Cirbp PE=2 SV=1 127 207 2.0E-07
sp|P60824|CIRBP_MOUSE Cold-inducible RNA-binding protein OS=Mus musculus GN=Cirbp PE=1 SV=1 127 207 2.0E-07
sp|P60826|CIRBP_CRIGR Cold-inducible RNA-binding protein OS=Cricetulus griseus GN=CIRBP PE=2 SV=1 127 207 2.0E-07
sp|Q7ZWA3|RBMX_DANRE RNA-binding motif protein, X chromosome OS=Danio rerio GN=rbmx PE=2 SV=1 127 207 3.0E-07
sp|Q6IRQ4|RBMX_XENLA RNA-binding motif protein, X chromosome OS=Xenopus laevis GN=rbmx PE=2 SV=1 119 207 5.0E-07
sp|Q28IQ9|CIRBP_XENTR Cold-inducible RNA-binding protein OS=Xenopus tropicalis GN=cirbp PE=2 SV=1 127 207 7.0E-07
sp|O75526|RMXL2_HUMAN RNA-binding motif protein, X-linked-like-2 OS=Homo sapiens GN=RBMXL2 PE=1 SV=3 119 206 9.0E-07
sp|P0C8Z4|RMXL3_PANTR RNA-binding motif protein, X-linked-like-3 OS=Pan troglodytes GN=RBMXL3 PE=3 SV=1 127 206 1.0E-06
sp|Q9DED4|CIRBB_XENLA Cold-inducible RNA-binding protein B OS=Xenopus laevis GN=cirbp-b PE=1 SV=1 127 207 2.0E-06
sp|P0DJD4|RBY1C_HUMAN RNA-binding motif protein, Y chromosome, family 1 member C OS=Homo sapiens GN=RBMY1C PE=1 SV=1 119 215 2.0E-06
sp|Q91VM5|RMXL1_MOUSE RNA binding motif protein, X-linked-like-1 OS=Mus musculus GN=Rbmxl1 PE=2 SV=1 119 207 2.0E-06
sp|Q4R813|RMXL2_MACFA RNA-binding motif protein, X-linked-like-2 OS=Macaca fascicularis GN=RBMXL2 PE=2 SV=1 119 206 2.0E-06
sp|Q8VY74|U1135_ARATH U11/U12 small nuclear ribonucleoprotein 35 kDa protein OS=Arabidopsis thaliana GN=SNRNP35 PE=1 SV=1 107 219 2.0E-06
sp|P0DJD3|RBY1A_HUMAN RNA-binding motif protein, Y chromosome, family 1 member A1 OS=Homo sapiens GN=RBMY1A1 PE=1 SV=1 119 215 2.0E-06
sp|P0C7P1|RBY1D_HUMAN RNA-binding motif protein, Y chromosome, family 1 member D OS=Homo sapiens GN=RBMY1D PE=2 SV=1 119 215 2.0E-06
sp|A6NEQ0|RBY1E_HUMAN RNA-binding motif protein, Y chromosome, family 1 member E OS=Homo sapiens GN=RBMY1E PE=2 SV=1 119 215 2.0E-06
sp|A6NDE4|RBY1B_HUMAN RNA-binding motif protein, Y chromosome, family 1 member B OS=Homo sapiens GN=RBMY1B PE=2 SV=2 119 215 2.0E-06
sp|Q15415|RBY1F_HUMAN RNA-binding motif protein, Y chromosome, family 1 member F/J OS=Homo sapiens GN=RBMY1F PE=1 SV=2 119 215 2.0E-06
sp|O02008|TRA2_DROVI Transformer-2 sex-determining protein OS=Drosophila virilis GN=tra2 PE=3 SV=1 145 207 2.0E-06
sp|Q8N7X1|RMXL3_HUMAN RNA-binding motif protein, X-linked-like-3 OS=Homo sapiens GN=RBMXL3 PE=2 SV=2 127 206 3.0E-06
sp|O93235|CIRBA_XENLA Cold-inducible RNA-binding protein A OS=Xenopus laevis GN=cirbp-a PE=1 SV=2 127 207 3.0E-06
sp|Q96E39|RMXL1_HUMAN RNA binding motif protein, X-linked-like-1 OS=Homo sapiens GN=RBMXL1 PE=1 SV=1 119 207 3.0E-06
sp|Q9WV02|RBMX_MOUSE RNA-binding motif protein, X chromosome OS=Mus musculus GN=Rbmx PE=1 SV=1 119 207 4.0E-06
sp|Q4V898|RBMX_RAT RNA-binding motif protein, X chromosome OS=Rattus norvegicus GN=Rbmx PE=1 SV=1 119 207 4.0E-06
sp|Q4R7F0|RBMX_MACFA RNA-binding motif protein, X chromosome OS=Macaca fascicularis GN=RBMX PE=2 SV=1 119 207 5.0E-06
sp|A5A6M3|RBMX_PANTR RNA-binding motif protein, X chromosome OS=Pan troglodytes GN=RBMX PE=2 SV=1 119 207 5.0E-06
sp|P38159|RBMX_HUMAN RNA-binding motif protein, X chromosome OS=Homo sapiens GN=RBMX PE=1 SV=3 119 207 5.0E-06
sp|O35698|RBY1A_MOUSE RNA-binding motif protein, Y chromosome, family 1 member A1 OS=Mus musculus GN=Rbmy1a1 PE=1 SV=2 127 210 5.0E-06
sp|P84586|RMXRL_RAT RNA-binding motif protein, X chromosome retrogene-like OS=Rattus norvegicus GN=Rbmxrtl PE=1 SV=1 119 207 6.0E-06
sp|Q60990|RBY1B_MOUSE RNA-binding motif protein, Y chromosome, family 1 member B OS=Mus musculus GN=Rbmy1b PE=2 SV=3 127 210 6.0E-06
sp|D4AE41|RMXL1_RAT RNA binding motif protein, X-linked-like-1 OS=Rattus norvegicus GN=Rbmxl1 PE=3 SV=1 119 207 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0003723 RNA binding Yes
GO:0097159 organic cyclic compound binding No
GO:0003674 molecular_function No
GO:0003676 nucleic acid binding No
GO:1901363 heterocyclic compound binding No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 23 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|1775
MTDRLPPNLLALFAPRPPLRWCEPIDKPLEQRRTARISPVTPYLEELKKYKETDVYHPTESWLEARDRKKEEKRE
ATRKLLEEEPKKCTPPEPLDSPLSPESGTDTTAELVNPEEDANIRGDALSTMIVARISYEADERDLERHFARFGP
IERIRLVKDTHAHEKPNKKPKPHRGYAFIVFERESDMKMAVRTCDGDRIKGRPIKTDVERGRTVQGFRPRRLGGG
LGGRGYTKIVPMRPGGPRSFNDGFRGPYRGFDGGRSRGGRGRGGGYRGDFGGPRGDRNSFGPPSGAPSGPGGSDR
RNGDRGYSGLGYEPRGPGRHDDRQGGYRDGAGRFGDRDGGRRTGSNMEPIGRRDGGYRDRDRDRDRDRDRERDRD
RGRDRRDYDRPRDDENRKRGYEGGGYDESRKMPRY*
Coding >Ophun1|1775
ATGACTGATAGGCTGCCCCCCAACCTTCTCGCGCTCTTCGCGCCGCGACCTCCCCTGCGCTGGTGTGAACCCATC
GATAAACCTCTCGAGCAGCGCCGCACGGCCAGAATCTCGCCTGTCACGCCCTACCTCGAGGAGCTGAAGAAGTAC
AAGGAGACGGACGTCTATCACCCTACCGAAAGCTGGCTCGAGGCTCGCGACCGCAAGAAGGAAGAGAAGAGGGAG
GCCACCAGGAAGCTTCTCGAGGAGGAGCCCAAGAAATGTACACCGCCTGAGCCGCTTGATTCCCCTCTGTCCCCA
GAATCGGGAACTGACACTACCGCTGAGCTAGTCAATCCTGAGGAGGATGCTAACATCAGAGGCGATGCTCTCTCC
ACCATGATTGTGGCCCGCATCAGCTACGAGGCTGATGAGCGTGACCTGGAGAGGCACTTTGCCCGTTTTGGTCCC
ATCGAACGCATTCGTCTCGTCAAAGACACCCATGCTCATGAGAAGCCCAACAAGAAGCCGAAGCCTCACCGAGGC
TACGCTTTTATTGTTTTTGAACGCGAGTCCGACATGAAAATGGCCGTCAGGACTTGTGATGGCGATCGCATCAAG
GGCAGACCCATCAAGACGGACGTCGAACGAGGCCGAACCGTCCAAGGATTCAGGCCCAGAAGACTTGGAGGTGGT
CTCGGAGGTCGCGGCTACACCAAGATCGTGCCCATGCGTCCCGGCGGCCCTCGCAGCTTCAACGATGGCTTCCGT
GGACCATACAGAGGCTTCGACGGTGGCCGTTCTCGCGGCGGACGCGGCCGTGGTGGAGGCTACCGAGGTGATTTC
GGCGGCCCTCGAGGCGATAGAAATAGCTTCGGTCCACCCAGTGGAGCGCCGTCTGGACCGGGAGGATCCGACAGG
CGCAACGGCGATCGTGGCTACTCTGGACTCGGATACGAACCGCGCGGACCTGGACGTCACGACGACAGACAAGGC
GGCTATCGCGACGGGGCCGGCCGATTTGGCGACCGTGATGGCGGGCGCAGGACTGGAAGCAACATGGAGCCGATC
GGCCGTCGAGATGGTGGGTATCGCGATCGGGACCGCGACCGCGACCGTGACCGTGACCGCGAACGCGACAGGGAC
CGAGGCCGGGATCGACGGGACTACGACCGACCGCGTGACGATGAGAACCGGAAACGAGGATACGAGGGAGGAGGC
TACGATGAGTCCCGGAAAATGCCGCGATACTGA
Transcript >Ophun1|1775
ATGACTGATAGGCTGCCCCCCAACCTTCTCGCGCTCTTCGCGCCGCGACCTCCCCTGCGCTGGTGTGAACCCATC
GATAAACCTCTCGAGCAGCGCCGCACGGCCAGAATCTCGCCTGTCACGCCCTACCTCGAGGAGCTGAAGAAGTAC
AAGGAGACGGACGTCTATCACCCTACCGAAAGCTGGCTCGAGGCTCGCGACCGCAAGAAGGAAGAGAAGAGGGAG
GCCACCAGGAAGCTTCTCGAGGAGGAGCCCAAGAAATGTACACCGCCTGAGCCGCTTGATTCCCCTCTGTCCCCA
GAATCGGGAACTGACACTACCGCTGAGCTAGTCAATCCTGAGGAGGATGCTAACATCAGAGGCGATGCTCTCTCC
ACCATGATTGTGGCCCGCATCAGCTACGAGGCTGATGAGCGTGACCTGGAGAGGCACTTTGCCCGTTTTGGTCCC
ATCGAACGCATTCGTCTCGTCAAAGACACCCATGCTCATGAGAAGCCCAACAAGAAGCCGAAGCCTCACCGAGGC
TACGCTTTTATTGTTTTTGAACGCGAGTCCGACATGAAAATGGCCGTCAGGACTTGTGATGGCGATCGCATCAAG
GGCAGACCCATCAAGACGGACGTCGAACGAGGCCGAACCGTCCAAGGATTCAGGCCCAGAAGACTTGGAGGTGGT
CTCGGAGGTCGCGGCTACACCAAGATCGTGCCCATGCGTCCCGGCGGCCCTCGCAGCTTCAACGATGGCTTCCGT
GGACCATACAGAGGCTTCGACGGTGGCCGTTCTCGCGGCGGACGCGGCCGTGGTGGAGGCTACCGAGGTGATTTC
GGCGGCCCTCGAGGCGATAGAAATAGCTTCGGTCCACCCAGTGGAGCGCCGTCTGGACCGGGAGGATCCGACAGG
CGCAACGGCGATCGTGGCTACTCTGGACTCGGATACGAACCGCGCGGACCTGGACGTCACGACGACAGACAAGGC
GGCTATCGCGACGGGGCCGGCCGATTTGGCGACCGTGATGGCGGGCGCAGGACTGGAAGCAACATGGAGCCGATC
GGCCGTCGAGATGGTGGGTATCGCGATCGGGACCGCGACCGCGACCGTGACCGTGACCGCGAACGCGACAGGGAC
CGAGGCCGGGATCGACGGGACTACGACCGACCGCGTGACGATGAGAACCGGAAACGAGGATACGAGGGAGGAGGC
TACGATGAGTCCCGGAAAATGCCGCGATACTGA
Gene >Ophun1|1775
ATGACTGATAGGCTGCCCCCCAACCTTCTCGCGCTCTTCGCGCCGCGACCTCCCCTGCGCTGGTGTGAACCCATC
GATAAACCTCTCGAGCAGCGCCGCACGGCCAGAATCTCGCCTGTCACGCCCTACCTCGAGGAGCTGAAGAAGTAC
AAGGAGACGGACGTCTATCACCCTACCGAAAGCTGGCTCGAGGCTCGCGACCGCAAGAAGGAAGAGAAGAGGGAG
GCCACCAGGAAGCTTCTCGAGGAGGAGCCCAAGAAATGTACACCGCCTGAGCCGCTTGATTCCCCTCTGTCCCCA
GAATCGGGAACTGACACTACCGCTGAGCTAGTCAATCCTGAGGAGGATGCTAACATCAGAGGCGATGCTCTCTCC
ACCATGATTGTGGCCCGCATCAGCTACGAGGCTGATGAGCGTGACCTGGAGAGGCACTTTGCCCGTTTTGGTCCC
ATCGAACGCGTTTGTTTACCCTGTCATCTCTTCTCACTTTTAACCCCGCCTTCTCTTTCGCTGCTGACGTCGTCC
CTAGATTCGTCTCGTCAAAGACACCCATGCTCATGAGAAGCCCAACAAGAAGCCGAAGCCTCACCGAGGCTACGC
TTTTATTGTTTTTGAACGCGAGTCCGACATGAAAAGTAAGTACTCTACTGCAACGTAGGTCGTGTAGCATGACTA
ATAGCTGGCAGTGGCCGTCAGGACTTGTGATGGCGATCGCATCAAGGGCAGACCCATCAAGACGGACGTCGAACG
AGGCCGAACCGTCCAAGGATTCAGGCCCAGAAGACTTGGAGGTGGTCTCGGAGGTCGCGGCTACACCAAGATCGT
GCCCATGCGTCCCGGCGGCCCTCGCAGCTTCAACGATGGCTTCCGTGGACCATACAGAGGCTTCGACGGTGGCCG
TTCTCGCGGCGGACGCGGCCGTGGTGGAGGCTACCGAGGTGATTTCGGCGGCCCTCGAGGCGATAGAAATAGCTT
CGGTCCACCCAGTGGAGCGCCGTCTGGACCGGGAGGATCCGACAGGCGCAACGGCGATCGTGGCTACTCTGGACT
CGGATACGAACCGCGCGGACCTGGACGTCACGACGACAGACAAGGCGGCTATCGCGACGGGGCCGGCCGATTTGG
CGACCGTGATGGCGGGCGCAGGACTGGAAGCAACATGGAGCCGATCGGCCGTCGAGATGGTGGGTATCGCGATCG
GGACCGCGACCGCGACCGTGACCGTGACCGCGAACGCGACAGGGACCGAGGCCGGGATCGACGGGACTACGACCG
ACCGCGTGACGATGAGAACCGGAAACGAGGATACGAGGGAGGAGGCTACGATGAGTCCCGGAAAATGCCGCGATA
CTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail