Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|1773
Gene name
LocationContig_178:20579..21488
Strand+
Gene length (bp)909
Transcript length (bp)744
Coding sequence length (bp)744
Protein length (aa) 248

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00121 TIM Triosephosphate isomerase 5.0E-89 6 243

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q7S2Z9|TPIS_NEUCR Triosephosphate isomerase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=tpi-1 PE=3 SV=1 1 244 3.0E-118
sp|P04828|TPIS_EMENI Triosephosphate isomerase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=tpiA PE=3 SV=1 1 245 2.0E-117
sp|Q96VN5|TPIS_PARBA Triosephosphate isomerase OS=Paracoccidioides lutzii (strain ATCC MYA-826 / Pb01) GN=TPI1 PE=1 SV=3 1 245 2.0E-112
sp|Q9HGY8|TPIS_ASPOR Triosephosphate isomerase OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=tpiA PE=2 SV=1 1 245 3.0E-111
sp|Q6BMB8|TPIS_DEBHA Triosephosphate isomerase OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=TPI1 PE=3 SV=1 1 245 3.0E-102
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q7S2Z9|TPIS_NEUCR Triosephosphate isomerase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=tpi-1 PE=3 SV=1 1 244 3.0E-118
sp|P04828|TPIS_EMENI Triosephosphate isomerase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=tpiA PE=3 SV=1 1 245 2.0E-117
sp|Q96VN5|TPIS_PARBA Triosephosphate isomerase OS=Paracoccidioides lutzii (strain ATCC MYA-826 / Pb01) GN=TPI1 PE=1 SV=3 1 245 2.0E-112
sp|Q9HGY8|TPIS_ASPOR Triosephosphate isomerase OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=tpiA PE=2 SV=1 1 245 3.0E-111
sp|Q6BMB8|TPIS_DEBHA Triosephosphate isomerase OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=TPI1 PE=3 SV=1 1 245 3.0E-102
sp|Q6C2T9|TPIS_YARLI Triosephosphate isomerase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=TPI1 PE=3 SV=1 1 245 1.0E-100
sp|Q12574|TPIS_COPC7 Triosephosphate isomerase OS=Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003) GN=TPI PE=3 SV=2 1 246 2.0E-97
sp|Q6CJG5|TPIS_KLULA Triosephosphate isomerase OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=TPI1 PE=3 SV=2 1 245 6.0E-96
sp|P48491|TPIS_ARATH Triosephosphate isomerase, cytosolic OS=Arabidopsis thaliana GN=CTIMC PE=1 SV=2 1 242 7.0E-95
sp|Q5R928|TPIS_PONAB Triosephosphate isomerase OS=Pongo abelii GN=TPI1 PE=2 SV=1 2 246 1.0E-94
sp|P46226|TPIS_SECCE Triosephosphate isomerase, cytosolic OS=Secale cereale PE=2 SV=3 1 243 1.0E-94
sp|P60175|TPIS_PANTR Triosephosphate isomerase OS=Pan troglodytes GN=TPI1 PE=2 SV=2 2 246 1.0E-94
sp|Q9C401|TPIS_ZYGBA Triosephosphate isomerase OS=Zygosaccharomyces bailii GN=TPI1 PE=3 SV=1 1 245 1.0E-94
sp|P07669|TPIS_SCHPO Triosephosphate isomerase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tpi1 PE=1 SV=4 1 245 2.0E-94
sp|P54714|TPIS_CANLF Triosephosphate isomerase OS=Canis lupus familiaris GN=TPI1 PE=1 SV=3 2 246 2.0E-94
sp|P00939|TPIS_RABIT Triosephosphate isomerase OS=Oryctolagus cuniculus GN=TPI1 PE=1 SV=1 2 246 3.0E-94
sp|P60174|TPIS_HUMAN Triosephosphate isomerase OS=Homo sapiens GN=TPI1 PE=1 SV=3 2 246 3.0E-94
sp|Q5E956|TPIS_BOVIN Triosephosphate isomerase OS=Bos taurus GN=TPI1 PE=2 SV=3 2 246 4.0E-94
sp|P15426|TPIS_MACMU Triosephosphate isomerase OS=Macaca mulatta GN=TPI1 PE=3 SV=2 2 246 4.0E-94
sp|Q60HC9|TPIS_MACFA Triosephosphate isomerase OS=Macaca fascicularis GN=TPI1 PE=2 SV=3 2 246 4.0E-94
sp|Q2QD07|TPIS_GORGO Triosephosphate isomerase OS=Gorilla gorilla gorilla GN=TPI1 PE=3 SV=1 2 246 5.0E-94
sp|Q9P940|TPIS_CANAL Triosephosphate isomerase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=TPI1 PE=1 SV=3 1 245 5.0E-94
sp|Q70JN8|TPIS_KLUMA Triosephosphate isomerase OS=Kluyveromyces marxianus GN=TPI1 PE=3 SV=1 1 245 1.0E-93
sp|Q10657|TPIS_CAEEL Triosephosphate isomerase OS=Caenorhabditis elegans GN=tpi-1 PE=1 SV=2 1 245 2.0E-93
sp|Q6FRI3|TPIS_CANGA Triosephosphate isomerase OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=TPI1 PE=3 SV=1 1 245 2.0E-93
sp|P00940|TPIS_CHICK Triosephosphate isomerase OS=Gallus gallus GN=TPI1 PE=1 SV=2 3 245 2.0E-93
sp|P12863|TPIS_MAIZE Triosephosphate isomerase, cytosolic OS=Zea mays PE=3 SV=3 1 243 3.0E-93
sp|P48500|TPIS_RAT Triosephosphate isomerase OS=Rattus norvegicus GN=Tpi1 PE=1 SV=2 2 246 4.0E-93
sp|Q1MTI4|TPISA_DANRE Triosephosphate isomerase A OS=Danio rerio GN=tpi1a PE=2 SV=1 2 245 6.0E-93
sp|P48494|TPIS_ORYSJ Triosephosphate isomerase, cytosolic OS=Oryza sativa subsp. japonica GN=TPI PE=1 SV=3 1 243 1.0E-92
sp|P82204|TPIS_BOMMO Triosephosphate isomerase OS=Bombyx mori GN=Tpi PE=1 SV=2 1 246 2.0E-92
sp|B0BM40|TPIS_XENTR Triosephosphate isomerase OS=Xenopus tropicalis GN=tpi1 PE=2 SV=1 2 246 2.0E-91
sp|P17751|TPIS_MOUSE Triosephosphate isomerase OS=Mus musculus GN=Tpi1 PE=1 SV=4 3 246 2.0E-91
sp|Q7ZWN5|TPIS_XENLA Triosephosphate isomerase OS=Xenopus laevis GN=tpi1 PE=2 SV=1 3 245 5.0E-91
sp|P48495|TPIS_PETHY Triosephosphate isomerase, cytosolic OS=Petunia hybrida GN=TPIP1 PE=2 SV=1 1 242 6.0E-91
sp|P30741|TPIS_CULTA Triosephosphate isomerase OS=Culex tarsalis GN=Tpi PE=1 SV=2 1 246 6.0E-91
sp|Q29371|TPIS_PIG Triosephosphate isomerase OS=Sus scrofa GN=TPI1 PE=2 SV=4 2 245 6.0E-91
sp|Q90XG0|TPISB_DANRE Triosephosphate isomerase B OS=Danio rerio GN=tpi1b PE=2 SV=1 3 245 3.0E-90
sp|O77458|TPIS_DROYA Triosephosphate isomerase OS=Drosophila yakuba GN=Tpi PE=2 SV=1 1 246 6.0E-90
sp|Q7JNS1|TPIS_DROSI Triosephosphate isomerase OS=Drosophila simulans GN=Tpi PE=3 SV=1 1 246 6.0E-90
sp|Q589R5|TPIS_ORYLA Triosephosphate isomerase OS=Oryzias latipes GN=tpi1 PE=3 SV=1 3 245 1.0E-89
sp|P29613|TPIS_DROME Triosephosphate isomerase OS=Drosophila melanogaster GN=Tpi PE=1 SV=3 1 246 2.0E-89
sp|P48496|TPIC_SPIOL Triosephosphate isomerase, chloroplastic OS=Spinacia oleracea GN=TPIP1 PE=1 SV=1 4 243 2.0E-89
sp|P00942|TPIS_YEAST Triosephosphate isomerase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPI1 PE=1 SV=2 1 245 4.0E-89
sp|Q750Y8|TPIS_ASHGO Triosephosphate isomerase OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=TPI1 PE=3 SV=2 1 246 4.0E-89
sp|Q9SKP6|TPIC_ARATH Triosephosphate isomerase, chloroplastic OS=Arabidopsis thaliana GN=TIM PE=1 SV=1 4 243 1.0E-88
sp|Q9M4S8|TPIC_FRAAN Triosephosphate isomerase, chloroplastic OS=Fragaria ananassa GN=TPI PE=2 SV=1 4 244 3.0E-88
sp|P46225|TPIC_SECCE Triosephosphate isomerase, chloroplastic OS=Secale cereale PE=1 SV=1 4 243 1.0E-87
sp|Q27775|TPIS_SCHJA Triosephosphate isomerase OS=Schistosoma japonicum GN=TPI PE=2 SV=1 2 246 1.0E-86
sp|Q9GTX8|TPIS_TAESO Triosephosphate isomerase OS=Taenia solium PE=2 SV=1 1 246 9.0E-86
sp|P34937|TPIS_HORVU Triosephosphate isomerase, cytosolic OS=Hordeum vulgare PE=1 SV=3 1 243 7.0E-85
sp|P00941|TPIS_LATCH Triosephosphate isomerase OS=Latimeria chalumnae PE=1 SV=1 3 246 3.0E-84
sp|P21820|TPIS_COPJA Triosephosphate isomerase, cytosolic OS=Coptis japonica PE=2 SV=1 1 242 6.0E-84
sp|P48501|TPIS_SCHMA Triosephosphate isomerase OS=Schistosoma mansoni GN=TPI PE=1 SV=1 2 246 1.0E-83
sp|P48497|TPIS_STELP Triosephosphate isomerase, cytosolic OS=Stellaria longipes GN=TPI PE=2 SV=1 1 243 5.0E-83
sp|P48492|TPIS_GRAGA Triosephosphate isomerase, cytosolic (Fragment) OS=Gracilaria gracilis GN=TPI1 PE=3 SV=1 10 246 2.0E-77
sp|P36186|TPI1_GIAIN Triosephosphate isomerase OS=Giardia intestinalis PE=1 SV=1 2 243 3.0E-73
sp|Q07412|TPIS_PLAFA Triosephosphate isomerase OS=Plasmodium falciparum GN=TPI PE=1 SV=1 1 242 7.0E-73
sp|Q7KQM0|TPIS_PLAF7 Triosephosphate isomerase OS=Plasmodium falciparum (isolate 3D7) GN=TPI PE=3 SV=1 1 242 7.0E-73
sp|P36187|TPI2_GIAIN Triosephosphate isomerase OS=Giardia intestinalis PE=3 SV=1 2 243 4.0E-72
sp|P48499|TPIS_LEIME Triosephosphate isomerase OS=Leishmania mexicana PE=1 SV=1 8 246 4.0E-72
sp|P52270|TPIS_TRYCR Triosephosphate isomerase, glycosomal OS=Trypanosoma cruzi PE=1 SV=1 8 246 7.0E-72
sp|P48493|TPIS_LACSA Triosephosphate isomerase, cytosolic (Fragment) OS=Lactuca sativa PE=2 SV=1 58 242 3.0E-71
sp|Q869R8|TPIS_DICDI Triosephosphate isomerase OS=Dictyostelium discoideum GN=tpiA PE=3 SV=1 3 242 9.0E-70
sp|O02611|TPIS_ENTHI Triosephosphate isomerase OS=Entamoeba histolytica GN=TPI PE=1 SV=2 2 243 5.0E-69
sp|Q31HG2|TPIS_THICR Triosephosphate isomerase OS=Thiomicrospira crunogena (strain XCL-2) GN=tpiA PE=3 SV=1 3 234 1.0E-68
sp|Q5WT18|TPIS_LEGPL Triosephosphate isomerase OS=Legionella pneumophila (strain Lens) GN=tpiA PE=3 SV=1 3 244 3.0E-67
sp|P91895|TPIS_ANOME Triosephosphate isomerase (Fragment) OS=Anopheles merus GN=Tpi PE=3 SV=1 19 223 4.0E-67
sp|Q5ZRT6|TPIS_LEGPH Triosephosphate isomerase OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=tpiA PE=3 SV=1 3 244 1.0E-66
sp|A5IHW5|TPIS_LEGPC Triosephosphate isomerase OS=Legionella pneumophila (strain Corby) GN=tpiA PE=3 SV=1 3 244 1.0E-66
sp|P92119|TPIS_AEDTO Triosephosphate isomerase (Fragment) OS=Aedes togoi GN=Tpi PE=3 SV=1 19 223 3.0E-66
sp|P04789|TPIS_TRYBB Triosephosphate isomerase, glycosomal OS=Trypanosoma brucei brucei PE=1 SV=2 10 246 4.0E-66
sp|Q5X1A5|TPIS_LEGPA Triosephosphate isomerase OS=Legionella pneumophila (strain Paris) GN=tpiA PE=3 SV=1 3 244 5.0E-66
sp|P55275|TPIS_HELVI Triosephosphate isomerase (Fragment) OS=Heliothis virescens GN=Tpi PE=3 SV=1 13 225 1.0E-65
sp|P91919|TPIS_CULPI Triosephosphate isomerase (Fragment) OS=Culex pipiens GN=Tpi PE=3 SV=1 19 223 9.0E-65
sp|Q2SML7|TPIS_HAHCH Triosephosphate isomerase OS=Hahella chejuensis (strain KCTC 2396) GN=tpiA PE=3 SV=1 3 242 6.0E-63
sp|Q4KIF9|TPIS_PSEF5 Triosephosphate isomerase OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=tpiA PE=3 SV=1 3 234 4.0E-62
sp|B3QV54|TPIS_CHLT3 Triosephosphate isomerase OS=Chloroherpeton thalassium (strain ATCC 35110 / GB-78) GN=tpiA PE=3 SV=1 3 242 5.0E-62
sp|Q3KI88|TPIS_PSEPF Triosephosphate isomerase OS=Pseudomonas fluorescens (strain Pf0-1) GN=tpiA PE=3 SV=1 3 234 6.0E-62
sp|Q9HV51|TPIS_PSEAE Triosephosphate isomerase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=tpiA PE=3 SV=1 3 234 3.0E-61
sp|Q02FS4|TPIS_PSEAB Triosephosphate isomerase OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=tpiA PE=3 SV=1 3 234 3.0E-61
sp|B7V1G0|TPIS_PSEA8 Triosephosphate isomerase OS=Pseudomonas aeruginosa (strain LESB58) GN=tpiA PE=3 SV=1 3 234 3.0E-61
sp|Q3YV59|TPIS_SHISS Triosephosphate isomerase OS=Shigella sonnei (strain Ss046) GN=tpiA PE=3 SV=1 3 244 3.0E-61
sp|P0A861|TPIS_SHIFL Triosephosphate isomerase OS=Shigella flexneri GN=tpiA PE=3 SV=1 3 244 3.0E-61
sp|Q0SZA9|TPIS_SHIF8 Triosephosphate isomerase OS=Shigella flexneri serotype 5b (strain 8401) GN=tpiA PE=3 SV=1 3 244 3.0E-61
sp|Q32A84|TPIS_SHIDS Triosephosphate isomerase OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=tpiA PE=3 SV=1 3 244 3.0E-61
sp|Q31U71|TPIS_SHIBS Triosephosphate isomerase OS=Shigella boydii serotype 4 (strain Sb227) GN=tpiA PE=3 SV=1 3 244 3.0E-61
sp|B2TVR1|TPIS_SHIB3 Triosephosphate isomerase OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=tpiA PE=3 SV=1 3 244 3.0E-61
sp|B7LVC6|TPIS_ESCF3 Triosephosphate isomerase OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=tpiA PE=3 SV=1 3 244 3.0E-61
sp|Q1R3Z9|TPIS_ECOUT Triosephosphate isomerase OS=Escherichia coli (strain UTI89 / UPEC) GN=tpiA PE=3 SV=1 3 244 3.0E-61
sp|B1LNM2|TPIS_ECOSM Triosephosphate isomerase OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=tpiA PE=3 SV=1 3 244 3.0E-61
sp|B6I4R2|TPIS_ECOSE Triosephosphate isomerase OS=Escherichia coli (strain SE11) GN=tpiA PE=3 SV=1 3 244 3.0E-61
sp|B7NFL6|TPIS_ECOLU Triosephosphate isomerase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=tpiA PE=3 SV=1 3 244 3.0E-61
sp|P0A858|TPIS_ECOLI Triosephosphate isomerase OS=Escherichia coli (strain K12) GN=tpiA PE=1 SV=1 3 244 3.0E-61
sp|B1IVG0|TPIS_ECOLC Triosephosphate isomerase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=tpiA PE=3 SV=1 3 244 3.0E-61
sp|P0A859|TPIS_ECOL6 Triosephosphate isomerase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=tpiA PE=3 SV=1 3 244 3.0E-61
sp|Q0TAE5|TPIS_ECOL5 Triosephosphate isomerase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=tpiA PE=3 SV=1 3 244 3.0E-61
sp|A1AI95|TPIS_ECOK1 Triosephosphate isomerase OS=Escherichia coli O1:K1 / APEC GN=tpiA PE=3 SV=1 3 244 3.0E-61
sp|A8A724|TPIS_ECOHS Triosephosphate isomerase OS=Escherichia coli O9:H4 (strain HS) GN=tpiA PE=3 SV=1 3 244 3.0E-61
sp|B1XB85|TPIS_ECODH Triosephosphate isomerase OS=Escherichia coli (strain K12 / DH10B) GN=tpiA PE=1 SV=1 3 244 3.0E-61
sp|B7M6X0|TPIS_ECO8A Triosephosphate isomerase OS=Escherichia coli O8 (strain IAI1) GN=tpiA PE=3 SV=1 3 244 3.0E-61
sp|B7NU88|TPIS_ECO7I Triosephosphate isomerase OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=tpiA PE=3 SV=1 3 244 3.0E-61
sp|B5YZ57|TPIS_ECO5E Triosephosphate isomerase OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=tpiA PE=3 SV=1 3 244 3.0E-61
sp|P0A860|TPIS_ECO57 Triosephosphate isomerase OS=Escherichia coli O157:H7 GN=tpiA PE=3 SV=1 3 244 3.0E-61
sp|B7MI51|TPIS_ECO45 Triosephosphate isomerase OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=tpiA PE=3 SV=1 3 244 3.0E-61
sp|A7ZUD3|TPIS_ECO24 Triosephosphate isomerase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=tpiA PE=3 SV=1 3 244 3.0E-61
sp|A6VCK5|TPIS_PSEA7 Triosephosphate isomerase OS=Pseudomonas aeruginosa (strain PA7) GN=tpiA PE=3 SV=1 3 234 4.0E-61
sp|Q88DV4|TPIS_PSEPK Triosephosphate isomerase OS=Pseudomonas putida (strain KT2440) GN=tpiA PE=3 SV=1 3 234 6.0E-61
sp|A5W991|TPIS_PSEP1 Triosephosphate isomerase OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=tpiA PE=3 SV=1 3 234 6.0E-61
sp|Q8ZKP7|TPIS_SALTY Triosephosphate isomerase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=tpiA PE=3 SV=1 3 244 7.0E-61
sp|B4TPU2|TPIS_SALSV Triosephosphate isomerase OS=Salmonella schwarzengrund (strain CVM19633) GN=tpiA PE=3 SV=1 3 244 7.0E-61
sp|B4T0S7|TPIS_SALNS Triosephosphate isomerase OS=Salmonella newport (strain SL254) GN=tpiA PE=3 SV=1 3 244 7.0E-61
sp|B4TCL7|TPIS_SALHS Triosephosphate isomerase OS=Salmonella heidelberg (strain SL476) GN=tpiA PE=3 SV=1 3 244 7.0E-61
sp|Q57HD6|TPIS_SALCH Triosephosphate isomerase OS=Salmonella choleraesuis (strain SC-B67) GN=tpiA PE=3 SV=1 3 244 7.0E-61
sp|B5F0R2|TPIS_SALA4 Triosephosphate isomerase OS=Salmonella agona (strain SL483) GN=tpiA PE=3 SV=1 3 244 7.0E-61
sp|B0KHY2|TPIS_PSEPG Triosephosphate isomerase OS=Pseudomonas putida (strain GB-1) GN=tpiA PE=3 SV=1 3 234 8.0E-61
sp|B5BJJ8|TPIS_SALPK Triosephosphate isomerase OS=Salmonella paratyphi A (strain AKU_12601) GN=tpiA PE=3 SV=1 3 244 8.0E-61
sp|A9MZG8|TPIS_SALPB Triosephosphate isomerase OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=tpiA PE=3 SV=1 3 244 8.0E-61
sp|Q5PJE0|TPIS_SALPA Triosephosphate isomerase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=tpiA PE=3 SV=1 3 244 8.0E-61
sp|B5RF90|TPIS_SALG2 Triosephosphate isomerase OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=tpiA PE=3 SV=1 3 244 8.0E-61
sp|B5QX14|TPIS_SALEP Triosephosphate isomerase OS=Salmonella enteritidis PT4 (strain P125109) GN=tpiA PE=3 SV=1 3 244 8.0E-61
sp|B5FPS9|TPIS_SALDC Triosephosphate isomerase OS=Salmonella dublin (strain CT_02021853) GN=tpiA PE=3 SV=1 3 244 8.0E-61
sp|A1U604|TPIS_MARHV Triosephosphate isomerase OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=tpiA PE=3 SV=1 3 245 1.0E-60
sp|B1J266|TPIS_PSEPW Triosephosphate isomerase OS=Pseudomonas putida (strain W619) GN=tpiA PE=3 SV=1 3 234 1.0E-60
sp|A6SY03|TPIS_JANMA Triosephosphate isomerase OS=Janthinobacterium sp. (strain Marseille) GN=tpiA PE=3 SV=1 3 243 1.0E-60
sp|A4G646|TPIS_HERAR Triosephosphate isomerase OS=Herminiimonas arsenicoxydans GN=tpiA PE=3 SV=1 3 242 2.0E-60
sp|Q8Z2Y2|TPIS_SALTI Triosephosphate isomerase OS=Salmonella typhi GN=tpiA PE=3 SV=1 3 244 4.0E-60
sp|A4WG77|TPIS_ENT38 Triosephosphate isomerase OS=Enterobacter sp. (strain 638) GN=tpiA PE=3 SV=1 3 244 5.0E-60
sp|A8FYS4|TPIS_SHESH Triosephosphate isomerase OS=Shewanella sediminis (strain HAW-EB3) GN=tpiA PE=3 SV=1 3 234 7.0E-60
sp|A8H744|TPIS_SHEPA Triosephosphate isomerase OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=tpiA PE=3 SV=1 3 234 7.0E-60
sp|A4VPP4|TPIS_PSEU5 Triosephosphate isomerase OS=Pseudomonas stutzeri (strain A1501) GN=tpiA PE=3 SV=1 3 235 9.0E-60
sp|Q7X222|TPIS_KLEPN Triosephosphate isomerase OS=Klebsiella pneumoniae GN=tpiA PE=3 SV=1 3 242 2.0E-59
sp|Q12QI5|TPIS_SHEDO Triosephosphate isomerase OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=tpiA PE=3 SV=1 3 234 3.0E-59
sp|A1RGX1|TPIS_SHESW Triosephosphate isomerase OS=Shewanella sp. (strain W3-18-1) GN=tpiA PE=3 SV=1 3 234 4.0E-59
sp|A4Y9C4|TPIS_SHEPC Triosephosphate isomerase OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=tpiA PE=3 SV=1 3 234 4.0E-59
sp|A9KZX5|TPIS_SHEB9 Triosephosphate isomerase OS=Shewanella baltica (strain OS195) GN=tpiA PE=3 SV=1 3 234 4.0E-59
sp|A6WRH2|TPIS_SHEB8 Triosephosphate isomerase OS=Shewanella baltica (strain OS185) GN=tpiA PE=3 SV=1 3 234 4.0E-59
sp|A3D7L0|TPIS_SHEB5 Triosephosphate isomerase OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=tpiA PE=3 SV=1 3 234 4.0E-59
sp|Q9Z6B9|TPIS_ENTCL Triosephosphate isomerase OS=Enterobacter cloacae GN=tpiA PE=3 SV=1 3 244 4.0E-59
sp|A1APN8|TPIS_PELPD Triosephosphate isomerase OS=Pelobacter propionicus (strain DSM 2379) GN=tpiA PE=3 SV=1 3 245 5.0E-59
sp|Q48E73|TPIS_PSE14 Triosephosphate isomerase OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=tpiA PE=3 SV=1 3 234 6.0E-59
sp|Q1IF47|TPIS_PSEE4 Triosephosphate isomerase OS=Pseudomonas entomophila (strain L48) GN=tpiA PE=3 SV=1 3 234 6.0E-59
sp|Q47YJ8|TPIS_COLP3 Triosephosphate isomerase OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=tpiA PE=3 SV=1 1 242 8.0E-59
sp|A1S458|TPIS_SHEAM Triosephosphate isomerase OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=tpiA PE=3 SV=1 3 234 9.0E-59
sp|P43727|TPIS_HAEIN Triosephosphate isomerase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=tpiA PE=1 SV=1 1 235 1.0E-58
sp|A5UE39|TPIS_HAEIE Triosephosphate isomerase OS=Haemophilus influenzae (strain PittEE) GN=tpiA PE=3 SV=1 1 235 1.0E-58
sp|Q0HLG5|TPIS_SHESM Triosephosphate isomerase OS=Shewanella sp. (strain MR-4) GN=tpiA PE=3 SV=1 3 234 2.0E-58
sp|Q0HXR9|TPIS_SHESR Triosephosphate isomerase OS=Shewanella sp. (strain MR-7) GN=tpiA PE=3 SV=1 3 234 2.0E-58
sp|A0KTZ2|TPIS_SHESA Triosephosphate isomerase OS=Shewanella sp. (strain ANA-3) GN=tpiA PE=3 SV=1 3 234 2.0E-58
sp|Q8EHL9|TPIS_SHEON Triosephosphate isomerase OS=Shewanella oneidensis (strain MR-1) GN=tpiA PE=3 SV=1 3 234 2.0E-58
sp|B0BTK6|TPIS_ACTPJ Triosephosphate isomerase OS=Actinobacillus pleuropneumoniae serotype 3 (strain JL03) GN=tpiA PE=3 SV=1 1 242 2.0E-58
sp|B3H2Z6|TPIS_ACTP7 Triosephosphate isomerase OS=Actinobacillus pleuropneumoniae serotype 7 (strain AP76) GN=tpiA PE=3 SV=1 1 242 2.0E-58
sp|A3N3L9|TPIS_ACTP2 Triosephosphate isomerase OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=tpiA PE=3 SV=1 1 242 2.0E-58
sp|A3QGU9|TPIS_SHELP Triosephosphate isomerase OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=tpiA PE=3 SV=1 3 234 2.0E-58
sp|B0TQA6|TPIS_SHEHH Triosephosphate isomerase OS=Shewanella halifaxensis (strain HAW-EB4) GN=tpiA PE=3 SV=1 3 234 2.0E-58
sp|A5UHG7|TPIS_HAEIG Triosephosphate isomerase OS=Haemophilus influenzae (strain PittGG) GN=tpiA PE=3 SV=1 1 235 2.0E-58
sp|Q4QMN8|TPIS_HAEI8 Triosephosphate isomerase OS=Haemophilus influenzae (strain 86-028NP) GN=tpiA PE=3 SV=1 1 235 2.0E-58
sp|B1KRR4|TPIS_SHEWM Triosephosphate isomerase OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=tpiA PE=3 SV=1 3 234 2.0E-58
sp|Q8P7T0|TPIS_XANCP Triosephosphate isomerase OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=tpiA PE=3 SV=1 3 234 2.0E-58
sp|Q4UWC0|TPIS_XANC8 Triosephosphate isomerase OS=Xanthomonas campestris pv. campestris (strain 8004) GN=tpiA PE=3 SV=1 3 234 2.0E-58
sp|Q60B10|TPIS_METCA Triosephosphate isomerase OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=tpiA PE=3 SV=1 3 243 3.0E-58
sp|Q3IE60|TPIS_PSEHT Triosephosphate isomerase OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=tpiA PE=3 SV=1 2 246 3.0E-58
sp|B4F161|TPIS_PROMH Triosephosphate isomerase OS=Proteus mirabilis (strain HI4320) GN=tpiA PE=3 SV=1 3 242 4.0E-58
sp|P57936|TPIS_PASMU Triosephosphate isomerase OS=Pasteurella multocida (strain Pm70) GN=tpiA PE=3 SV=1 1 242 4.0E-58
sp|Q88YH4|TPIS_LACPL Triosephosphate isomerase OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=tpiA PE=3 SV=1 3 247 6.0E-58
sp|Q3BRM7|TPIS_XANC5 Triosephosphate isomerase OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=tpiA PE=3 SV=1 3 234 6.0E-58
sp|Q086H6|TPIS_SHEFN Triosephosphate isomerase OS=Shewanella frigidimarina (strain NCIMB 400) GN=tpiA PE=3 SV=1 3 234 7.0E-58
sp|B2FNY1|TPIS_STRMK Triosephosphate isomerase OS=Stenotrophomonas maltophilia (strain K279a) GN=tpiA PE=3 SV=1 3 234 8.0E-58
sp|A8GLA8|TPIS_SERP5 Triosephosphate isomerase OS=Serratia proteamaculans (strain 568) GN=tpiA PE=3 SV=1 3 242 9.0E-58
sp|Q8PJ38|TPIS_XANAC Triosephosphate isomerase OS=Xanthomonas axonopodis pv. citri (strain 306) GN=tpiA PE=3 SV=1 3 234 9.0E-58
sp|B8CKG9|TPIS_SHEPW Triosephosphate isomerase OS=Shewanella piezotolerans (strain WP3 / JCM 13877) GN=tpiA PE=3 SV=1 3 234 9.0E-58
sp|A1JHZ7|TPIS_YERE8 Triosephosphate isomerase OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=tpiA PE=3 SV=1 3 242 1.0E-57
sp|O52633|TPIS_CLOAB Triosephosphate isomerase OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=tpiA PE=3 SV=1 3 243 1.0E-57
sp|Q0I591|TPIS_HAES1 Triosephosphate isomerase OS=Haemophilus somnus (strain 129Pt) GN=tpiA PE=3 SV=1 1 242 1.0E-57
sp|B3WCW6|TPIS_LACCB Triosephosphate isomerase OS=Lactobacillus casei (strain BL23) GN=tpiA PE=3 SV=1 3 243 1.0E-57
sp|Q03AK5|TPIS_LACC3 Triosephosphate isomerase OS=Lactobacillus casei (strain ATCC 334) GN=tpiA PE=3 SV=1 3 243 1.0E-57
sp|B2SVM1|TPIS_XANOP Triosephosphate isomerase OS=Xanthomonas oryzae pv. oryzae (strain PXO99A) GN=tpiA PE=3 SV=1 3 234 1.0E-57
sp|Q2P0V3|TPIS_XANOM Triosephosphate isomerase OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=tpiA PE=3 SV=1 3 234 1.0E-57
sp|A4XYE4|TPIS_PSEMY Triosephosphate isomerase OS=Pseudomonas mendocina (strain ymp) GN=tpiA PE=3 SV=1 3 234 1.0E-57
sp|Q3A4X5|TPIS_PELCD Triosephosphate isomerase OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=tpiA PE=3 SV=1 3 234 1.0E-57
sp|B4SQT8|TPIS_STRM5 Triosephosphate isomerase OS=Stenotrophomonas maltophilia (strain R551-3) GN=tpiA PE=3 SV=1 3 234 1.0E-57
sp|A7GUR9|TPIS_BACCN Triosephosphate isomerase OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=tpiA PE=3 SV=1 3 246 2.0E-57
sp|B0URI5|TPIS_HISS2 Triosephosphate isomerase OS=Histophilus somni (strain 2336) GN=tpiA PE=3 SV=1 1 242 2.0E-57
sp|A9KPF8|TPIS_CLOPH Triosephosphate isomerase OS=Clostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg) GN=tpiA PE=3 SV=1 3 245 2.0E-57
sp|A1SWS5|TPIS_PSYIN Triosephosphate isomerase OS=Psychromonas ingrahamii (strain 37) GN=tpiA PE=3 SV=1 3 246 2.0E-57
sp|Q11PZ7|TPIS_CYTH3 Triosephosphate isomerase OS=Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469) GN=tpiA PE=3 SV=1 3 241 2.0E-57
sp|A0L8V0|TPIS_MAGMM Triosephosphate isomerase OS=Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1) GN=tpiA PE=3 SV=1 3 235 3.0E-57
sp|A6LR06|TPIS_CLOB8 Triosephosphate isomerase OS=Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052) GN=tpiA PE=3 SV=1 3 243 3.0E-57
sp|P86216|TPIS_MESAU Triosephosphate isomerase (Fragments) OS=Mesocricetus auratus GN=TPI1 PE=1 SV=1 4 246 4.0E-57
sp|A5FE44|TPIS_FLAJ1 Triosephosphate isomerase OS=Flavobacterium johnsoniae (strain ATCC 17061 / DSM 2064 / UW101) GN=tpiA PE=3 SV=1 3 235 4.0E-57
sp|B3QPT6|TPIS_CHLP8 Triosephosphate isomerase OS=Chlorobaculum parvum (strain NCIB 8327) GN=tpiA PE=3 SV=1 3 235 5.0E-57
sp|Q7VN27|TPIS_HAEDU Triosephosphate isomerase OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=tpiA PE=3 SV=1 1 242 5.0E-57
sp|Q21YC9|TPIS_RHOFT Triosephosphate isomerase OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) GN=tpiA PE=3 SV=1 3 242 6.0E-57
sp|B0S1G9|TPIS_FINM2 Triosephosphate isomerase OS=Finegoldia magna (strain ATCC 29328) GN=tpiA PE=3 SV=1 3 243 8.0E-57
sp|Q87WQ1|TPIS_PSESM Triosephosphate isomerase OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=tpiA PE=3 SV=1 3 234 8.0E-57
sp|Q0KCT2|TPIS_CUPNH Triosephosphate isomerase OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=tpiA PE=3 SV=1 3 243 9.0E-57
sp|Q4L4K5|TPIS_STAHJ Triosephosphate isomerase OS=Staphylococcus haemolyticus (strain JCSC1435) GN=tpiA PE=3 SV=1 3 235 2.0E-56
sp|B1JQ90|TPIS_YERPY Triosephosphate isomerase OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=tpiA PE=3 SV=1 3 242 2.0E-56
sp|Q66GA1|TPIS_YERPS Triosephosphate isomerase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=tpiA PE=3 SV=1 3 242 2.0E-56
sp|A4TSA1|TPIS_YERPP Triosephosphate isomerase OS=Yersinia pestis (strain Pestoides F) GN=tpiA PE=3 SV=1 3 242 2.0E-56
sp|Q1CD40|TPIS_YERPN Triosephosphate isomerase OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=tpiA PE=3 SV=1 3 242 2.0E-56
sp|A9R6B0|TPIS_YERPG Triosephosphate isomerase OS=Yersinia pestis bv. Antiqua (strain Angola) GN=tpiA PE=3 SV=1 3 242 2.0E-56
sp|Q8ZJK9|TPIS_YERPE Triosephosphate isomerase OS=Yersinia pestis GN=tpiA PE=3 SV=1 3 242 2.0E-56
sp|B2JZB1|TPIS_YERPB Triosephosphate isomerase OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=tpiA PE=3 SV=1 3 242 2.0E-56
sp|Q1C2A4|TPIS_YERPA Triosephosphate isomerase OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=tpiA PE=3 SV=1 3 242 2.0E-56
sp|A7FCW8|TPIS_YERP3 Triosephosphate isomerase OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=tpiA PE=3 SV=1 3 242 2.0E-56
sp|P95576|TPIS_PSEU2 Triosephosphate isomerase OS=Pseudomonas syringae pv. syringae (strain B728a) GN=tpiA PE=3 SV=1 3 234 2.0E-56
sp|Q4A5S6|TPIS_MYCS5 Triosephosphate isomerase OS=Mycoplasma synoviae (strain 53) GN=tpiA PE=3 SV=1 1 242 3.0E-56
sp|Q7UP89|TPIS_RHOBA Triosephosphate isomerase OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=tpiA PE=3 SV=1 1 235 4.0E-56
sp|Q8A0U2|TPIS_BACTN Triosephosphate isomerase OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=tpiA PE=3 SV=1 3 235 4.0E-56
sp|Q56738|TPIS_VIBSA Triosephosphate isomerase OS=Vibrio sp. (strain ANT-300) GN=tpiA PE=3 SV=1 3 234 6.0E-56
sp|Q6MSF2|TPIS_MYCMS Triosephosphate isomerase OS=Mycoplasma mycoides subsp. mycoides SC (strain PG1) GN=tpiA PE=3 SV=1 3 234 7.0E-56
sp|A1WXW9|TPIS_HALHL Triosephosphate isomerase OS=Halorhodospira halophila (strain DSM 244 / SL1) GN=tpiA PE=3 SV=1 3 244 7.0E-56
sp|A6GZI2|TPIS_FLAPJ Triosephosphate isomerase OS=Flavobacterium psychrophilum (strain JIP02/86 / ATCC 49511) GN=tpiA PE=3 SV=1 3 243 7.0E-56
sp|Q7MH47|TPIS_VIBVY Triosephosphate isomerase OS=Vibrio vulnificus (strain YJ016) GN=tpiA PE=3 SV=1 3 234 1.0E-55
sp|Q8DCQ3|TPIS_VIBVU Triosephosphate isomerase OS=Vibrio vulnificus (strain CMCP6) GN=tpiA PE=3 SV=1 3 234 1.0E-55
sp|A7INK7|TPIS_XANP2 Triosephosphate isomerase OS=Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2) GN=tpiA PE=3 SV=1 2 237 1.0E-55
sp|B3R3W5|TPIS_CUPTR Triosephosphate isomerase OS=Cupriavidus taiwanensis (strain R1 / LMG 19424) GN=tpiA PE=3 SV=1 3 235 1.0E-55
sp|Q898R2|TPIS_CLOTE Triosephosphate isomerase OS=Clostridium tetani (strain Massachusetts / E88) GN=tpiA PE=3 SV=1 3 245 2.0E-55
sp|B2VF53|TPIS_ERWT9 Triosephosphate isomerase OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=tpiA PE=3 SV=1 3 235 2.0E-55
sp|A6KXL2|TPIS_BACV8 Triosephosphate isomerase OS=Bacteroides vulgatus (strain ATCC 8482 / DSM 1447 / NCTC 11154) GN=tpiA PE=3 SV=1 3 235 2.0E-55
sp|Q64P83|TPIS_BACFR Triosephosphate isomerase OS=Bacteroides fragilis (strain YCH46) GN=tpiA PE=3 SV=1 3 243 2.0E-55
sp|Q5L923|TPIS_BACFN Triosephosphate isomerase OS=Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / JCM 11019 / NCTC 9343) GN=tpiA PE=3 SV=1 3 243 2.0E-55
sp|B1GZW3|TPIS_UNCTG Triosephosphate isomerase OS=Uncultured termite group 1 bacterium phylotype Rs-D17 GN=tpiA PE=3 SV=1 3 246 3.0E-55
sp|A8MFY0|TPIS_ALKOO Triosephosphate isomerase OS=Alkaliphilus oremlandii (strain OhILAs) GN=tpiA PE=3 SV=1 3 243 3.0E-55
sp|B7IP22|TPIS_BACC2 Triosephosphate isomerase OS=Bacillus cereus (strain G9842) GN=tpiA PE=3 SV=1 3 246 3.0E-55
sp|Q0VSS5|TPIS_ALCBS Triosephosphate isomerase OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=tpiA PE=3 SV=1 1 234 3.0E-55
sp|Q8RDX7|TPIS_FUSNN Triosephosphate isomerase OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) GN=tpiA PE=3 SV=1 3 244 3.0E-55
sp|A9VQ50|TPIS_BACWK Triosephosphate isomerase OS=Bacillus weihenstephanensis (strain KBAB4) GN=tpiA PE=3 SV=1 3 246 4.0E-55
sp|Q6HBF1|TPIS_BACHK Triosephosphate isomerase OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=tpiA PE=3 SV=1 3 246 4.0E-55
sp|Q631M0|TPIS_BACCZ Triosephosphate isomerase OS=Bacillus cereus (strain ZK / E33L) GN=tpiA PE=3 SV=1 3 246 4.0E-55
sp|P60180|TPIS_BACCR Putative triosephosphate isomerase OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=tpiA PE=5 SV=1 3 246 4.0E-55
sp|Q4MQ55|TPIS_BACCE Triosephosphate isomerase OS=Bacillus cereus GN=tpiA PE=1 SV=2 3 246 4.0E-55
sp|B7HED4|TPIS_BACC4 Triosephosphate isomerase OS=Bacillus cereus (strain B4264) GN=tpiA PE=3 SV=1 3 246 4.0E-55
sp|B0K6X4|TPIS_THEPX Triosephosphate isomerase OS=Thermoanaerobacter sp. (strain X514) GN=tpiA PE=3 SV=1 3 243 4.0E-55
sp|A6LFF0|TPIS_PARD8 Triosephosphate isomerase OS=Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / NCTC 11152) GN=tpiA PE=3 SV=1 3 242 5.0E-55
sp|Q72XY3|TPIS_BACC1 Triosephosphate isomerase OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=tpiA PE=3 SV=1 3 246 5.0E-55
sp|B7HW54|TPIS_BACC7 Triosephosphate isomerase OS=Bacillus cereus (strain AH187) GN=tpiA PE=3 SV=1 3 246 6.0E-55
sp|B7JFG5|TPIS_BACC0 Triosephosphate isomerase OS=Bacillus cereus (strain AH820) GN=tpiA PE=3 SV=1 3 246 6.0E-55
sp|Q38Y19|TPIS_LACSS Triosephosphate isomerase OS=Lactobacillus sakei subsp. sakei (strain 23K) GN=tpiA PE=3 SV=1 3 243 7.0E-55
sp|Q473U5|TPIS_CUPPJ Triosephosphate isomerase OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=tpiA PE=3 SV=1 3 235 7.0E-55
sp|Q3B2V8|TPIS_CHLL7 Triosephosphate isomerase OS=Chlorobium luteolum (strain DSM 273 / 2530) GN=tpiA PE=3 SV=1 1 242 7.0E-55
sp|Q8ENP4|TPIS_OCEIH Triosephosphate isomerase OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=tpiA PE=3 SV=1 3 242 8.0E-55
sp|Q8XXP9|TPIS_RALSO Triosephosphate isomerase OS=Ralstonia solanacearum (strain GMI1000) GN=tpiA PE=3 SV=1 2 235 8.0E-55
sp|Q0STD6|TPIS_CLOPS Triosephosphate isomerase OS=Clostridium perfringens (strain SM101 / Type A) GN=tpiA PE=3 SV=1 3 243 9.0E-55
sp|Q8XKU1|TPIS_CLOPE Triosephosphate isomerase OS=Clostridium perfringens (strain 13 / Type A) GN=tpiA PE=1 SV=1 3 243 9.0E-55
sp|Q0TQY8|TPIS_CLOP1 Triosephosphate isomerase OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) GN=tpiA PE=3 SV=1 3 243 9.0E-55
sp|B5EF41|TPIS_GEOBB Triosephosphate isomerase OS=Geobacter bemidjiensis (strain Bem / ATCC BAA-1014 / DSM 16622) GN=tpiA PE=3 SV=1 3 243 9.0E-55
sp|B4S9B0|TPIS_PROA2 Triosephosphate isomerase OS=Prosthecochloris aestuarii (strain DSM 271 / SK 413) GN=tpiA PE=3 SV=1 3 242 1.0E-54
sp|Q2NQX4|TPIS_SODGM Triosephosphate isomerase OS=Sodalis glossinidius (strain morsitans) GN=tpiA PE=3 SV=1 3 242 1.0E-54
sp|Q6CZ81|TPIS_PECAS Triosephosphate isomerase OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=tpiA PE=3 SV=1 3 242 1.0E-54
sp|Q3J827|TPIS_NITOC Triosephosphate isomerase OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=tpiA PE=3 SV=1 3 234 1.0E-54
sp|B0K880|TPIS_THEP3 Triosephosphate isomerase OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=tpiA PE=3 SV=1 3 243 2.0E-54
sp|Q7MWI7|TPIS_PORGI Triosephosphate isomerase OS=Porphyromonas gingivalis (strain ATCC BAA-308 / W83) GN=tpiA PE=3 SV=1 3 242 2.0E-54
sp|B2RII9|TPIS_PORG3 Triosephosphate isomerase OS=Porphyromonas gingivalis (strain ATCC 33277 / DSM 20709 / JCM 12257) GN=tpiA PE=3 SV=1 3 242 2.0E-54
sp|Q81X76|TPIS_BACAN Triosephosphate isomerase OS=Bacillus anthracis GN=tpiA PE=3 SV=1 3 246 2.0E-54
sp|Q0A773|TPIS_ALKEH Triosephosphate isomerase OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=tpiA PE=3 SV=1 3 246 2.0E-54
sp|A1BHJ1|TPIS_CHLPD Triosephosphate isomerase OS=Chlorobium phaeobacteroides (strain DSM 266) GN=tpiA PE=3 SV=1 3 242 2.0E-54
sp|Q2G030|TPIS_STAA8 Triosephosphate isomerase OS=Staphylococcus aureus (strain NCTC 8325) GN=tpiA PE=3 SV=1 3 246 2.0E-54
sp|Q87T31|TPIS_VIBPA Triosephosphate isomerase OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=tpiA PE=3 SV=1 3 234 2.0E-54
sp|A5G381|TPIS_GEOUR Triosephosphate isomerase OS=Geobacter uraniireducens (strain Rf4) GN=tpiA PE=3 SV=1 3 242 2.0E-54
sp|O32757|TPIS_LACDE Triosephosphate isomerase OS=Lactobacillus delbrueckii subsp. bulgaricus GN=tpiA PE=3 SV=1 1 243 3.0E-54
sp|Q04BH0|TPIS_LACDB Triosephosphate isomerase OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC BAA-365) GN=tpiA PE=3 SV=1 1 243 3.0E-54
sp|Q1GB25|TPIS_LACDA Triosephosphate isomerase OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / JCM 1002 / NBRC 13953 / NCIMB 11778) GN=tpiA PE=3 SV=1 1 243 3.0E-54
sp|Q83BQ3|TPIS_COXBU Triosephosphate isomerase OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=tpiA PE=3 SV=1 1 235 3.0E-54
sp|A9N8X5|TPIS_COXBR Triosephosphate isomerase OS=Coxiella burnetii (strain RSA 331 / Henzerling II) GN=tpiA PE=3 SV=1 1 235 3.0E-54
sp|A9KBK2|TPIS_COXBN Triosephosphate isomerase OS=Coxiella burnetii (strain Dugway 5J108-111) GN=tpiA PE=3 SV=1 1 235 3.0E-54
sp|Q2RLU0|TPIS_MOOTA Triosephosphate isomerase OS=Moorella thermoacetica (strain ATCC 39073) GN=tpiA PE=3 SV=1 3 243 3.0E-54
sp|Q1WSX9|TPIS_LACS1 Triosephosphate isomerase OS=Lactobacillus salivarius (strain UCC118) GN=tpiA PE=3 SV=1 3 245 3.0E-54
sp|A1AXX3|TPIS_RUTMC Triosephosphate isomerase OS=Ruthia magnifica subsp. Calyptogena magnifica GN=tpiA PE=3 SV=1 3 235 3.0E-54
sp|Q71WW9|TPIS1_LISMF Triosephosphate isomerase 1 OS=Listeria monocytogenes serotype 4b (strain F2365) GN=tpiA1 PE=3 SV=1 3 237 3.0E-54
sp|Q928I1|TPIS1_LISIN Triosephosphate isomerase 1 OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=tpiA1 PE=3 SV=1 3 237 3.0E-54
sp|P68824|TPIS_STAAW Triosephosphate isomerase OS=Staphylococcus aureus (strain MW2) GN=tpiA PE=3 SV=1 3 246 4.0E-54
sp|P68823|TPIS_STAAU Triosephosphate isomerase OS=Staphylococcus aureus GN=tpiA PE=3 SV=1 3 246 4.0E-54
sp|A8Z1A2|TPIS_STAAT Triosephosphate isomerase OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=tpiA PE=3 SV=1 3 246 4.0E-54
sp|Q6GB56|TPIS_STAAS Triosephosphate isomerase OS=Staphylococcus aureus (strain MSSA476) GN=tpiA PE=3 SV=1 3 246 4.0E-54
sp|Q6GIL6|TPIS_STAAR Triosephosphate isomerase OS=Staphylococcus aureus (strain MRSA252) GN=tpiA PE=1 SV=1 3 246 4.0E-54
sp|P99133|TPIS_STAAN Triosephosphate isomerase OS=Staphylococcus aureus (strain N315) GN=tpiA PE=1 SV=1 3 246 4.0E-54
sp|P68822|TPIS_STAAM Triosephosphate isomerase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=tpiA PE=3 SV=1 3 246 4.0E-54
sp|A6QF83|TPIS_STAAE Triosephosphate isomerase OS=Staphylococcus aureus (strain Newman) GN=tpiA PE=3 SV=1 3 246 4.0E-54
sp|Q5HHP3|TPIS_STAAC Triosephosphate isomerase OS=Staphylococcus aureus (strain COL) GN=tpiA PE=3 SV=1 3 246 4.0E-54
sp|A5IQX8|TPIS_STAA9 Triosephosphate isomerase OS=Staphylococcus aureus (strain JH9) GN=tpiA PE=3 SV=1 3 246 4.0E-54
sp|Q2FIL9|TPIS_STAA3 Triosephosphate isomerase OS=Staphylococcus aureus (strain USA300) GN=tpiA PE=3 SV=1 3 246 4.0E-54
sp|A6TZQ3|TPIS_STAA2 Triosephosphate isomerase OS=Staphylococcus aureus (strain JH1) GN=tpiA PE=3 SV=1 3 246 4.0E-54
sp|A7WZS8|TPIS_STAA1 Triosephosphate isomerase OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=tpiA PE=3 SV=1 3 246 4.0E-54
sp|B2UY22|TPIS_CLOBA Triosephosphate isomerase OS=Clostridium botulinum (strain Alaska E43 / Type E3) GN=tpiA PE=3 SV=1 3 243 4.0E-54
sp|Q93GB7|TPIS_LACDL Triosephosphate isomerase OS=Lactobacillus delbrueckii subsp. lactis GN=tpiA PE=1 SV=1 1 243 5.0E-54
sp|B3E9Q8|TPIS_GEOLS Triosephosphate isomerase OS=Geobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) GN=tpiA PE=3 SV=1 3 245 5.0E-54
sp|A8YUE4|TPIS_LACH4 Triosephosphate isomerase OS=Lactobacillus helveticus (strain DPC 4571) GN=tpiA PE=3 SV=1 1 243 6.0E-54
sp|Q1D8I9|TPIS_MYXXD Triosephosphate isomerase OS=Myxococcus xanthus (strain DK 1622) GN=tpiA PE=3 SV=1 3 235 6.0E-54
sp|Q2YSF0|TPIS_STAAB Triosephosphate isomerase OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=tpiA PE=3 SV=1 3 246 8.0E-54
sp|Q7MYB3|TPIS_PHOLL Triosephosphate isomerase OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=tpiA PE=3 SV=1 3 242 8.0E-54
sp|A0PYP2|TPIS_CLONN Triosephosphate isomerase OS=Clostridium novyi (strain NT) GN=tpiA PE=3 SV=1 3 246 9.0E-54
sp|Q82TU1|TPIS_NITEU Triosephosphate isomerase OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=tpiA PE=3 SV=1 1 241 9.0E-54
sp|P36204|PGKT_THEMA Bifunctional PGK/TIM OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=pgk/tpi PE=1 SV=4 1 241 9.0E-54
sp|Q8Y4I3|TPIS1_LISMO Triosephosphate isomerase 1 OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=tpiA1 PE=3 SV=1 3 237 1.0E-53
sp|Q8E0H0|TPIS_STRA5 Triosephosphate isomerase OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=tpiA PE=3 SV=1 1 235 1.0E-53
sp|Q8E644|TPIS_STRA3 Triosephosphate isomerase OS=Streptococcus agalactiae serotype III (strain NEM316) GN=tpiA PE=3 SV=1 1 235 1.0E-53
sp|Q3K1U3|TPIS_STRA1 Triosephosphate isomerase OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=tpiA PE=3 SV=1 1 235 1.0E-53
sp|B2TPX3|TPIS_CLOBB Triosephosphate isomerase OS=Clostridium botulinum (strain Eklund 17B / Type B) GN=tpiA PE=3 SV=1 3 243 1.0E-53
sp|B5FFY1|TPIS_VIBFM Triosephosphate isomerase OS=Vibrio fischeri (strain MJ11) GN=tpiA PE=3 SV=1 3 234 1.0E-53
sp|Q5E8E5|TPIS_VIBF1 Triosephosphate isomerase OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=tpiA PE=3 SV=1 3 234 1.0E-53
sp|Q2SRB2|TPIS_MYCCT Triosephosphate isomerase OS=Mycoplasma capricolum subsp. capricolum (strain California kid / ATCC 27343 / NCTC 10154) GN=tpiA PE=3 SV=1 3 234 2.0E-53
sp|A5CVF7|TPIS_VESOH Triosephosphate isomerase OS=Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA) GN=tpiA PE=3 SV=1 3 235 2.0E-53
sp|Q8KCH7|TPIS_CHLTE Triosephosphate isomerase OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=tpiA PE=3 SV=1 9 234 2.0E-53
sp|P35144|TPIS_BACMD Triosephosphate isomerase OS=Bacillus megaterium (strain DSM 319) GN=tpiA PE=3 SV=1 3 246 2.0E-53
sp|Q49W01|TPIS_STAS1 Triosephosphate isomerase OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=tpiA PE=3 SV=1 3 246 3.0E-53
sp|P50919|TPIS_MYCHR Triosephosphate isomerase OS=Mycoplasma hyorhinis GN=tpiA PE=3 SV=1 4 246 3.0E-53
sp|A3DBQ1|TPIS_CLOTH Triosephosphate isomerase OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=tpiA PE=3 SV=1 1 235 4.0E-53
sp|A5UZW4|TPIS_ROSS1 Triosephosphate isomerase OS=Roseiflexus sp. (strain RS-1) GN=tpiA PE=3 SV=1 3 243 5.0E-53
sp|Q9K715|TPIS_BACHD Triosephosphate isomerase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=tpiA PE=3 SV=1 3 246 6.0E-53
sp|Q9KNR1|TPIS_VIBCH Triosephosphate isomerase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=tpiA PE=3 SV=2 3 234 6.0E-53
sp|A4ISP6|TPIS_GEOTN Triosephosphate isomerase OS=Geobacillus thermodenitrificans (strain NG80-2) GN=tpiA PE=3 SV=1 3 247 8.0E-53
sp|Q98QA8|TPIS_MYCPU Triosephosphate isomerase OS=Mycoplasma pulmonis (strain UAB CTIP) GN=tpiA PE=3 SV=1 3 242 8.0E-53
sp|Q03GW6|TPIS_PEDPA Triosephosphate isomerase OS=Pediococcus pentosaceus (strain ATCC 25745 / 183-1w) GN=tpiA PE=3 SV=1 3 245 9.0E-53
sp|A7Z8Y3|TPIS_BACMF Triosephosphate isomerase OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=tpiA PE=3 SV=1 3 242 1.0E-52
sp|B3EPH5|TPIS_CHLPB Triosephosphate isomerase OS=Chlorobium phaeobacteroides (strain BS1) GN=tpiA PE=3 SV=1 3 243 1.0E-52
sp|Q253S1|TPIS_CHLFF Triosephosphate isomerase OS=Chlamydophila felis (strain Fe/C-56) GN=tpiA PE=3 SV=1 1 242 1.0E-52
sp|Q0S0J3|TPIS_RHOJR Triosephosphate isomerase OS=Rhodococcus jostii (strain RHA1) GN=tpiA PE=3 SV=1 1 235 1.0E-52
sp|Q1QSY6|TPIS_CHRSD Triosephosphate isomerase OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=tpiA PE=3 SV=1 3 235 1.0E-52
sp|A0Q8C4|TPIS_FRATN Triosephosphate isomerase OS=Francisella tularensis subsp. novicida (strain U112) GN=tpiA PE=3 SV=1 6 243 1.0E-52
sp|B6EPI8|TPIS_ALISL Triosephosphate isomerase OS=Aliivibrio salmonicida (strain LFI1238) GN=tpiA PE=3 SV=1 3 234 1.0E-52
sp|A6TU32|TPIS_ALKMQ Triosephosphate isomerase OS=Alkaliphilus metalliredigens (strain QYMF) GN=tpiA PE=3 SV=1 3 243 1.0E-52
sp|Q3AFD0|TPIS_CARHZ Triosephosphate isomerase OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=tpiA PE=3 SV=1 3 235 1.0E-52
sp|Q8CTD5|TPIS_STAES Triosephosphate isomerase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=tpiA PE=3 SV=1 3 246 2.0E-52
sp|Q5HQV2|TPIS_STAEQ Triosephosphate isomerase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=tpiA PE=3 SV=1 3 246 2.0E-52
sp|Q01SE4|TPIS_SOLUE Triosephosphate isomerase OS=Solibacter usitatus (strain Ellin6076) GN=tpiA PE=3 SV=1 3 243 2.0E-52
sp|A7G9Y1|TPIS_CLOBL Triosephosphate isomerase OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) GN=tpiA PE=3 SV=1 3 243 2.0E-52
sp|Q39U97|TPIS_GEOMG Triosephosphate isomerase OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=tpiA PE=3 SV=1 3 245 2.0E-52
sp|Q7VZT5|TPIS_BORPE Triosephosphate isomerase OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=tpiA PE=3 SV=1 3 234 2.0E-52
sp|Q7W575|TPIS_BORPA Triosephosphate isomerase OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=tpiA PE=3 SV=1 3 234 2.0E-52
sp|Q7WCQ5|TPIS_BORBR Triosephosphate isomerase OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=tpiA PE=3 SV=1 3 234 2.0E-52
sp|A4TC25|TPIS_MYCGI Triosephosphate isomerase OS=Mycobacterium gilvum (strain PYR-GCK) GN=tpiA PE=3 SV=1 1 234 2.0E-52
sp|A7FQN8|TPIS_CLOB1 Triosephosphate isomerase OS=Clostridium botulinum (strain ATCC 19397 / Type A) GN=tpiA PE=3 SV=1 3 243 2.0E-52
sp|B1KTJ6|TPIS_CLOBM Triosephosphate isomerase OS=Clostridium botulinum (strain Loch Maree / Type A3) GN=tpiA PE=3 SV=1 3 243 3.0E-52
sp|B1IDB7|TPIS_CLOBK Triosephosphate isomerase OS=Clostridium botulinum (strain Okra / Type B1) GN=tpiA PE=3 SV=1 3 243 3.0E-52
sp|Q5NII7|TPIS_FRATT Triosephosphate isomerase OS=Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4) GN=tpiA PE=3 SV=1 6 243 3.0E-52
sp|Q14JZ0|TPIS_FRAT1 Triosephosphate isomerase OS=Francisella tularensis subsp. tularensis (strain FSC 198) GN=tpiA PE=3 SV=1 6 243 3.0E-52
sp|B1YLE0|TPIS_EXIS2 Triosephosphate isomerase OS=Exiguobacterium sibiricum (strain DSM 17290 / JCM 13490 / 255-15) GN=tpiA PE=3 SV=1 3 235 3.0E-52
sp|Q03LW9|TPIS_STRTD Triosephosphate isomerase OS=Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9) GN=tpiA PE=3 SV=1 1 246 3.0E-52
sp|Q8VVC1|TPIS_STRT2 Triosephosphate isomerase OS=Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311) GN=tpiA PE=3 SV=2 1 246 3.0E-52
sp|Q5M100|TPIS_STRT1 Triosephosphate isomerase OS=Streptococcus thermophilus (strain CNRZ 1066) GN=tpiA PE=3 SV=1 1 246 3.0E-52
sp|Q5FL49|TPIS_LACAC Triosephosphate isomerase OS=Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM) GN=tpiA PE=3 SV=1 1 243 4.0E-52
sp|Q0BKA0|TPIS_FRATO Triosephosphate isomerase OS=Francisella tularensis subsp. holarctica (strain OSU18) GN=tpiA PE=3 SV=1 6 243 4.0E-52
sp|P96763|TPIS_FRATH Triosephosphate isomerase OS=Francisella tularensis subsp. holarctica (strain LVS) GN=tpiA PE=3 SV=2 6 243 4.0E-52
sp|A7NEF8|TPIS_FRATF Triosephosphate isomerase OS=Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA) GN=tpiA PE=3 SV=2 6 243 4.0E-52
sp|B0TWU2|TPIS_FRAP2 Triosephosphate isomerase OS=Francisella philomiragia subsp. philomiragia (strain ATCC 25017) GN=tpiA PE=3 SV=1 6 243 5.0E-52
sp|Q5YTQ6|TPIS_NOCFA Triosephosphate isomerase OS=Nocardia farcinica (strain IFM 10152) GN=tpiA PE=3 SV=1 1 235 5.0E-52
sp|O66686|TPIS_AQUAE Triosephosphate isomerase OS=Aquifex aeolicus (strain VF5) GN=tpiA PE=3 SV=1 6 242 5.0E-52
sp|A5N2N7|TPIS_CLOK5 Triosephosphate isomerase OS=Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680) GN=tpiA PE=3 SV=1 3 243 5.0E-52
sp|Q8R966|TPIS_CALS4 Triosephosphate isomerase OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=tpiA PE=3 SV=1 3 243 5.0E-52
sp|Q1MP91|TPIS_LAWIP Triosephosphate isomerase OS=Lawsonia intracellularis (strain PHE/MN1-00) GN=tpiA PE=3 SV=1 4 244 6.0E-52
sp|A9BNB6|TPIS_DELAS Triosephosphate isomerase OS=Delftia acidovorans (strain DSM 14801 / SPH-1) GN=tpiA PE=3 SV=1 1 242 6.0E-52
sp|P27876|TPIS_BACSU Triosephosphate isomerase OS=Bacillus subtilis (strain 168) GN=tpiA PE=1 SV=3 3 242 6.0E-52
sp|P50921|TPIS_MORMI Triosephosphate isomerase OS=Moritella marina GN=tpiA PE=1 SV=1 3 234 7.0E-52
sp|A8FHJ2|TPIS_BACP2 Triosephosphate isomerase OS=Bacillus pumilus (strain SAFR-032) GN=tpiA PE=3 SV=1 3 242 7.0E-52
sp|B7J0Z1|TPIS_BORBZ Triosephosphate isomerase OS=Borrelia burgdorferi (strain ZS7) GN=tpiA PE=3 SV=1 3 243 8.0E-52
sp|Q59182|TPIS_BORBU Triosephosphate isomerase OS=Borrelia burgdorferi (strain ATCC 35210 / B31 / CIP 102532 / DSM 4680) GN=tpiA PE=3 SV=2 3 243 8.0E-52
sp|Q1AUH8|TPIS_RUBXD Triosephosphate isomerase OS=Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129) GN=tpiA PE=3 SV=1 3 246 8.0E-52
sp|Q74K79|TPIS_LACJO Triosephosphate isomerase OS=Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533) GN=tpiA PE=3 SV=1 3 243 1.0E-51
sp|Q823U7|TPIS_CHLCV Triosephosphate isomerase OS=Chlamydophila caviae (strain GPIC) GN=tpiA PE=3 SV=1 1 242 1.0E-51
sp|A4VTQ8|TPIS_STRSY Triosephosphate isomerase OS=Streptococcus suis (strain 05ZYH33) GN=tpiA PE=3 SV=1 1 243 1.0E-51
sp|A4VZZ4|TPIS_STRS2 Triosephosphate isomerase OS=Streptococcus suis (strain 98HAH33) GN=tpiA PE=3 SV=1 1 243 1.0E-51
sp|Q1GIL9|TPIS_RUEST Triosephosphate isomerase OS=Ruegeria sp. (strain TM1040) GN=tpiA PE=3 SV=1 1 242 2.0E-51
sp|Q65EN0|TPIS_BACLD Triosephosphate isomerase OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=tpiA PE=3 SV=1 3 247 2.0E-51
sp|Q5KVE5|TPIS_GEOKA Triosephosphate isomerase OS=Geobacillus kaustophilus (strain HTA426) GN=tpiA PE=3 SV=1 3 247 3.0E-51
sp|Q0SPB0|TPIS_BORAP Triosephosphate isomerase OS=Borrelia afzelii (strain PKo) GN=tpiA PE=3 SV=1 3 243 4.0E-51
sp|Q662V9|TPIS_BORBP Triosephosphate isomerase OS=Borrelia bavariensis (strain ATCC BAA-2496 / DSM 23469 / PBi) GN=tpiA PE=3 SV=1 3 243 4.0E-51
sp|Q0AHK2|TPIS_NITEC Triosephosphate isomerase OS=Nitrosomonas eutropha (strain C91) GN=tpiA PE=3 SV=1 1 241 5.0E-51
sp|Q6KHM5|TPIS_MYCMO Triosephosphate isomerase OS=Mycoplasma mobile (strain ATCC 43663 / 163K / NCTC 11711) GN=tpiA PE=3 SV=1 3 242 6.0E-51
sp|B6YRU5|TPIS_AZOPC Triosephosphate isomerase OS=Azobacteroides pseudotrichonymphae genomovar. CFP2 GN=tpiA PE=3 SV=1 3 242 7.0E-51
sp|Q042F3|TPIS_LACGA Triosephosphate isomerase OS=Lactobacillus gasseri (strain ATCC 33323 / DSM 20243 / JCM 1131 / NCIMB 11718 / AM63) GN=tpiA PE=3 SV=1 3 243 8.0E-51
sp|B2S1P0|TPIS_BORHD Triosephosphate isomerase OS=Borrelia hermsii (strain HS1 / DAH) GN=tpiA PE=3 SV=1 3 243 2.0E-50
sp|Q8FT67|TPIS_COREF Triosephosphate isomerase OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) GN=tpiA PE=3 SV=1 1 234 2.0E-50
sp|Q8EW34|TPIS_MYCPE Triosephosphate isomerase OS=Mycoplasma penetrans (strain HF-2) GN=tpiA PE=3 SV=1 4 242 2.0E-50
sp|B5YE97|TPIS_DICT6 Triosephosphate isomerase OS=Dictyoglomus thermophilum (strain ATCC 35947 / DSM 3960 / H-6-12) GN=tpiA PE=3 SV=1 3 242 2.0E-50
sp|B2SEZ7|TPIS_FRATM Triosephosphate isomerase OS=Francisella tularensis subsp. mediasiatica (strain FSC147) GN=tpiA PE=3 SV=1 6 243 2.0E-50
sp|Q3ATA5|TPIS_CHLCH Triosephosphate isomerase OS=Chlorobium chlorochromatii (strain CaD3) GN=tpiA PE=3 SV=1 3 242 2.0E-50
sp|B0SSU4|TPIS_LEPBP Triosephosphate isomerase OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / ATCC 23582 / Paris) GN=tpiA PE=3 SV=1 3 235 2.0E-50
sp|B0SB22|TPIS_LEPBA Triosephosphate isomerase OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / Ames) GN=tpiA PE=3 SV=1 3 235 2.0E-50
sp|B7GL26|TPIS_ANOFW Triosephosphate isomerase OS=Anoxybacillus flavithermus (strain DSM 21510 / WK1) GN=tpiA PE=3 SV=1 3 246 3.0E-50
sp|Q9PK66|TPIS_CHLMU Triosephosphate isomerase OS=Chlamydia muridarum (strain MoPn / Nigg) GN=tpiA PE=3 SV=1 4 243 4.0E-50
sp|A4SXQ5|TPIS_POLSQ Triosephosphate isomerase OS=Polynucleobacter necessarius subsp. asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1) GN=tpiA PE=3 SV=1 3 236 5.0E-50
sp|B8E2R2|TPIS_DICTD Triosephosphate isomerase OS=Dictyoglomus turgidum (strain Z-1310 / DSM 6724) GN=tpiA PE=3 SV=1 3 242 5.0E-50
sp|Q5WDK7|TPIS_BACSK Triosephosphate isomerase OS=Bacillus clausii (strain KSM-K16) GN=tpiA PE=3 SV=1 3 246 6.0E-50
sp|Q5LQ75|TPIS_RUEPO Triosephosphate isomerase OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=tpiA PE=3 SV=1 3 243 6.0E-50
sp|A4SFM8|TPIS_CHLPM Triosephosphate isomerase OS=Chlorobium phaeovibrioides (strain DSM 265 / 1930) GN=tpiA PE=3 SV=1 1 235 6.0E-50
sp|Q1GZK6|TPIS_METFK Triosephosphate isomerase OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=tpiA PE=3 SV=1 1 234 6.0E-50
sp|Q73NB9|TPIS_TREDE Triosephosphate isomerase OS=Treponema denticola (strain ATCC 35405 / CIP 103919 / DSM 14222) GN=tpiA PE=3 SV=1 3 235 7.0E-50
sp|Q5L6H0|TPIS_CHLAB Triosephosphate isomerase OS=Chlamydophila abortus (strain DSM 27085 / S26/3) GN=tpiA PE=3 SV=1 1 242 7.0E-50
sp|Q03SL6|TPIS_LACBA Triosephosphate isomerase OS=Lactobacillus brevis (strain ATCC 367 / JCM 1170) GN=tpiA PE=3 SV=1 3 243 7.0E-50
sp|B1HVS2|TPIS_LYSSC Triosephosphate isomerase OS=Lysinibacillus sphaericus (strain C3-41) GN=tpiA PE=3 SV=1 3 236 8.0E-50
sp|P00943|TPIS_GEOSE Triosephosphate isomerase OS=Geobacillus stearothermophilus GN=tpiA PE=1 SV=2 3 247 8.0E-50
sp|Q052H8|TPIS_LEPBL Triosephosphate isomerase OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain L550) GN=tpiA PE=3 SV=1 3 235 1.0E-49
sp|Q04TF0|TPIS_LEPBJ Triosephosphate isomerase OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) GN=tpiA PE=3 SV=1 3 235 1.0E-49
sp|A4QEG0|TPIS_CORGB Triosephosphate isomerase OS=Corynebacterium glutamicum (strain R) GN=tpiA PE=3 SV=1 1 234 2.0E-49
sp|A1VDB2|TPIS_DESVV Triosephosphate isomerase OS=Desulfovibrio vulgaris subsp. vulgaris (strain DP4) GN=tpiA PE=3 SV=1 4 235 2.0E-49
sp|Q72BF9|TPIS_DESVH Triosephosphate isomerase OS=Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) GN=tpiA PE=3 SV=1 4 235 2.0E-49
sp|A1TLL4|TPIS_ACIAC Triosephosphate isomerase OS=Acidovorax citrulli (strain AAC00-1) GN=tpiA PE=3 SV=1 1 242 2.0E-49
sp|Q3SJQ7|TPIS_THIDA Triosephosphate isomerase OS=Thiobacillus denitrificans (strain ATCC 25259) GN=tpiA PE=3 SV=1 3 245 2.0E-49
sp|P19583|TPIS_CORGL Triosephosphate isomerase OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=tpiA PE=3 SV=3 1 234 2.0E-49
sp|A8AWA1|TPIS_STRGC Triosephosphate isomerase OS=Streptococcus gordonii (strain Challis / ATCC 35105 / CH1 / DL1 / V288) GN=tpiA PE=3 SV=1 1 235 2.0E-49
sp|A9AUN9|TPIS_HERA2 Triosephosphate isomerase OS=Herpetosiphon aurantiacus (strain ATCC 23779 / DSM 785) GN=tpiA PE=3 SV=1 3 245 3.0E-49
sp|Q47HH8|TPIS_DECAR Triosephosphate isomerase OS=Dechloromonas aromatica (strain RCB) GN=tpiA PE=3 SV=1 3 234 4.0E-49
sp|A1T8L2|TPIS_MYCVP Triosephosphate isomerase OS=Mycobacterium vanbaalenii (strain DSM 7251 / PYR-1) GN=tpiA PE=3 SV=1 1 234 4.0E-49
sp|A7NI03|TPIS_ROSCS Triosephosphate isomerase OS=Roseiflexus castenholzii (strain DSM 13941 / HLO8) GN=tpiA PE=3 SV=1 3 243 4.0E-49
sp|A4FBM6|TPIS_SACEN Triosephosphate isomerase OS=Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338) GN=tpiA PE=3 SV=1 1 234 4.0E-49
sp|O84332|TPIS_CHLTR Triosephosphate isomerase OS=Chlamydia trachomatis (strain D/UW-3/Cx) GN=tpiA PE=3 SV=1 4 243 4.0E-49
sp|Q7NAQ4|TPIS_MYCGA Triosephosphate isomerase OS=Mycoplasma gallisepticum (strain R(low / passage 15 / clone 2)) GN=tpiA PE=3 SV=1 2 245 5.0E-49
sp|Q6A9J2|TPIS_PROAC Triosephosphate isomerase OS=Propionibacterium acnes (strain KPA171202 / DSM 16379) GN=tpiA PE=3 SV=1 1 235 5.0E-49
sp|B2A6Z3|TPIS_NATTJ Triosephosphate isomerase OS=Natranaerobius thermophilus (strain ATCC BAA-1301 / DSM 18059 / JW/NM-WN-LF) GN=tpiA PE=3 SV=1 1 234 5.0E-49
sp|P66943|TPIS_STRR6 Triosephosphate isomerase OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=tpiA PE=3 SV=1 1 235 5.0E-49
sp|P66942|TPIS_STRPN Triosephosphate isomerase OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=tpiA PE=3 SV=1 1 235 5.0E-49
sp|B1ICZ4|TPIS_STRPI Triosephosphate isomerase OS=Streptococcus pneumoniae (strain Hungary19A-6) GN=tpiA PE=3 SV=1 1 235 5.0E-49
sp|B5E6L7|TPIS_STRP4 Triosephosphate isomerase OS=Streptococcus pneumoniae serotype 19F (strain G54) GN=tpiA PE=3 SV=1 1 235 5.0E-49
sp|Q04JH4|TPIS_STRP2 Triosephosphate isomerase OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=tpiA PE=3 SV=1 1 235 5.0E-49
sp|B0BBW0|TPIS_CHLTB Triosephosphate isomerase OS=Chlamydia trachomatis serovar L2b (strain UCH-1/proctitis) GN=tpiA PE=3 SV=1 4 243 7.0E-49
sp|B0B7P5|TPIS_CHLT2 Triosephosphate isomerase OS=Chlamydia trachomatis serovar L2 (strain 434/Bu / ATCC VR-902B) GN=tpiA PE=3 SV=1 4 243 7.0E-49
sp|B1XUJ6|TPIS_POLNS Triosephosphate isomerase OS=Polynucleobacter necessarius subsp. necessarius (strain STIR1) GN=tpiA PE=3 SV=1 3 236 1.0E-48
sp|A5FRB6|TPIS_DEHMB Triosephosphate isomerase OS=Dehalococcoides mccartyi (strain ATCC BAA-2100 / JCM 16839 / KCTC 5957 / BAV1) GN=tpiA PE=3 SV=1 3 246 1.0E-48
sp|Q6MP18|TPIS_BDEBA Triosephosphate isomerase OS=Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100) GN=tpiA PE=3 SV=1 3 235 2.0E-48
sp|Q6AF43|TPIS_LEIXX Triosephosphate isomerase OS=Leifsonia xyli subsp. xyli (strain CTCB07) GN=tpiA PE=3 SV=2 1 247 2.0E-48
sp|Q3ZXC5|TPIS_DEHMC Triosephosphate isomerase OS=Dehalococcoides mccartyi (strain CBDB1) GN=tpiA PE=3 SV=1 3 246 2.0E-48
sp|Q6NH37|TPIS_CORDI Triosephosphate isomerase OS=Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis) GN=tpiA PE=3 SV=1 1 234 2.0E-48
sp|Q3KM32|TPIS_CHLTA Triosephosphate isomerase OS=Chlamydia trachomatis serovar A (strain ATCC VR-571B / DSM 19440 / HAR-13) GN=tpiA PE=3 SV=1 4 243 3.0E-48
sp|Q30ZW0|TPIS_DESAG Triosephosphate isomerase OS=Desulfovibrio alaskensis (strain G20) GN=tpiA PE=3 SV=1 4 235 3.0E-48
sp|Q6MD24|TPIS_PARUW Triosephosphate isomerase OS=Protochlamydia amoebophila (strain UWE25) GN=tpiA PE=3 SV=1 3 243 4.0E-48
sp|Q4A8R0|TPIS_MYCH7 Triosephosphate isomerase OS=Mycoplasma hyopneumoniae (strain 7448) GN=tpiA PE=3 SV=1 9 236 5.0E-48
sp|Q833J0|TPIS_ENTFA Triosephosphate isomerase OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=tpiA PE=3 SV=1 3 246 6.0E-48
sp|P50918|TPIS_LACLA Triosephosphate isomerase OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=tpiA PE=1 SV=3 1 246 9.0E-48
sp|B4SBF7|TPIS_PELPB Triosephosphate isomerase OS=Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1) GN=tpiA PE=3 SV=1 1 234 1.0E-47
sp|P57393|TPIS_BUCAI Triosephosphate isomerase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=tpiA PE=3 SV=1 3 242 1.0E-47
sp|P0C0J5|TPIS_MYCHY Triosephosphate isomerase OS=Mycoplasma hyopneumoniae GN=tpiA PE=3 SV=1 9 236 1.0E-47
sp|Q4AAM8|TPIS_MYCHJ Triosephosphate isomerase OS=Mycoplasma hyopneumoniae (strain J / ATCC 25934 / NCTC 10110) GN=tpiA PE=3 SV=1 9 236 1.0E-47
sp|P0C0J6|TPIS_MYCH2 Triosephosphate isomerase OS=Mycoplasma hyopneumoniae (strain 232) GN=tpiA PE=3 SV=1 9 236 1.0E-47
sp|A2RL40|TPIS_LACLM Triosephosphate isomerase OS=Lactococcus lactis subsp. cremoris (strain MG1363) GN=tpiA PE=3 SV=1 1 246 2.0E-47
sp|Q9Z6J6|TPIS_CHLPN Triosephosphate isomerase OS=Chlamydia pneumoniae GN=tpiA PE=3 SV=2 1 235 2.0E-47
sp|Q02Z48|TPIS_LACLS Triosephosphate isomerase OS=Lactococcus lactis subsp. cremoris (strain SK11) GN=tpiA PE=3 SV=1 1 246 2.0E-47
sp|Q8F5I5|TPIS_LEPIN Triosephosphate isomerase OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=tpiA PE=3 SV=1 3 235 2.0E-47
sp|Q72QL9|TPIS_LEPIC Triosephosphate isomerase OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) GN=tpiA PE=3 SV=1 3 235 3.0E-47
sp|P96744|TPIS_CHLAA Triosephosphate isomerase OS=Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl) GN=tpiA PE=3 SV=2 3 243 3.0E-47
sp|Q741C5|TPIS_MYCPA Triosephosphate isomerase OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=tpiA PE=3 SV=1 1 234 3.0E-47
sp|A0QHY3|TPIS_MYCA1 Triosephosphate isomerase OS=Mycobacterium avium (strain 104) GN=tpiA PE=3 SV=1 1 234 3.0E-47
sp|A1K5A6|TPIS_AZOSB Triosephosphate isomerase OS=Azoarcus sp. (strain BH72) GN=tpiA PE=3 SV=1 6 245 4.0E-47
sp|Q87EQ7|TPIS_XYLFT Triosephosphate isomerase OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=tpiA PE=3 SV=1 3 234 5.0E-47
sp|B2I782|TPIS_XYLF2 Triosephosphate isomerase OS=Xylella fastidiosa (strain M23) GN=tpiA PE=3 SV=1 3 234 5.0E-47
sp|B5YL53|TPIS_THEYD Triosephosphate isomerase OS=Thermodesulfovibrio yellowstonii (strain ATCC 51303 / DSM 11347 / YP87) GN=tpiA PE=3 SV=1 1 236 6.0E-47
sp|Q491Y3|TPIS_BLOPB Triosephosphate isomerase OS=Blochmannia pennsylvanicus (strain BPEN) GN=tpiA PE=3 SV=1 3 234 7.0E-47
sp|B5RKV4|TPIS_BORDL Triosephosphate isomerase OS=Borrelia duttonii (strain Ly) GN=tpiA PE=3 SV=1 3 243 8.0E-47
sp|A5WBS1|TPIS_PSYWF Triosephosphate isomerase OS=Psychrobacter sp. (strain PRwf-1) GN=tpiA PE=3 SV=1 4 244 9.0E-47
sp|Q9PGJ7|TPIS_XYLFA Triosephosphate isomerase OS=Xylella fastidiosa (strain 9a5c) GN=tpiA PE=3 SV=1 3 234 9.0E-47
sp|B4U3U0|TPIS_STREM Triosephosphate isomerase OS=Streptococcus equi subsp. zooepidemicus (strain MGCS10565) GN=tpiA PE=3 SV=1 1 243 9.0E-47
sp|Q1JHV5|TPIS_STRPD Triosephosphate isomerase OS=Streptococcus pyogenes serotype M2 (strain MGAS10270) GN=tpiA PE=3 SV=1 1 243 1.0E-46
sp|B5XKI2|TPIS_STRPZ Triosephosphate isomerase OS=Streptococcus pyogenes serotype M49 (strain NZ131) GN=tpiA PE=3 SV=1 1 243 1.0E-46
sp|P0DG11|TPIS_STRPQ Triosephosphate isomerase OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=tpiA PE=3 SV=1 1 243 1.0E-46
sp|Q48UK4|TPIS_STRPM Triosephosphate isomerase OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=tpiA PE=3 SV=1 1 243 1.0E-46
sp|Q1JMR2|TPIS_STRPC Triosephosphate isomerase OS=Streptococcus pyogenes serotype M12 (strain MGAS9429) GN=tpiA PE=3 SV=1 1 243 1.0E-46
sp|Q1JCT5|TPIS_STRPB Triosephosphate isomerase OS=Streptococcus pyogenes serotype M12 (strain MGAS2096) GN=tpiA PE=3 SV=1 1 243 1.0E-46
sp|P0DG10|TPIS_STRP3 Triosephosphate isomerase OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=tpiA PE=3 SV=1 1 243 1.0E-46
sp|P69887|TPIS_STRP1 Triosephosphate isomerase OS=Streptococcus pyogenes serotype M1 GN=tpiA PE=3 SV=2 1 243 1.0E-46
sp|A2RFQ3|TPIS_STRPG Triosephosphate isomerase OS=Streptococcus pyogenes serotype M5 (strain Manfredo) GN=tpiA PE=3 SV=1 1 243 2.0E-46
sp|B0U1W3|TPIS_XYLFM Triosephosphate isomerase OS=Xylella fastidiosa (strain M12) GN=tpiA PE=3 SV=1 3 234 2.0E-46
sp|Q9Z520|TPIS_STRCO Triosephosphate isomerase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=tpiA PE=1 SV=1 3 245 2.0E-46
sp|B5RQN4|TPIS_BORRA Triosephosphate isomerase OS=Borrelia recurrentis (strain A1) GN=tpiA PE=3 SV=1 3 243 2.0E-46
sp|Q3Z8H2|TPIS_DEHM1 Triosephosphate isomerase OS=Dehalococcoides mccartyi (strain ATCC BAA-2266 / KCTC 15142 / 195) GN=tpiA PE=3 SV=1 3 246 3.0E-46
sp|Q5SJR1|TPIS_THET8 Triosephosphate isomerase OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=tpiA PE=1 SV=1 3 235 3.0E-46
sp|Q2K869|TPIS1_RHIEC Triosephosphate isomerase 1 OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=tpiA PE=3 SV=2 4 237 3.0E-46
sp|Q01893|TPIS_MORSP Triosephosphate isomerase OS=Moraxella sp. GN=tpiA PE=3 SV=1 6 235 3.0E-46
sp|Q1J7N3|TPIS_STRPF Triosephosphate isomerase OS=Streptococcus pyogenes serotype M4 (strain MGAS10750) GN=tpiA PE=3 SV=1 1 243 4.0E-46
sp|Q5XD48|TPIS_STRP6 Triosephosphate isomerase OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=tpiA PE=1 SV=3 1 243 4.0E-46
sp|Q5R0R3|TPIS_IDILO Triosephosphate isomerase OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=tpiA PE=3 SV=1 1 241 4.0E-46
sp|Q8P1W3|TPIS_STRP8 Triosephosphate isomerase OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=tpiA PE=3 SV=2 1 243 5.0E-46
sp|Q1B9C0|TPIS_MYCSS Triosephosphate isomerase OS=Mycobacterium sp. (strain MCS) GN=tpiA PE=3 SV=1 1 234 5.0E-46
sp|A1UFP1|TPIS_MYCSK Triosephosphate isomerase OS=Mycobacterium sp. (strain KMS) GN=tpiA PE=3 SV=1 1 234 5.0E-46
sp|A3PZA3|TPIS_MYCSJ Triosephosphate isomerase OS=Mycobacterium sp. (strain JLS) GN=tpiA PE=3 SV=1 1 234 5.0E-46
sp|Q1QEP9|TPIS_PSYCK Triosephosphate isomerase OS=Psychrobacter cryohalolentis (strain K5) GN=tpiA PE=3 SV=1 6 235 7.0E-46
sp|Q9RUP5|TPIS_DEIRA Triosephosphate isomerase OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=tpiA PE=1 SV=1 10 235 7.0E-46
sp|Q829W1|TPIS_STRAW Triosephosphate isomerase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=tpiA PE=3 SV=1 2 245 7.0E-46
sp|A0PPN4|TPIS_MYCUA Triosephosphate isomerase OS=Mycobacterium ulcerans (strain Agy99) GN=tpiA PE=3 SV=1 1 234 8.0E-46
sp|B2HP86|TPIS_MYCMM Triosephosphate isomerase OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=tpiA PE=3 SV=1 1 234 8.0E-46
sp|Q28RL2|TPIS_JANSC Triosephosphate isomerase OS=Jannaschia sp. (strain CCS1) GN=tpiA PE=3 SV=1 1 235 1.0E-45
sp|P9WG43|TPIS_MYCTU Triosephosphate isomerase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=tpiA PE=1 SV=1 1 234 1.0E-45
sp|P9WG42|TPIS_MYCTO Triosephosphate isomerase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=tpiA PE=3 SV=1 1 234 1.0E-45
sp|A5U2E0|TPIS_MYCTA Triosephosphate isomerase OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=tpiA PE=3 SV=1 1 234 1.0E-45
sp|P66941|TPIS_MYCBO Triosephosphate isomerase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=tpiA PE=3 SV=1 1 234 1.0E-45
sp|Q1IZA2|TPIS_DEIGD Triosephosphate isomerase OS=Deinococcus geothermalis (strain DSM 11300) GN=tpiA PE=3 SV=1 10 239 1.0E-45
sp|Q8YP17|TPIS_NOSS1 Triosephosphate isomerase OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=tpiA PE=3 SV=1 3 243 1.0E-45
sp|A4YVD3|TPIS_BRASO Triosephosphate isomerase OS=Bradyrhizobium sp. (strain ORS278) GN=tpiA PE=3 SV=1 6 237 1.0E-45
sp|Q7VC41|TPIS_PROMA Triosephosphate isomerase OS=Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) GN=tpiA PE=3 SV=1 3 243 1.0E-45
sp|Q3M7Y8|TPIS_ANAVT Triosephosphate isomerase OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=tpiA PE=3 SV=1 3 243 1.0E-45
sp|Q98ME7|TPIS1_RHILO Triosephosphate isomerase 1 OS=Rhizobium loti (strain MAFF303099) GN=tpiA1 PE=3 SV=1 4 241 2.0E-45
sp|Q2JX75|TPIS_SYNJA Triosephosphate isomerase OS=Synechococcus sp. (strain JA-3-3Ab) GN=tpiA PE=3 SV=1 3 243 2.0E-45
sp|Q4FVL9|TPIS_PSYA2 Triosephosphate isomerase OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=tpiA PE=3 SV=1 6 243 2.0E-45
sp|Q72K37|TPIS_THET2 Triosephosphate isomerase OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=tpiA PE=3 SV=1 3 235 2.0E-45
sp|Q1LTT4|TPIS_BAUCH Triosephosphate isomerase OS=Baumannia cicadellinicola subsp. Homalodisca coagulata GN=tpiA PE=3 SV=1 3 235 3.0E-45
sp|Q89KU3|TPIS_BRADU Triosephosphate isomerase OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=tpiA PE=3 SV=1 6 237 3.0E-45
sp|B1MC85|TPIS_MYCA9 Triosephosphate isomerase OS=Mycobacterium abscessus (strain ATCC 19977 / DSM 44196 / CIP 104536 / JCM 13569 / NCTC 13031 / TMC 1543) GN=tpiA PE=3 SV=1 1 234 3.0E-45
sp|P72484|TPIS_STRMU Triosephosphate isomerase OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=tpiA PE=3 SV=2 1 246 4.0E-45
sp|B1VA75|TPIS_PHYAS Triosephosphate isomerase OS=Phytoplasma australiense GN=tpiA PE=3 SV=1 1 243 6.0E-45
sp|A1KIM7|TPIS_MYCBP Triosephosphate isomerase OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=tpiA PE=3 SV=1 1 234 6.0E-45
[Show less]

GO

GO Term Description Terminal node
GO:0004807 triose-phosphate isomerase activity Yes
GO:0016860 intramolecular oxidoreductase activity No
GO:0003674 molecular_function No
GO:0016861 intramolecular oxidoreductase activity, interconverting aldoses and ketoses No
GO:0003824 catalytic activity No
GO:0016853 isomerase activity No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup4626
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3915
Ophiocordyceps australis map64 (Brazil) OphauB2|4145
Ophiocordyceps camponoti-floridani Ophcf2|04451
Ophiocordyceps camponoti-rufipedis Ophun1|1773 (this protein)
Ophiocordyceps kimflemingae Ophio5|3680
Ophiocordyceps subramaniannii Hirsu2|9711

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|1773
MARKFFVGGNFKMNGSISAIKEIVNNLNKAVIDAEVEIVVAPPALYLLLLRENLRSGIEVAAQNVFDKPNGAYTG
EISVSQLKDSNITWSILGHSERRTILNETDHVIASRTKYATENGLGVIWCCGETLEQREAGKTIEVVSNQLEALK
AQVSDWSRIVIAYEPIWAIGTGKVATTEQAQEVHKAIRGWLKGVSSKVADETRILYGGSVNEKNCGELSKQPDID
GFLVGGASLKPAFVDIINCRKH*
Coding >Ophun1|1773
ATGGCTCGCAAGTTCTTCGTCGGCGGCAACTTCAAGATGAACGGGTCCATCTCGGCCATCAAGGAGATTGTCAAT
AACCTCAACAAGGCTGTTATCGACGCCGAAGTCGAGATTGTCGTCGCCCCGCCGGCTCTCTACCTGCTGCTCCTG
CGCGAGAACCTCCGATCCGGCATCGAGGTGGCGGCGCAAAACGTCTTCGATAAGCCCAATGGCGCCTACACGGGC
GAAATCTCCGTCTCGCAGCTCAAGGATAGCAACATCACCTGGTCCATCCTCGGCCACTCGGAGCGGCGCACCATC
CTCAACGAGACGGATCATGTGATTGCCTCTCGAACAAAGTACGCGACTGAGAACGGCCTCGGTGTCATCTGGTGC
TGCGGCGAGACGCTTGAGCAGCGCGAGGCGGGCAAGACTATCGAGGTGGTCAGCAACCAGCTGGAAGCGCTCAAG
GCGCAGGTCTCGGATTGGTCTCGTATCGTCATTGCCTACGAGCCTATCTGGGCTATTGGGACTGGCAAGGTGGCT
ACCACGGAACAGGCTCAGGAGGTTCACAAGGCTATTCGCGGCTGGCTTAAGGGCGTCAGTTCCAAGGTCGCGGAC
GAGACTCGCATTCTCTACGGTGGCAGTGTCAATGAGAAGAACTGCGGAGAGCTTAGCAAGCAGCCTGACATTGAC
GGCTTCCTCGTCGGCGGTGCTTCGCTTAAGCCTGCTTTCGTCGACATTATCAACTGTCGGAAACATTGA
Transcript >Ophun1|1773
ATGGCTCGCAAGTTCTTCGTCGGCGGCAACTTCAAGATGAACGGGTCCATCTCGGCCATCAAGGAGATTGTCAAT
AACCTCAACAAGGCTGTTATCGACGCCGAAGTCGAGATTGTCGTCGCCCCGCCGGCTCTCTACCTGCTGCTCCTG
CGCGAGAACCTCCGATCCGGCATCGAGGTGGCGGCGCAAAACGTCTTCGATAAGCCCAATGGCGCCTACACGGGC
GAAATCTCCGTCTCGCAGCTCAAGGATAGCAACATCACCTGGTCCATCCTCGGCCACTCGGAGCGGCGCACCATC
CTCAACGAGACGGATCATGTGATTGCCTCTCGAACAAAGTACGCGACTGAGAACGGCCTCGGTGTCATCTGGTGC
TGCGGCGAGACGCTTGAGCAGCGCGAGGCGGGCAAGACTATCGAGGTGGTCAGCAACCAGCTGGAAGCGCTCAAG
GCGCAGGTCTCGGATTGGTCTCGTATCGTCATTGCCTACGAGCCTATCTGGGCTATTGGGACTGGCAAGGTGGCT
ACCACGGAACAGGCTCAGGAGGTTCACAAGGCTATTCGCGGCTGGCTTAAGGGCGTCAGTTCCAAGGTCGCGGAC
GAGACTCGCATTCTCTACGGTGGCAGTGTCAATGAGAAGAACTGCGGAGAGCTTAGCAAGCAGCCTGACATTGAC
GGCTTCCTCGTCGGCGGTGCTTCGCTTAAGCCTGCTTTCGTCGACATTATCAACTGTCGGAAACATTGA
Gene >Ophun1|1773
ATGGCTCGCAAGTTCTTCGTCGGCGGCAACTTCAAGATGTGAGCTACCCCTCCATACCCCGCGCGTCACCAAGCA
GCTGACGATTGGCTAGGAACGGGTCCATCTCGGCCATCAAGGAGATTGTCAATAACCTCAACAAGGCTGTTATCG
ACGCCGAAGTCGGTACGTTGTTCATCTACTCGATTCAGGTGGACGGTTGACTGACCAGCTCGTGACGAGACAGAG
ATTGTCGTCGCCCCGCCGGCTCTCTACCTGCTGCTCCTGCGCGAGAACCTCCGATCCGGCATCGAGGTGGCGGCG
CAAAACGTCTTCGATAAGCCCAATGGCGCCTACACGGGCGAAATCTCCGTCTCGCAGCTCAAGGATAGCAACATC
ACCTGGTCCATCCTCGGCCACTCGGAGCGGCGCACCATCCTCAACGAGACGGATCATGTGATTGCCTCTCGAACA
AAGTACGCGACTGAGAACGGCCTCGGTGTCATCTGGTGCTGCGGCGAGACGCTTGAGCAGCGCGAGGCGGGCAAG
ACTATCGAGGTGGTCAGCAACCAGCTGGAAGCGCTCAAGGCGCAGGTCTCGGATTGGTCTCGTATCGTCATTGCC
TACGAGCCTATCTGGGCTATTGGGACTGGCAAGGTGGCTACCACGGAACAGGCTCAGGAGGTTCACAAGGCTATT
CGCGGCTGGCTTAAGGGCGTCAGTTCCAAGGTCGCGGACGAGACTCGCATTCTCTACGGTGGCAGTGTCAATGAG
AAGAACTGCGGAGAGCTTAGCAAGCAGCCTGACATTGACGGCTTCCTCGTCGGCGGTGCTTCGCTTAAGCCTGCT
TGTGAGTCTTGCATCGTCGCTGTGTGTTCACTTCTGACTCTACTTTCCCTAGTCGTCGACATTATCAACTGTCGG
AAACATTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail