Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|1769
Gene name
LocationContig_178:6755..11183
Strand-
Gene length (bp)4428
Transcript length (bp)3813
Coding sequence length (bp)3813
Protein length (aa) 1271

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10441 Urb2 Urb2/Npa2 family 1.9E-59 1060 1269

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P47108|URB2_YEAST Nucleolar pre-ribosomal-associated protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=URB2 PE=1 SV=1 1065 1267 1.0E-12

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup4161
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3299
Ophiocordyceps australis map64 (Brazil) OphauB2|4139
Ophiocordyceps camponoti-floridani Ophcf2|04447
Ophiocordyceps camponoti-rufipedis Ophun1|1769 (this protein)
Ophiocordyceps kimflemingae Ophio5|3685
Ophiocordyceps subramaniannii Hirsu2|8448

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|1769
MWPDVASDVKELKSELRRTASQSLELVMPSFRDGRSKDRATDLVKTVRAIDQTGPGENGEGLQHLWSCLTASSGR
HFHAAEESILRWLLKSMNGSSPAAETVRRYPLTWTILACVFQRVPLFSLAKSLADRKFIAVLQQTFKDISKPVSG
SSSPPSPKRKRSPTVGYDLSQLQARQWCLETAAEAFKALESLLRRLESSEEAFSRHQMGAEHIKSLFCTSAAEAV
KIVAPALTVCELLINESSEQLKGPESWINTISTVWDLHLQVDDDAVEVATHLFPPSAMILARIGDFPSDSEIDVP
QLLKSRWSADLRLFLQRNLIAPGKRDFVRQKTFDPLAKALNASKSMIQYSAPALYFLCSDDSSLISKGELRKDNV
EWLRRTFKAVELAIAERSDRSAIMQTILDRAIQRLASVDADDLRRVCRGYALHESETDWALLSKAMTCDADILQV
TDEGVSLRADVCDRILRAESGSETDGDIAVIMGAIMDGYRTRRSLGSFLQLCERIDIWNSVKKPLSKILKKSPVV
SSATFEAFKYCFQAWDYLSLTEQADEPALLIESFSKRLVAHEFGPLVLGSRLPFTEASAKADFQEDSALQHYLMW
CAFGSSRFSKLHFSRKGGLPPVLSKALTTTDAGVEHVELLWDALLCNEINLNDAQLAATLVDRLVTALDGFVEAE
STGPGERSLTWIKMLTRVPIEVFSRGQREQLMSIFNRLRARMAEPSNKTTPHACKMTLSLASKMMRRPTFYQGMS
FFDLVDLAAAVSKISVVGSIDCETILELIQRYLSVASVTIRQMADHLDERGIQYFLGASKFVSDCSARLRTEADA
NTSGLGLSITLLQTLHGELSRTPNVRAHEELASLADESKEVLSRCVSATVSKFVSDKKLLSSSNSAAAMSLLAAL
DAASVFESFEGLLDPASSAVRKLDKRTKEQIQQGDLKAWKIQAFLQAYLPTTGAVSRPTKFVSLAGLPGKLQQPL
LKELVTSTTRHMSSDGRRQYLGELIGELGKGWDTDGQILAIQTMVDQLTDSNDQHDKTDGFSLAAAHSQLTLSLL
QLPKSPQAVQICQVLQTLLDNRPQAMGQWNIELTLSVVCDLSSIRSDEPSVPFTSLCKLVEVIIKKHRLRLEGHY
HILLIALQALLRNLIIKQSASPPPETTPEAKAQAYARLISLICEPTAGAVSRTQLHGALESATDAAKRSASRHMY
LVMMQYVKLQLEKSVAKAVREALEPAMNAIFDISPPEVRKILNDAVQGGGRAILREMFRRYVKFGKWSGV*
Coding >Ophun1|1769
ATGTGGCCGGATGTTGCGTCGGACGTCAAAGAGCTAAAGTCGGAGCTCAGACGGACAGCTTCTCAATCCCTTGAA
CTGGTGATGCCAAGCTTCAGAGACGGCAGAAGCAAGGATCGGGCGACGGATCTCGTCAAGACCGTGCGAGCCATC
GATCAGACAGGCCCCGGAGAGAATGGCGAGGGCTTGCAGCATCTCTGGAGCTGTCTGACAGCATCATCTGGACGT
CACTTTCACGCCGCCGAAGAAAGCATCCTGAGATGGCTTCTCAAATCCATGAACGGGTCGTCTCCAGCTGCCGAA
ACCGTCCGCCGCTACCCATTGACATGGACGATTCTCGCCTGCGTCTTCCAACGGGTCCCCCTCTTCTCCCTCGCC
AAGTCTCTCGCCGACCGAAAGTTCATCGCCGTGTTACAGCAGACATTCAAAGACATTTCCAAGCCTGTCAGCGGC
TCCTCTTCCCCGCCCTCGCCGAAGCGCAAGAGAAGTCCTACCGTCGGCTACGACTTGAGCCAGCTGCAAGCCCGC
CAATGGTGTTTGGAAACTGCTGCGGAGGCTTTCAAGGCTCTGGAATCGCTGTTGAGACGTCTCGAGAGCTCGGAG
GAGGCCTTTTCCCGGCATCAGATGGGCGCGGAACACATCAAGTCTCTATTTTGCACATCGGCAGCTGAAGCAGTC
AAGATCGTGGCCCCGGCACTGACAGTCTGCGAACTACTGATCAATGAATCGTCTGAACAGCTAAAAGGCCCTGAA
TCCTGGATCAATACCATCTCTACGGTGTGGGATCTCCATCTCCAAGTAGATGACGATGCAGTCGAGGTTGCGACC
CATCTCTTTCCGCCGTCAGCAATGATACTGGCCAGGATCGGCGACTTTCCCTCTGACAGCGAAATCGACGTTCCT
CAACTCCTTAAAAGCAGATGGAGCGCCGATCTGCGCCTGTTCTTGCAGCGGAACCTCATCGCCCCCGGCAAGAGA
GACTTTGTCAGACAGAAAACTTTTGATCCCCTCGCCAAGGCGCTGAACGCATCGAAAAGCATGATTCAATACTCA
GCTCCTGCGCTCTATTTTCTCTGCTCGGATGACTCTAGCCTTATTTCGAAGGGCGAACTACGGAAAGACAACGTC
GAATGGCTGAGACGGACATTCAAAGCCGTAGAGCTCGCCATCGCAGAGCGAAGTGATCGAAGCGCCATCATGCAG
ACTATTCTGGACCGGGCGATACAACGACTTGCCTCGGTGGATGCCGACGACCTTCGCCGTGTGTGCCGCGGCTAT
GCGTTACACGAGTCGGAGACAGACTGGGCATTGTTGTCCAAGGCAATGACTTGCGACGCCGATATCCTCCAGGTA
ACCGACGAGGGGGTTTCCCTGAGAGCAGACGTCTGTGACAGAATCTTGAGGGCAGAGTCTGGAAGCGAAACCGAC
GGGGACATCGCAGTCATCATGGGGGCGATTATGGACGGGTATCGAACGCGCCGCTCTCTGGGTAGCTTTCTGCAG
TTATGTGAGAGAATTGATATTTGGAACTCGGTCAAGAAACCGCTGTCAAAGATCCTGAAGAAGTCGCCCGTCGTC
TCAAGTGCCACATTTGAGGCTTTCAAATACTGCTTCCAGGCCTGGGACTACTTGAGTCTGACAGAGCAGGCAGAC
GAGCCCGCACTTCTTATCGAGAGCTTTTCGAAACGACTGGTCGCTCATGAGTTCGGCCCCCTTGTGCTTGGCAGC
AGACTGCCTTTCACAGAAGCAAGCGCAAAGGCGGACTTTCAGGAAGACAGTGCCCTTCAACACTATCTGATGTGG
TGCGCATTTGGCTCCAGCAGATTCAGCAAGCTGCATTTCTCGAGGAAAGGAGGTTTGCCACCGGTGTTGTCGAAA
GCGTTGACGACTACTGATGCGGGCGTCGAGCACGTTGAACTGCTCTGGGACGCCTTGCTGTGCAATGAAATCAAC
CTGAACGATGCACAACTCGCGGCAACCTTGGTCGACCGTCTCGTGACCGCTCTGGATGGCTTTGTGGAGGCCGAA
TCGACTGGCCCAGGAGAGCGGAGCCTCACCTGGATCAAGATGTTGACCAGAGTACCGATCGAGGTCTTTAGTCGC
GGGCAACGGGAACAACTCATGAGTATTTTCAACAGGCTGCGGGCGAGAATGGCAGAGCCGTCCAACAAGACGACT
CCGCATGCCTGTAAAATGACGCTTAGTCTCGCATCGAAGATGATGAGACGACCCACGTTTTATCAGGGCATGAGC
TTTTTTGACCTCGTCGACCTCGCTGCTGCAGTTTCCAAGATTTCCGTGGTTGGGTCAATAGATTGCGAGACCATC
CTCGAACTGATTCAGAGATATCTTTCAGTGGCGTCGGTAACGATCAGGCAGATGGCAGACCACCTGGATGAACGA
GGCATTCAGTACTTCTTGGGGGCTTCGAAGTTCGTGTCTGATTGCAGCGCACGGCTCAGAACGGAGGCAGATGCC
AACACGTCTGGACTGGGCCTTTCCATAACTCTGCTACAAACCCTCCACGGCGAGCTGTCGCGAACTCCGAACGTG
CGAGCCCATGAGGAACTGGCGTCGCTTGCAGATGAGTCGAAAGAGGTCTTATCGCGCTGCGTTTCTGCCACCGTG
AGCAAGTTCGTCTCCGACAAGAAGCTCCTCTCTTCTTCCAACTCTGCCGCTGCTATGAGCCTCCTAGCCGCGCTT
GATGCAGCTTCCGTCTTTGAGAGTTTCGAAGGACTGCTGGACCCGGCATCGTCAGCAGTGCGAAAACTTGACAAG
CGCACCAAAGAGCAGATCCAGCAGGGAGACTTGAAGGCATGGAAGATTCAGGCTTTCCTGCAAGCTTATTTACCC
ACGACAGGGGCAGTGTCTCGCCCTACGAAGTTCGTCAGTCTGGCTGGGTTACCGGGCAAGCTTCAACAACCGCTT
CTAAAGGAGTTGGTGACGTCAACTACGAGGCACATGAGCAGCGATGGGAGACGTCAGTATCTTGGAGAGTTGATA
GGTGAACTCGGCAAGGGCTGGGACACGGACGGTCAGATTCTAGCCATCCAGACCATGGTCGATCAGCTCACGGAC
TCCAACGACCAGCACGACAAGACAGATGGCTTCAGTCTAGCGGCAGCACATAGCCAACTGACGCTGTCTCTTCTG
CAGCTGCCAAAGTCACCGCAGGCTGTGCAAATCTGTCAGGTCCTGCAGACACTGTTGGATAACCGTCCGCAGGCC
ATGGGACAGTGGAACATCGAGCTTACACTGAGCGTCGTGTGCGACCTCTCGTCAATAAGAAGCGACGAGCCGTCC
GTGCCATTCACATCGCTCTGCAAACTAGTCGAAGTCATCATCAAGAAGCACCGACTTCGCCTGGAGGGACACTAC
CACATCCTCCTCATCGCTCTACAGGCTCTCCTCCGAAACCTCATCATCAAGCAGTCAGCAAGCCCCCCCCCCGAA
ACAACCCCCGAAGCAAAAGCACAGGCCTACGCCCGACTCATCAGCCTCATCTGCGAGCCCACCGCCGGCGCCGTC
TCCCGAACGCAGCTCCACGGCGCGCTCGAGTCCGCCACGGACGCGGCTAAGCGGTCTGCTAGCCGACACATGTAT
CTCGTCATGATGCAGTACGTCAAGCTGCAGCTTGAAAAGAGCGTGGCCAAGGCTGTGAGGGAGGCGCTGGAGCCG
GCTATGAATGCCATTTTTGACATTTCGCCGCCCGAGGTGAGGAAGATTTTGAACGATGCTGTTCAGGGGGGTGGG
AGGGCGATCCTGCGGGAAATGTTTAGGCGTTATGTCAAGTTTGGGAAATGGAGTGGAGTTTAG
Transcript >Ophun1|1769
ATGTGGCCGGATGTTGCGTCGGACGTCAAAGAGCTAAAGTCGGAGCTCAGACGGACAGCTTCTCAATCCCTTGAA
CTGGTGATGCCAAGCTTCAGAGACGGCAGAAGCAAGGATCGGGCGACGGATCTCGTCAAGACCGTGCGAGCCATC
GATCAGACAGGCCCCGGAGAGAATGGCGAGGGCTTGCAGCATCTCTGGAGCTGTCTGACAGCATCATCTGGACGT
CACTTTCACGCCGCCGAAGAAAGCATCCTGAGATGGCTTCTCAAATCCATGAACGGGTCGTCTCCAGCTGCCGAA
ACCGTCCGCCGCTACCCATTGACATGGACGATTCTCGCCTGCGTCTTCCAACGGGTCCCCCTCTTCTCCCTCGCC
AAGTCTCTCGCCGACCGAAAGTTCATCGCCGTGTTACAGCAGACATTCAAAGACATTTCCAAGCCTGTCAGCGGC
TCCTCTTCCCCGCCCTCGCCGAAGCGCAAGAGAAGTCCTACCGTCGGCTACGACTTGAGCCAGCTGCAAGCCCGC
CAATGGTGTTTGGAAACTGCTGCGGAGGCTTTCAAGGCTCTGGAATCGCTGTTGAGACGTCTCGAGAGCTCGGAG
GAGGCCTTTTCCCGGCATCAGATGGGCGCGGAACACATCAAGTCTCTATTTTGCACATCGGCAGCTGAAGCAGTC
AAGATCGTGGCCCCGGCACTGACAGTCTGCGAACTACTGATCAATGAATCGTCTGAACAGCTAAAAGGCCCTGAA
TCCTGGATCAATACCATCTCTACGGTGTGGGATCTCCATCTCCAAGTAGATGACGATGCAGTCGAGGTTGCGACC
CATCTCTTTCCGCCGTCAGCAATGATACTGGCCAGGATCGGCGACTTTCCCTCTGACAGCGAAATCGACGTTCCT
CAACTCCTTAAAAGCAGATGGAGCGCCGATCTGCGCCTGTTCTTGCAGCGGAACCTCATCGCCCCCGGCAAGAGA
GACTTTGTCAGACAGAAAACTTTTGATCCCCTCGCCAAGGCGCTGAACGCATCGAAAAGCATGATTCAATACTCA
GCTCCTGCGCTCTATTTTCTCTGCTCGGATGACTCTAGCCTTATTTCGAAGGGCGAACTACGGAAAGACAACGTC
GAATGGCTGAGACGGACATTCAAAGCCGTAGAGCTCGCCATCGCAGAGCGAAGTGATCGAAGCGCCATCATGCAG
ACTATTCTGGACCGGGCGATACAACGACTTGCCTCGGTGGATGCCGACGACCTTCGCCGTGTGTGCCGCGGCTAT
GCGTTACACGAGTCGGAGACAGACTGGGCATTGTTGTCCAAGGCAATGACTTGCGACGCCGATATCCTCCAGGTA
ACCGACGAGGGGGTTTCCCTGAGAGCAGACGTCTGTGACAGAATCTTGAGGGCAGAGTCTGGAAGCGAAACCGAC
GGGGACATCGCAGTCATCATGGGGGCGATTATGGACGGGTATCGAACGCGCCGCTCTCTGGGTAGCTTTCTGCAG
TTATGTGAGAGAATTGATATTTGGAACTCGGTCAAGAAACCGCTGTCAAAGATCCTGAAGAAGTCGCCCGTCGTC
TCAAGTGCCACATTTGAGGCTTTCAAATACTGCTTCCAGGCCTGGGACTACTTGAGTCTGACAGAGCAGGCAGAC
GAGCCCGCACTTCTTATCGAGAGCTTTTCGAAACGACTGGTCGCTCATGAGTTCGGCCCCCTTGTGCTTGGCAGC
AGACTGCCTTTCACAGAAGCAAGCGCAAAGGCGGACTTTCAGGAAGACAGTGCCCTTCAACACTATCTGATGTGG
TGCGCATTTGGCTCCAGCAGATTCAGCAAGCTGCATTTCTCGAGGAAAGGAGGTTTGCCACCGGTGTTGTCGAAA
GCGTTGACGACTACTGATGCGGGCGTCGAGCACGTTGAACTGCTCTGGGACGCCTTGCTGTGCAATGAAATCAAC
CTGAACGATGCACAACTCGCGGCAACCTTGGTCGACCGTCTCGTGACCGCTCTGGATGGCTTTGTGGAGGCCGAA
TCGACTGGCCCAGGAGAGCGGAGCCTCACCTGGATCAAGATGTTGACCAGAGTACCGATCGAGGTCTTTAGTCGC
GGGCAACGGGAACAACTCATGAGTATTTTCAACAGGCTGCGGGCGAGAATGGCAGAGCCGTCCAACAAGACGACT
CCGCATGCCTGTAAAATGACGCTTAGTCTCGCATCGAAGATGATGAGACGACCCACGTTTTATCAGGGCATGAGC
TTTTTTGACCTCGTCGACCTCGCTGCTGCAGTTTCCAAGATTTCCGTGGTTGGGTCAATAGATTGCGAGACCATC
CTCGAACTGATTCAGAGATATCTTTCAGTGGCGTCGGTAACGATCAGGCAGATGGCAGACCACCTGGATGAACGA
GGCATTCAGTACTTCTTGGGGGCTTCGAAGTTCGTGTCTGATTGCAGCGCACGGCTCAGAACGGAGGCAGATGCC
AACACGTCTGGACTGGGCCTTTCCATAACTCTGCTACAAACCCTCCACGGCGAGCTGTCGCGAACTCCGAACGTG
CGAGCCCATGAGGAACTGGCGTCGCTTGCAGATGAGTCGAAAGAGGTCTTATCGCGCTGCGTTTCTGCCACCGTG
AGCAAGTTCGTCTCCGACAAGAAGCTCCTCTCTTCTTCCAACTCTGCCGCTGCTATGAGCCTCCTAGCCGCGCTT
GATGCAGCTTCCGTCTTTGAGAGTTTCGAAGGACTGCTGGACCCGGCATCGTCAGCAGTGCGAAAACTTGACAAG
CGCACCAAAGAGCAGATCCAGCAGGGAGACTTGAAGGCATGGAAGATTCAGGCTTTCCTGCAAGCTTATTTACCC
ACGACAGGGGCAGTGTCTCGCCCTACGAAGTTCGTCAGTCTGGCTGGGTTACCGGGCAAGCTTCAACAACCGCTT
CTAAAGGAGTTGGTGACGTCAACTACGAGGCACATGAGCAGCGATGGGAGACGTCAGTATCTTGGAGAGTTGATA
GGTGAACTCGGCAAGGGCTGGGACACGGACGGTCAGATTCTAGCCATCCAGACCATGGTCGATCAGCTCACGGAC
TCCAACGACCAGCACGACAAGACAGATGGCTTCAGTCTAGCGGCAGCACATAGCCAACTGACGCTGTCTCTTCTG
CAGCTGCCAAAGTCACCGCAGGCTGTGCAAATCTGTCAGGTCCTGCAGACACTGTTGGATAACCGTCCGCAGGCC
ATGGGACAGTGGAACATCGAGCTTACACTGAGCGTCGTGTGCGACCTCTCGTCAATAAGAAGCGACGAGCCGTCC
GTGCCATTCACATCGCTCTGCAAACTAGTCGAAGTCATCATCAAGAAGCACCGACTTCGCCTGGAGGGACACTAC
CACATCCTCCTCATCGCTCTACAGGCTCTCCTCCGAAACCTCATCATCAAGCAGTCAGCAAGCCCCCCCCCCGAA
ACAACCCCCGAAGCAAAAGCACAGGCCTACGCCCGACTCATCAGCCTCATCTGCGAGCCCACCGCCGGCGCCGTC
TCCCGAACGCAGCTCCACGGCGCGCTCGAGTCCGCCACGGACGCGGCTAAGCGGTCTGCTAGCCGACACATGTAT
CTCGTCATGATGCAGTACGTCAAGCTGCAGCTTGAAAAGAGCGTGGCCAAGGCTGTGAGGGAGGCGCTGGAGCCG
GCTATGAATGCCATTTTTGACATTTCGCCGCCCGAGGTGAGGAAGATTTTGAACGATGCTGTTCAGGGGGGTGGG
AGGGCGATCCTGCGGGAAATGTTTAGGCGTTATGTCAAGTTTGGGAAATGGAGTGGAGTTTAG
Gene >Ophun1|1769
ATGTGGCCGGATGTTGCGTCGGACGTCAAAGAGCTAAAGTCGGAGCTCAGACGGACAGCTTCTCAATCCCTTGAA
CTGGTGATGCCAAGCTTCAGAGACGGCAGAAGCAAGGATCGGGCGGTGAGCCGCTTTGGGACTAGCGCGCTGGCA
GAATTCTCGAAATTTTGGTGAGGGTCGGCGCAGATCGTTGGCTGAGGGATTGATGACTCTGCGCCTCGCTGAATT
CCAGCGCCAGCGATACTCGGATGAATCTGGTGCATGAATCTGCGGAATCATGGTTAGTCAATGAAGACTCTCTTC
TTCTCTGAGATTTAACTGAGACGGAACATCAGACGGATCTCGTCAAGACCGTGCGAGCCATCGATCAGACAGGCC
CCGGAGAGAATGGCGAGGGCTTGCAGCATCTCTGGAGCTGTCTGACAGCATCATCTGGACGTCACTTTCACGCCG
CCGAAGAAAGCATCCTGAGATGGCTTCTCAAATCCATGAACGGGTCGTCTCCAGCTGCCGAAACCGTCCGCCGCT
ACCCATTGACATGGACGATTCTCGCCTGCGTCTTCCAACGGGTCCCCCTCTTCTCCCTCGCCAAGTCTCTCGCCG
ACCGAAAGTTCATCGCCGTGTTACAGCAGACATTCAAAGACATTTCCAAGCCTGTCAGCGGCTCCTCTTCCCCGC
CCTCGCCGAAGCGCAAGAGAAGTCCTACCGTCGGCTACGACTTGAGCCAGCTGCAAGCCCGCCAATGGTGTTTGG
AAACTGCTGCGGAGGCTTTCAAGGCTCTGGAATCGCTGTTGAGACGTCTCGAGAGCTCGGAGGAGGCCTTTTCCC
GGCATCAGATGGGCGCGGAACACATCAAGTCTCTATTTTGCACATCGGCAGCTGAAGCAGTCAAGATCGTGGCCC
CGGCACTGACAGTCTGCGAACTACTGATCAATGAATCGTCTGAACAGCTAAAAGGCCCTGAATCCTGGATCAATA
CCATCTCTACGGTGTGGGATCTCCATCTCCAAGTAGATGACGATGCAGTCGAGGTTGCGACCCATCTCTTTCCGC
CGTCAGCAATGATACTGGCCAGGATCGGCGACTTTCCCTCTGACAGCGAAATCGACGTTCCTCAACTCCTTAAAA
GCAGATGGAGCGCCGATCTGCGCCTGTTCTTGCAGCGGAACCTCATCGCCCCCGGCAAGAGAGACTTTGTCAGAC
AGAAAACTTTTGATCCCCTCGCCAAGGCGCTGAACGCATCGAAAAGCATGATTCAATACTCAGCTCCTGCGCTCT
ATTTTCTCTGCTCGGATGACTCTAGCCTTATTTCGAAGGGCGAACTACGGAAAGACAACGTCGAATGGCTGAGAC
GGACATTCAAAGCCGTAGAGCTCGCCATCGCAGAGCGAAGTGATCGAAGCGCCATCATGCAGACTATTCTGGACC
GGGCGATACAACGACTTGCCTCGGTGGATGCCGACGACCTTCGCCGTGTGTGCCGCGGCTATGCGTTACACGAGT
CGGAGACAGACTGGGCATTGTTGTCCAAGGCAATGACTTGCGACGCCGATATCCTCCAGGTAACCGACGAGGGGG
TTTCCCTGAGAGCAGACGTCTGTGACAGAATCTTGAGGGCAGAGTCTGGAAGCGAAACCGACGGGGACATCGCAG
TCATCATGGGGGCGATTATGGACGGGTATCGAACGCGCCGCTCTCTGGGTAGCTTTCTGCAGTTATGGTTCGAAC
AGCTTTGCAGAGAGGAGCGGAAACGAAACGGCGAACCCTTACTTTGGTCCAAAGTTGGTCAATTACCGGGTTCGA
CGCAAGCATTGTACTCCTTTCTTGAGGCAGAGCTGTCCCCGACACAACTGCTTGGCGTGATCTCATGGGTTGGAA
CGCAAACGCCAGAGTCGCCGCCCGAGTCTCTTTGCATATTCGCCAGCACAATTGCGTCTGCACTTCGAAGTGAAG
TGTTTGTCGATGCTGTGGGAAAAAGCCTTCTCGACTTAGTCGCTTCCGTGGACGGCTCTCAACCAGCTTCAGCTT
TAAAGTGGAGAGTCGTTTCCCTGACGATGAACTGGACTGTTCCAAGTGAGAGAATTGATATTTGGAACTCGGTCA
AGAAACCGCTGTCAAAGATCCTGAAGAAGTCGCCCGTCGTCTCAAGTGCCACATTTGAGGCTTTCAAATACTGCT
TCCAGGCCTGGGACTACTTGAGTCTGACAGAGCAGGCAGACGAGCCCGCACTTCTTATCGAGAGCTTTTCGAAAC
GACTGGTCGCTCATGAGTTCGGCCCCCTTGTGCTTGGCAGCAGACTGCCTTTCACAGAAGCAAGCGCAAAGGCGG
ACTTTCAGGAAGACAGTGCCCTTCAACACTATCTGATGTGGTGCGCATTTGGCTCCAGCAGATTCAGCAAGCTGC
ATTTCTCGAGGAAAGGAGGTTTGCCACCGGTGTTGTCGAAAGCGTTGACGACTACTGATGCGGGCGTCGAGCACG
TTGAACTGCTCTGGGACGCCTTGCTGTGCAATGAAATCAACCTGAACGATGCACAACTCGCGGCAACCTTGGTCG
ACCGTCTCGTGACCGCTCTGGATGGCTTTGTGGAGGCCGAATCGACTGGCCCAGGAGAGCGGAGCCTCACCTGGA
TCAAGATGTTGACCAGAGTACCGATCGAGGTCTTTAGTCGCGGGCAACGGGAACAACTCATGAGTATTTTCAACA
GGCTGCGGGCGAGAATGGCAGAGCCGTCCAACAAGACGACTCCGCATGCCTGTAAAATGACGCTTAGTCTCGCAT
CGAAGATGATGAGACGACCCACGTTTTATCAGGGCATGAGCTTTTTTGACCTCGTCGACCTCGCTGCTGCAGTTT
CCAAGATTTCCGTGGTTGGGTCAATAGATTGCGAGACCATCCTCGAACTGATTCAGAGATATCTTTCAGTGGCGT
CGGTAACGATCAGGCAGATGGCAGACCACCTGGATGAACGAGGCATTCAGTACTTCTTGGGGGCTTCGAAGTTCG
TGTCTGATTGCAGCGCACGGCTCAGAACGGAGGCAGATGCCAACACGTCTGGACTGGGCCTTTCCATAACTCTGC
TACAAACCCTCCACGGCGAGCTGTCGCGAACTCCGAACGTGCGAGCCCATGAGGAACTGGCGTCGCTTGCAGATG
AGTCGAAAGAGGTCTTATCGCGCTGCGTTTCTGCCACCGTGAGCAAGTTCGTCTCCGACAAGAAGCTCCTCTCTT
CTTCCAACTCTGCCGCTGCTATGAGCCTCCTAGCCGCGCTTGATGCAGCTTCCGTCTTTGAGAGTTTCGAAGGAC
TGCTGGACCCGGCATCGTCAGCAGTGCGAAAACTTGACAAGCGCACCAAAGAGCAGATCCAGCAGGGAGACTTGA
AGGCATGGAAGATTCAGGCTTTCCTGCAAGCTTATTTACCCACGACAGGGGCAGTGTCTCGCCCTACGAAGTTCG
TCAGTCTGGCTGGGTTACCGGGCAAGCTTCAACAACCGCTTCTAAAGGAGTTGGTGACGTCAACTACGAGGCACA
TGAGCAGCGATGGGAGACGTCAGTATCTTGGAGAGTTGATAGGTGAACTCGGCAAGGGCTGGGACACGGACGGTC
AGATTCTAGCCATCCAGACCATGGTCGATCAGCTCACGGGTACGTCGTCCCTTGTTCGCGACGAGGTTTCGCTAC
TGACGGCTTGCAGACTCCAACGACCAGCACGACAAGACAGATGGCTTCAGTCTAGCGGCAGCACATAGCCAACTG
ACGCTGTCTCTTCTGCAGCTGCCAAAGTCACCGCAGGCTGTGCAAATCTGTCAGGTCCTGCAGACACTGTTGGAT
AACCGTCCGCAGGCCATGGGACAGTGGAACATCGAGCTTACACTGAGCGTCGTGTGCGACCTCTCGTCAATAAGA
AGCGACGAGCCGTCCGTGCCATTCACATCGCTCTGCAAACTAGTCGAAGTCATCATCAAGAAGCACCGACTTCGC
CTGGAGGGACACTACCACATCCTCCTCATCGCTCTACAGGCTCTCCTCCGAAACCTCATCATCAAGCAGTCAGCA
AGCCCCCCCCCCGAAACAACCCCCGAAGCAAAAGCACAGGCCTACGCCCGACTCATCAGCCTCATCTGCGAGCCC
ACCGCCGGCGCCGTCTCCCGAACGCAGCTCCACGGCGCGCTCGAGTCCGCCACGGACGCGGCTAAGCGGTCTGCT
AGCCGACACATGTATCTCGTCATGATGCAGTACGTCAAGCTGCAGCTTGAAAAGAGCGTGGCCAAGGCTGTGAGG
GAGGCGCTGGAGCCGGCTATGAATGCCATTTTTGACATTTCGCCGCCCGAGGTGAGGAAGATTTTGAACGATGCT
GTTCAGGGGGGTGGGAGGGCGATCCTGCGGGAAATGTTTAGGCGTTATGTCAAGTTTGGGAAATGGAGTGGAGTT
TAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail