Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|1767
Gene name
LocationContig_178:86..5011
Strand-
Gene length (bp)4925
Transcript length (bp)3993
Coding sequence length (bp)3993
Protein length (aa) 1331

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08424 NRDE-2 NRDE-2, necessary for RNA interference 5.1E-99 360 675
PF01328 Peroxidase_2 Peroxidase, family 2 1.0E-24 1103 1278

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q9H7Z3|NRDE2_HUMAN Protein NRDE2 homolog OS=Homo sapiens GN=NRDE2 PE=1 SV=3 323 1100 2.0E-26
sp|Q80XC6|NRDE2_MOUSE Protein NRDE2 homolog OS=Mus musculus GN=Nrde2 PE=1 SV=3 323 1100 7.0E-24
sp|O42975|NRDE2_SCHPO Protein NRDE2 homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC20F10.05 PE=1 SV=1 368 877 1.0E-17
sp|Q54QP0|NRDE2_DICDI Protein NRDE2 homolog OS=Dictyostelium discoideum GN=nrde2 PE=3 SV=1 360 576 3.0E-11

GO

GO Term Description Terminal node
GO:0004601 peroxidase activity Yes
GO:0003674 molecular_function No
GO:0016209 antioxidant activity No
GO:0016684 oxidoreductase activity, acting on peroxide as acceptor No
GO:0003824 catalytic activity No
GO:0016491 oxidoreductase activity No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup4163
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3301
Ophiocordyceps australis map64 (Brazil) OphauB2|4137
Ophiocordyceps camponoti-floridani Ophcf2|04445
Ophiocordyceps camponoti-rufipedis Ophun1|1767 (this protein)
Ophiocordyceps kimflemingae Ophio5|3687
Ophiocordyceps subramaniannii Hirsu2|8450

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|1767
MADGDDDVKLKVPRFSSFKPQASEPARDGSAEGKLRVPKFSSFKDREAHLTAGERRGGGHGGGEELQRGKRKYDA
VDGEGGRRLRRDGDLREERGQERHHREKHRHEEHRHKEHHQEKHRHEKHRHEKHRRDENYHEKHYRDKHHHDEHH
RDNLRSRSHRGSHHRDTSHREKQHQRSRDQEKQRASTGLAESVPGLFVIDTKGDPLIRKYGLDRYRIPSYSRYGG
NRVLGTDGRLVIHRDGPVQKFSLLLPGQRLSDLLGERSSSSRDRGGLRSGNWIQPKALRLRPRRNKIADDDEEEG
YLCLESPRKRRRHHLHSESSDGEDATPWRSIEAKAKVDDEEEDASSESDVAEPDDPLRWKSSQLHRRVKDHPDDI
AGWLELVAHQDIVLSGDNKAENDVSENAARSVSEVKVNLLESALPHATRPSDRETVLVALMREGVKIWSRNVAAK
KWAQISDDENGSFDLWKTHVDYAMSSITTVQYEAVKTMMVERLHQQVRSRGPQSFSREAIYVFLRTTRFIHDAGY
KELAVAAWQALLELNLFRPEGIDSQAQALATFRDFWESEVPRLGDAGAQGWKQYVQNGGVGDAPEPVTNVEPVKA
SQQDSYSAWGATERLRGERASMPARTMDTGTDDDPFRVVMYSDIEPLLFLIPQSELEEMTGQLVDAYLLFCGLPP
VFRDSDFTDTAWHDQFVVRTCGNIQLQPVWEAEGGDDTWTRKPPLFDGGSCHLRLSASLLFSGSAWFRYLNVAGE
DHVVDLSWVESTLKQLVYSANMPTLALYYLGLCFVRDAGSIRKHAKALLKRYPTDVRLYNGYALAEFANGNDELA
IKVLASAVKSEALASTSTGFILFKTWSWIELQRGNKELATRRLCAVVDKSLLTDEGVISPLVATQANNRFQYGTS
RSLDEGDQEAARGHIECLALLAYLTHKGGSEPASKSQGNISAATKVLTLAMEDNCLGSSTKELLLQCASKMLYFH
STKGPFRRAFMREQLAGFINRFPQNTMFISLFAWADTGVGVIDETRQLLADKVLTKTHDAVSSRLLAVSYELTRG
NAHRTRAALQQAVSSEACRSSVVLWLWYVRFCRSQASLRAGAGEVLYRALGCLNTLANHGYIERSGRGITFADAV
KGCFDGLGVSPEVSGISAYNVLRVTSTFFHPAFKFDLRSLGAHYKPIEHDVSFSREDDALGDRNVFNPRIWSSVL
RVIGRSYEITPEMLGKAKDMRYLQQKAKSSKIRYDVDTAKLGGTEVGMLLTAGFTKLPWIRSLFEQERLPSHLGW
QRTQWGTNIVSTVTVAHRSLRAQRYIPAELRAKLDGPFDVRWNEVVWGGGGLTAC*
Coding >Ophun1|1767
ATGGCTGACGGCGACGATGACGTTAAGCTGAAGGTCCCCAGGTTCTCATCCTTCAAGCCCCAGGCGTCGGAGCCG
GCTCGTGATGGCTCTGCGGAGGGGAAGTTGAGGGTTCCTAAGTTTTCGTCTTTTAAGGATCGGGAGGCGCACTTG
ACGGCGGGGGAGCGGAGGGGGGGAGGGCATGGCGGAGGAGAGGAGTTGCAGAGGGGGAAACGGAAGTATGATGCT
GTGGATGGGGAGGGGGGGAGACGTCTGCGGCGTGATGGGGATCTACGTGAGGAGCGGGGCCAGGAGAGGCATCAT
CGCGAGAAGCATCGCCACGAGGAGCATCGCCACAAGGAGCATCACCAGGAGAAGCATCGACATGAGAAGCATCGG
CATGAGAAGCATCGCCGCGATGAGAATTATCACGAAAAGCACTATCGCGACAAGCATCATCACGATGAGCATCAC
CGCGATAATCTTCGCTCACGTTCCCATCGTGGCTCTCATCATCGCGATACCTCACACAGAGAAAAGCAGCATCAG
CGCTCCAGAGATCAAGAAAAGCAACGAGCTAGCACCGGCCTCGCAGAATCGGTTCCCGGTCTCTTCGTAATCGAC
ACAAAAGGCGATCCCCTCATCAGAAAATACGGTCTCGACCGCTACAGGATACCGTCTTACTCTCGCTACGGCGGC
AACAGAGTGCTGGGGACGGATGGACGCCTCGTCATCCATAGAGACGGACCGGTGCAAAAATTCAGCCTTTTGTTA
CCTGGGCAACGACTATCCGACCTGCTGGGTGAGCGGTCGTCAAGCAGCCGCGACCGAGGCGGATTGCGATCCGGA
AATTGGATACAGCCCAAGGCCTTGAGACTTCGCCCTCGACGGAATAAGATTGCCGATGACGACGAAGAGGAGGGA
TATTTGTGTCTGGAGAGTCCGCGGAAACGCCGACGACACCATCTACACAGCGAATCATCTGACGGAGAAGACGCG
ACGCCTTGGAGATCGATCGAGGCCAAGGCCAAAGTAGATGACGAGGAGGAGGACGCGTCGAGCGAATCTGACGTG
GCAGAACCCGACGATCCCTTGCGATGGAAGTCCAGCCAGCTTCATAGGCGTGTCAAAGATCATCCGGACGATATA
GCCGGCTGGCTCGAGTTGGTCGCTCACCAGGATATTGTCCTCTCTGGCGACAACAAGGCTGAGAATGACGTTTCT
GAAAATGCGGCTCGCAGCGTCTCCGAGGTCAAGGTGAACCTACTCGAGTCAGCGCTGCCACACGCGACACGGCCT
TCAGATCGTGAGACGGTTCTGGTTGCCCTCATGCGCGAAGGCGTCAAGATCTGGAGCCGGAACGTGGCCGCCAAG
AAGTGGGCACAAATCTCCGACGATGAGAATGGCAGCTTTGATCTGTGGAAGACGCATGTCGATTATGCCATGTCG
AGCATCACCACGGTTCAGTACGAGGCTGTCAAGACGATGATGGTCGAGCGGCTTCATCAACAAGTCCGTTCGCGA
GGCCCGCAGTCGTTTTCACGGGAAGCCATCTACGTCTTTCTCAGGACGACTAGATTCATCCACGATGCCGGCTAC
AAGGAGCTCGCCGTGGCGGCGTGGCAAGCTCTCTTGGAGCTCAACCTGTTCAGACCGGAGGGCATCGATAGCCAG
GCCCAGGCGCTGGCCACCTTTCGAGACTTCTGGGAGAGCGAGGTGCCGAGACTGGGCGACGCGGGAGCGCAGGGC
TGGAAGCAGTACGTTCAGAACGGCGGAGTGGGCGATGCCCCCGAGCCCGTCACCAACGTCGAGCCCGTGAAGGCG
TCACAGCAGGATTCTTACAGTGCCTGGGGAGCGACTGAACGCCTCCGCGGTGAGAGGGCTTCCATGCCGGCGAGG
ACGATGGACACCGGCACGGACGACGACCCGTTTAGAGTCGTCATGTACTCTGACATCGAGCCGCTGTTGTTTCTC
ATTCCCCAGAGTGAGCTGGAGGAAATGACTGGCCAGCTTGTCGACGCCTATCTCCTCTTCTGCGGACTTCCACCC
GTGTTTCGAGATAGCGACTTCACCGACACGGCGTGGCACGATCAGTTTGTGGTGCGAACCTGTGGCAATATCCAG
CTGCAGCCGGTCTGGGAGGCCGAGGGAGGAGACGACACTTGGACCAGAAAACCGCCTCTGTTCGATGGGGGGTCT
TGCCACTTGAGGTTGTCGGCGAGCCTGCTCTTCAGCGGCAGCGCTTGGTTTCGCTATCTTAATGTGGCGGGTGAG
GATCATGTGGTTGATCTCTCATGGGTAGAGTCCACGCTGAAGCAGCTTGTTTACTCGGCCAACATGCCGACTCTG
GCGTTGTACTACCTGGGACTATGCTTCGTCAGAGACGCAGGGTCTATCAGGAAACACGCAAAGGCCCTGTTGAAG
CGGTATCCGACGGACGTGCGTCTCTACAACGGCTACGCGCTGGCCGAGTTTGCCAATGGGAATGATGAGTTGGCC
ATCAAAGTACTGGCTTCCGCTGTTAAGTCTGAAGCGTTGGCCTCGACCTCGACGGGGTTCATCCTCTTCAAGACG
TGGAGCTGGATCGAGTTACAGAGGGGCAATAAGGAGCTGGCCACGAGGCGTCTCTGTGCAGTCGTCGATAAATCA
TTGCTGACGGACGAAGGCGTCATCTCGCCGTTGGTCGCGACTCAGGCGAATAACCGGTTTCAGTACGGCACCTCA
AGGAGCCTAGACGAGGGAGACCAGGAGGCGGCACGAGGCCATATTGAGTGCCTCGCACTGCTGGCATATCTCACC
CACAAGGGGGGCTCTGAGCCAGCGTCGAAGAGTCAAGGCAATATCTCGGCAGCCACGAAGGTCTTGACGTTGGCT
ATGGAAGACAACTGCTTGGGTTCATCTACCAAGGAACTCCTGCTTCAATGTGCCTCGAAGATGCTATATTTCCAC
TCGACAAAGGGACCTTTCCGACGAGCATTCATGCGGGAGCAGCTGGCGGGCTTCATCAACAGGTTCCCCCAAAAC
ACCATGTTCATAAGCCTCTTCGCATGGGCAGACACTGGCGTTGGAGTCATCGACGAGACACGCCAGCTACTGGCA
GACAAGGTCCTCACCAAGACACACGACGCAGTCAGCAGCAGACTCTTGGCCGTCTCTTACGAGCTGACGCGCGGA
AACGCCCACCGCACGCGGGCAGCCCTCCAGCAAGCCGTCTCCAGCGAGGCGTGCAGGTCGAGCGTGGTGCTGTGG
CTGTGGTACGTGCGCTTCTGCCGGTCGCAGGCGTCGCTGCGGGCTGGGGCGGGGGAGGTGCTGTATCGGGCGCTG
GGGTGCCTCAACACGCTGGCCAACCACGGCTACATCGAACGTTCAGGCCGGGGCATAACCTTTGCCGACGCGGTA
AAGGGCTGCTTCGACGGTCTGGGCGTCTCGCCTGAAGTGAGCGGCATCTCGGCTTACAACGTCCTCCGCGTTACC
TCGACCTTCTTTCATCCTGCCTTCAAGTTTGATCTTCGGAGCTTGGGGGCGCATTATAAACCTATTGAGCATGAC
GTTAGCTTCTCTCGCGAAGATGATGCCCTTGGCGATCGGAATGTTTTTAATCCCAGGATATGGTCGTCTGTTCTT
CGAGTCATTGGCCGCTCCTACGAGATTACGCCTGAGATGCTGGGCAAGGCAAAAGACATGCGATACCTGCAGCAG
AAAGCCAAGAGCTCTAAAATCAGATACGACGTTGACACTGCGAAGCTGGGCGGTACAGAGGTGGGCATGCTGCTC
ACCGCTGGCTTCACCAAGCTCCCCTGGATAAGGAGCCTGTTCGAGCAAGAGCGGTTACCATCTCATCTCGGCTGG
CAGAGGACTCAATGGGGCACTAACATCGTCAGCACCGTCACTGTTGCTCACCGGTCTCTCAGGGCGCAGAGGTAT
ATCCCGGCTGAGCTTCGGGCTAAGCTTGACGGGCCGTTTGATGTGAGATGGAATGAGGTTGTCTGGGGTGGAGGG
GGGCTGACTGCTTGTTAG
Transcript >Ophun1|1767
ATGGCTGACGGCGACGATGACGTTAAGCTGAAGGTCCCCAGGTTCTCATCCTTCAAGCCCCAGGCGTCGGAGCCG
GCTCGTGATGGCTCTGCGGAGGGGAAGTTGAGGGTTCCTAAGTTTTCGTCTTTTAAGGATCGGGAGGCGCACTTG
ACGGCGGGGGAGCGGAGGGGGGGAGGGCATGGCGGAGGAGAGGAGTTGCAGAGGGGGAAACGGAAGTATGATGCT
GTGGATGGGGAGGGGGGGAGACGTCTGCGGCGTGATGGGGATCTACGTGAGGAGCGGGGCCAGGAGAGGCATCAT
CGCGAGAAGCATCGCCACGAGGAGCATCGCCACAAGGAGCATCACCAGGAGAAGCATCGACATGAGAAGCATCGG
CATGAGAAGCATCGCCGCGATGAGAATTATCACGAAAAGCACTATCGCGACAAGCATCATCACGATGAGCATCAC
CGCGATAATCTTCGCTCACGTTCCCATCGTGGCTCTCATCATCGCGATACCTCACACAGAGAAAAGCAGCATCAG
CGCTCCAGAGATCAAGAAAAGCAACGAGCTAGCACCGGCCTCGCAGAATCGGTTCCCGGTCTCTTCGTAATCGAC
ACAAAAGGCGATCCCCTCATCAGAAAATACGGTCTCGACCGCTACAGGATACCGTCTTACTCTCGCTACGGCGGC
AACAGAGTGCTGGGGACGGATGGACGCCTCGTCATCCATAGAGACGGACCGGTGCAAAAATTCAGCCTTTTGTTA
CCTGGGCAACGACTATCCGACCTGCTGGGTGAGCGGTCGTCAAGCAGCCGCGACCGAGGCGGATTGCGATCCGGA
AATTGGATACAGCCCAAGGCCTTGAGACTTCGCCCTCGACGGAATAAGATTGCCGATGACGACGAAGAGGAGGGA
TATTTGTGTCTGGAGAGTCCGCGGAAACGCCGACGACACCATCTACACAGCGAATCATCTGACGGAGAAGACGCG
ACGCCTTGGAGATCGATCGAGGCCAAGGCCAAAGTAGATGACGAGGAGGAGGACGCGTCGAGCGAATCTGACGTG
GCAGAACCCGACGATCCCTTGCGATGGAAGTCCAGCCAGCTTCATAGGCGTGTCAAAGATCATCCGGACGATATA
GCCGGCTGGCTCGAGTTGGTCGCTCACCAGGATATTGTCCTCTCTGGCGACAACAAGGCTGAGAATGACGTTTCT
GAAAATGCGGCTCGCAGCGTCTCCGAGGTCAAGGTGAACCTACTCGAGTCAGCGCTGCCACACGCGACACGGCCT
TCAGATCGTGAGACGGTTCTGGTTGCCCTCATGCGCGAAGGCGTCAAGATCTGGAGCCGGAACGTGGCCGCCAAG
AAGTGGGCACAAATCTCCGACGATGAGAATGGCAGCTTTGATCTGTGGAAGACGCATGTCGATTATGCCATGTCG
AGCATCACCACGGTTCAGTACGAGGCTGTCAAGACGATGATGGTCGAGCGGCTTCATCAACAAGTCCGTTCGCGA
GGCCCGCAGTCGTTTTCACGGGAAGCCATCTACGTCTTTCTCAGGACGACTAGATTCATCCACGATGCCGGCTAC
AAGGAGCTCGCCGTGGCGGCGTGGCAAGCTCTCTTGGAGCTCAACCTGTTCAGACCGGAGGGCATCGATAGCCAG
GCCCAGGCGCTGGCCACCTTTCGAGACTTCTGGGAGAGCGAGGTGCCGAGACTGGGCGACGCGGGAGCGCAGGGC
TGGAAGCAGTACGTTCAGAACGGCGGAGTGGGCGATGCCCCCGAGCCCGTCACCAACGTCGAGCCCGTGAAGGCG
TCACAGCAGGATTCTTACAGTGCCTGGGGAGCGACTGAACGCCTCCGCGGTGAGAGGGCTTCCATGCCGGCGAGG
ACGATGGACACCGGCACGGACGACGACCCGTTTAGAGTCGTCATGTACTCTGACATCGAGCCGCTGTTGTTTCTC
ATTCCCCAGAGTGAGCTGGAGGAAATGACTGGCCAGCTTGTCGACGCCTATCTCCTCTTCTGCGGACTTCCACCC
GTGTTTCGAGATAGCGACTTCACCGACACGGCGTGGCACGATCAGTTTGTGGTGCGAACCTGTGGCAATATCCAG
CTGCAGCCGGTCTGGGAGGCCGAGGGAGGAGACGACACTTGGACCAGAAAACCGCCTCTGTTCGATGGGGGGTCT
TGCCACTTGAGGTTGTCGGCGAGCCTGCTCTTCAGCGGCAGCGCTTGGTTTCGCTATCTTAATGTGGCGGGTGAG
GATCATGTGGTTGATCTCTCATGGGTAGAGTCCACGCTGAAGCAGCTTGTTTACTCGGCCAACATGCCGACTCTG
GCGTTGTACTACCTGGGACTATGCTTCGTCAGAGACGCAGGGTCTATCAGGAAACACGCAAAGGCCCTGTTGAAG
CGGTATCCGACGGACGTGCGTCTCTACAACGGCTACGCGCTGGCCGAGTTTGCCAATGGGAATGATGAGTTGGCC
ATCAAAGTACTGGCTTCCGCTGTTAAGTCTGAAGCGTTGGCCTCGACCTCGACGGGGTTCATCCTCTTCAAGACG
TGGAGCTGGATCGAGTTACAGAGGGGCAATAAGGAGCTGGCCACGAGGCGTCTCTGTGCAGTCGTCGATAAATCA
TTGCTGACGGACGAAGGCGTCATCTCGCCGTTGGTCGCGACTCAGGCGAATAACCGGTTTCAGTACGGCACCTCA
AGGAGCCTAGACGAGGGAGACCAGGAGGCGGCACGAGGCCATATTGAGTGCCTCGCACTGCTGGCATATCTCACC
CACAAGGGGGGCTCTGAGCCAGCGTCGAAGAGTCAAGGCAATATCTCGGCAGCCACGAAGGTCTTGACGTTGGCT
ATGGAAGACAACTGCTTGGGTTCATCTACCAAGGAACTCCTGCTTCAATGTGCCTCGAAGATGCTATATTTCCAC
TCGACAAAGGGACCTTTCCGACGAGCATTCATGCGGGAGCAGCTGGCGGGCTTCATCAACAGGTTCCCCCAAAAC
ACCATGTTCATAAGCCTCTTCGCATGGGCAGACACTGGCGTTGGAGTCATCGACGAGACACGCCAGCTACTGGCA
GACAAGGTCCTCACCAAGACACACGACGCAGTCAGCAGCAGACTCTTGGCCGTCTCTTACGAGCTGACGCGCGGA
AACGCCCACCGCACGCGGGCAGCCCTCCAGCAAGCCGTCTCCAGCGAGGCGTGCAGGTCGAGCGTGGTGCTGTGG
CTGTGGTACGTGCGCTTCTGCCGGTCGCAGGCGTCGCTGCGGGCTGGGGCGGGGGAGGTGCTGTATCGGGCGCTG
GGGTGCCTCAACACGCTGGCCAACCACGGCTACATCGAACGTTCAGGCCGGGGCATAACCTTTGCCGACGCGGTA
AAGGGCTGCTTCGACGGTCTGGGCGTCTCGCCTGAAGTGAGCGGCATCTCGGCTTACAACGTCCTCCGCGTTACC
TCGACCTTCTTTCATCCTGCCTTCAAGTTTGATCTTCGGAGCTTGGGGGCGCATTATAAACCTATTGAGCATGAC
GTTAGCTTCTCTCGCGAAGATGATGCCCTTGGCGATCGGAATGTTTTTAATCCCAGGATATGGTCGTCTGTTCTT
CGAGTCATTGGCCGCTCCTACGAGATTACGCCTGAGATGCTGGGCAAGGCAAAAGACATGCGATACCTGCAGCAG
AAAGCCAAGAGCTCTAAAATCAGATACGACGTTGACACTGCGAAGCTGGGCGGTACAGAGGTGGGCATGCTGCTC
ACCGCTGGCTTCACCAAGCTCCCCTGGATAAGGAGCCTGTTCGAGCAAGAGCGGTTACCATCTCATCTCGGCTGG
CAGAGGACTCAATGGGGCACTAACATCGTCAGCACCGTCACTGTTGCTCACCGGTCTCTCAGGGCGCAGAGGTAT
ATCCCGGCTGAGCTTCGGGCTAAGCTTGACGGGCCGTTTGATGTGAGATGGAATGAGGTTGTCTGGGGTGGAGGG
GGGCTGACTGCTTGTTAG
Gene >Ophun1|1767
ATGGCTGACGGCGACGATGACGTTAAGCTGAAGGTCCCCAGGTTCTCATCCTTCAAGCCCCAGGCGTCGGAGCCG
GCTCGTGATGGCTCTGCGGAGGGGAAGTTGAGGGTTCCTAAGTTTTCGTCTTTTAAGGATCGGGAGGCGCACTTG
ACGGCGGGGGAGCGGAGGGGGGGAGGGCATGGCGGAGGAGAGGAGTTGCAGAGGGGGAAACGGAAGTATGATGCT
GTGGATGGGGAGGGGGGGAGACGTCTGCGGCGTGATGGGGATCTACGTGAGGAGCGGGGCCAGGAGAGGCATCAT
CGCGAGAAGCATCGCCACGAGGAGCATCGCCACAAGGAGCATCACCAGGAGAAGCATCGACATGAGAAGCATCGG
CATGAGAAGCATCGCCGCGATGAGAATTATCACGAAAAGCACTATCGCGACAAGCATCATCACGATGAGCATCAC
CGCGATAATCTTCGCTCACGTTCCCATCGTGGCTCTCATCATCGCGATACCTCACACAGAGAAAAGCAGCATCAG
CGCTCCAGAGATCAAGAAAAGCAACGAGCTAGCACCGGCCTCGCAGAATCGGTTCCCGGTCTCTTCGTAATCGAC
ACAAAAGGCGATCCCCTCATCAGAAAATACGGTCTCGACCGCTACAGGATACCGTCTTACTCTCGCTACGGCGGC
AACAGAGTGCTGGGGACGGATGGACGCCTCGTCATCCATAGAGACGGACCGGTGCAAAAATTCAGCCTTTTGTTA
CCTGGGCAACGACTATCCGACCTGCTGGGTGAGCGGTCGTCAAGCAGCCGCGACCGAGGCGGATTGCGATCCGGA
AATTGGATACAGCCCAAGGCCTTGAGACTTCGCCCTCGACGGAATAAGATTGCCGATGACGACGAAGAGGAGGGA
TATTTGTGTCTGGAGAGTCCGCGGAAACGCCGACGACACCATCTACACAGCGAATCATCTGACGGAGAAGACGCG
ACGCCTTGGAGATCGATCGAGGCCAAGGCCAAAGTAGATGACGAGGAGGAGGACGCGTCGAGCGAATCTGACGTG
GCAGAACCCGACGATCCCTTGCGATGGAAGTCCAGCCAGCTTCATAGGCGTGTCAAAGATCATCCGGACGATATA
GCCGGCTGGCTCGAGTTGGTCGCTCACCAGGATATTGTCCTCTCTGGCGACAACAAGGCTGAGAATGACGTTTCT
GAAAATGCGGCTCGCAGCGTCTCCGAGGTCAAGGTGAACCTACTCGAGTCAGCGCTGCCACACGCGACACGGCCT
TCAGATCGTGAGACGGTTCTGGTTGCCCTCATGCGCGAAGGCGTCAAGATCTGGAGCCGGAACGTGGCCGCCAAG
AAGTGGGCACAAATCTCCGACGATGAGAATGGCAGCTTTGATCTGTGGAAGACGCATGTCGATTATGCCATGTCG
AGCATCACCACGGTTCAGTACGAGGCTGTCAAGACGATGATGGTCGAGCGGCTTCATCAACAAGTCCGTTCGCGA
GGCCCGCAGTCGTTTTCACGGGAAGCCATCTACGTCTTTCTCAGGACGACTAGATTCATCCACGATGCCGGCTAC
AAGGAGCTCGCCGTGGCGGCGTGGCAAGCTCTCTTGGAGCTCAACCTGTTCAGACCGGAGGGCATCGATAGCCAG
GCCCAGGCGCTGGCCACCTTTCGAGACTTCTGGGAGAGCGAGGTGCCGAGACTGGGCGACGCGGGAGCGCAGGGC
TGGAAGCAGTACGTTCAGAACGGCGGAGTGGGCGATGCCCCCGAGCCCGTCACCAACGTCGAGCCCGTGAAGGCG
TCACAGCAGGATTCTTACAGTGCCTGGGGAGCGACTGAACGCCTCCGCGGTGAGAGGGCTTCCATGCCGGCGAGG
ACGATGGACACCGGCACGGACGACGACCCGTTTAGAGTCGTCATGTACTCTGACATCGAGCCGCTGTTGTTTCTC
ATTCCCCAGAGTGAGCTGGAGGAAATGACTGGCCAGCTTGTCGACGCCTATCTCCTCTTCTGCGGACTTCCACCC
GTGTTTCGAGATAGCGACTTCACCGACACGGCGTGGCACGATCAGTTTGTGGTGCGAACCTGTGGCAATATCCAG
CTGCAGCCGGTCTGGGAGGCCGAGGGAGGAGACGACACTTGGACCAGAAAACCGCCTCTGTTCGATGGGGGGTCT
TGCCACTTGAGGTTGTCGGCGAGCCTGCTCTTCAGCGGCAGCGCTTGGTTTCGCTATCTTAATGTGGCGGGTGAG
GATCATGTGGTTGATCTCTCATGGGTAGAGTCCACGCTGAAGCAGCTTGTTTACTCGGCCAACATGCCGACTCTG
GCGTTGTACTACCTGGGACTATGCTTCGTCAGAGACGCAGGGTCTATCAGGAAACACGCAAAGGCCCTGTTGAAG
CGGTATCCGACGGACGTGCGTCTCTACAACGGCTACGCGCTGGCCGAGTTTGCCAATGGGAATGATGAGTTGGCC
ATCAAAGTACTGGCTTCCGCTGTTAAGTCTGAAGCGGTAAGACTACATCCATTCGGCCCATCTTTTGTCAGCTAA
CTCGTACAGTTGGCCTCGACCTCGACGGGGTTCATCCTCTTCAAGACGTGGAGCTGGATCGAGTTACAGAGGGGC
AATAAGGAGCTGGCCACGAGGCGTCTCTGTGCAGTCGTCGATAAATCATTGCTGACGGACGAAGGCGTCATCTCG
CCGTTGGTCGCGACTCAGGCGAATAACCGGTTTCAGTACGGCACCTCAAGGAGCCTAGACGAGGGAGACCAGGAG
GCGGCACGAGGCCATATTGAGTGCCTCGCACTGCTGGCATATCTCACCCACAAGGGGGGCTCTGAGCCAGCGTCG
AAGAGTCAAGGCAATATCTCGGCAGCCACGAAGGTCTTGACGTTGGCTATGGAAGACAACTGCTTGGGTTCATCT
ACCAAGGAACTCCTGCTTCAATGTGCCTCGAAGATGCTATATTTCCACTCGACAAAGGGGTACGTCACAGCTCTT
TACAAGACCCGTCTCTGTTACTGAACCCTCTCCCCTACAGACCTTTCCGACGAGCATTCATGCGGGAGCAGCTGG
CGGGCTTCATCAACAGGTTCCCCCAAAACACCATGTTCATAAGCCTCTTCGCATGGGCAGACACTGGCGTTGGAG
TCATCGACGAGACACGCCAGCTACTGGCAGACAAGGTCCTCACCAAGACACACGACGCAGTCAGCAGCAGACTCT
TGGCCGTCTCTTACGAGCTGACGCGCGGAAACGCCCACCGCACGCGGGCAGCCCTCCAGCAAGCCGTCTCCAGCG
AGGCGTGCAGGTCGAGCGTGGTGCTGTGGCTGTGGTACGTGCGCTTCTGCCGGTCGCAGGCGTCGCTGCGGGCTG
GGGCGGGGGAGGTGCTGTATCGGGCGCTGGGGTGTTGTCCCTGGTCCAAGGAGTTGATGATGGAGGCTTTTTTGC
TGGGGTTGGGGGAGGGGGAGTTGAGGGCTGTGTATGAGGGGATGGAGGCTAAGGGGTTGAGGATTCATGGGGAAG
TTGGGGGGGGGTGAGGAGTGGTTGCTGTTGGGGGTAGGAGGCTGAACTTGAGAGGATAGAGTCACGATACTGGAG
CAGAGTTGTGATGCTGGAGCAGAGTTGTGATGCTGGAGCAGGGTTGTGATACTGGAGCAGAGTCACGATACTGGA
GCAGAGTTGTGATGACTGGAACAGAGTCATGGTAATGGTGCATGATGAACTCTTCAGACACGATGGAGATGTCAG
GCTACACAAGCAGCCAACTCCTAGTTCAACAGCTGTTCCTCACCCGCCACGTCATAACCAGAAACCAGGCCATCA
AGATGGTAGCCGATACAGCGTGTCTTAGTCTCAACTCGCCTCGTGGTCCTTCCGAGACAATGTCTCTTGCAGAAA
GCACATGGCATGCACGCATGAAGGAACGAGAGTGAATCAGCGGGGCTGGTGCACTATATTCTGGTTGGGATGGAC
TTAAAGTCCGTGGCTTGCATGCTGTGCTTTCCTCTCGGTTTGCTCTTCGAGGTCTGTTCACCATGAGACGTCTGG
CGGTCATACTCATGACATGGTCTTCCATCTCGTGCTCTTCAGCATTCAACGTTCCCGCGAGAGATTACCTCGCAG
ACGGACCCAACCGATACCAACGTCCAAAACCCGGAGACGGTGAACCCACCCCCAGCAGAGTTCGAATTCCAACTC
CCAGCTAACACGGTAAAGTCCGGGGACCATGTCCAGGCCTCAACACGCTGGCCAACCACGGCTACATCGAACGTT
CAGGCCGGGGCATAACCTTTGCCGACGCGGTAAAGGGCTGCTTCGACGGTCTGGGCGTCTCGCCTGAAGTGAGCG
GCATCTCGGCTTACAACGTCCTCCGCGTTACCTCGACCTTCTTTCATCCTGCCTTCAAGTTTGATCTTCGGAGCT
TGGGGGCGCATTATAAACCTATTGAGCATGACGTTAGCTTCTCTCGCGAAGATGATGCCCTTGGCGATCGGAATG
TTTTTAATCCCAGGATATGGTCGTCTGTTCTTCGAGTCATTGGCCGCTCCTACGAGATTACGCCTGAGATGCTGG
GCAAGGCAAAAGACATGCGATACCTGCAGCAGAAAGCCAAGAGCTCTAAAATCAGATACGACGTTGACACTGCGA
AGCTGGGCGGTACAGAGGTGGGCATGCTGCTCACCGCTGGCTTCACCAAGCTCCCCTGGATAAGGAGCCTGTTCG
AGCAAGAGCGGTTACCATCTCATCTCGGCTGGCAGAGGACTCAATGGGGCACTAACATCGTCAGCACCGTCACTG
TTGCTCACCGGTCTCTCAGGGCGCAGAGGTATATCCCGGCTGAGCTTCGGGCTAAGCTTGACGGGCCGTTTGATG
TGAGATGGAATGAGGTTGTCTGGGGTGGAGGGGGGCTGACTGCTTGTTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail