Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|1758
Gene name
LocationContig_177:18693..20140
Strand+
Gene length (bp)1447
Transcript length (bp)1395
Coding sequence length (bp)1395
Protein length (aa) 465

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

SignalP signal predicted Location Score
Yes 1 - 24 0.999675

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup725
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2549
Ophiocordyceps australis map64 (Brazil) OphauB2|8150
Ophiocordyceps camponoti-floridani Ophcf2|00846
Ophiocordyceps camponoti-rufipedis Ophun1|1758 (this protein)
Ophiocordyceps kimflemingae Ophio5|607
Ophiocordyceps subramaniannii Hirsu2|1750
Ophiocordyceps subramaniannii Hirsu2|3274
Ophiocordyceps subramaniannii Hirsu2|4091

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|1758
MAAIKTLSWSLAAVLLNSPLLTKAEKVEARPLGKDVTIKGNAVSWISPGGFEDGFQCRNSRILCISDDKTMAACC
EEKNKLKGSLESGFYCCAEGHDLAGSKEVGYSCCPTGQQFDGKVCKLVCTNGKVLVDGKCACPVGLEEAAEGGCI
KPKCTSGLMTGKCYMFKGESGRRLAYKNKQYSEAIPSKDTIPGKFQLCRDEKCTPNLPINPSQEIHIRDVHGSPP
DSADANQWLNNASGGNHMGKTAKYAESGNFTITKWPCGKYCLSGLQTGLGPACPSEDPSITFYRTLSEACVEFEL
LEVPCKIRDSKNNCIWKGSQKCCGKEVCLAEDETPEPSTQPSSSPSSSSSPSTATEAAPPSETKPPNAQLCPDKH
GMTLEANGIGFRVLCGWYYAAKDKLDELKNVRDPLTCHAKCAADSKCQGANFNWASFFCTHQIDWAAEMKDGGNV
TGCVTFHPTKPRPI*
Coding >Ophun1|1758
ATGGCGGCAATCAAGACCCTCTCCTGGAGCCTTGCGGCCGTCCTCCTCAACTCGCCCTTGCTCACCAAGGCAGAA
AAGGTGGAAGCCAGACCGCTGGGCAAGGACGTGACCATCAAGGGCAACGCCGTGTCGTGGATCAGCCCCGGCGGC
TTCGAAGACGGCTTCCAGTGCCGCAACTCGCGGATCCTCTGCATCAGCGATGACAAGACCATGGCCGCCTGCTGC
GAGGAAAAGAACAAGCTCAAGGGGTCGCTCGAGTCGGGCTTCTACTGCTGCGCTGAAGGACACGACCTTGCTGGC
TCTAAGGAGGTCGGCTACAGTTGCTGCCCGACGGGTCAGCAGTTTGACGGCAAGGTGTGCAAGCTGGTCTGTACG
AATGGCAAGGTGCTCGTCGACGGCAAGTGTGCCTGTCCCGTGGGACTTGAGGAGGCGGCCGAAGGCGGCTGTATC
AAGCCAAAGTGCACCTCTGGGTTGATGACTGGCAAATGCTACATGTTCAAGGGCGAGTCCGGACGTCGTCTGGCC
TACAAGAACAAGCAGTACTCCGAGGCAATCCCTAGTAAGGATACAATTCCAGGGAAATTCCAGCTGTGTAGGGAC
GAAAAGTGCACGCCCAACCTGCCCATCAACCCGAGCCAAGAGATCCATATCCGAGACGTCCACGGCTCTCCCCCG
GACTCAGCCGACGCCAACCAGTGGCTCAACAACGCCAGCGGAGGCAACCACATGGGAAAGACGGCCAAGTACGCC
GAGTCTGGCAACTTTACCATCACGAAGTGGCCCTGCGGCAAGTATTGTCTCAGTGGTCTTCAGACGGGCCTCGGA
CCGGCTTGCCCCAGCGAGGACCCGTCCATCACCTTCTACCGCACTCTCAGCGAGGCCTGTGTCGAGTTTGAGCTG
CTCGAGGTGCCGTGCAAGATCCGGGACAGCAAGAACAACTGCATCTGGAAGGGCAGCCAGAAGTGTTGTGGTAAG
GAGGTGTGTCTCGCAGAAGATGAAACCCCTGAGCCCTCGACCCAGCCCTCGTCATCGCCCTCTTCTTCGTCATCA
CCCTCGACGGCAACCGAAGCCGCCCCCCCCTCGGAGACGAAGCCGCCCAATGCCCAGCTCTGCCCGGATAAGCAC
GGAATGACTCTCGAGGCCAATGGCATCGGCTTCCGCGTCCTCTGCGGCTGGTACTACGCAGCCAAGGACAAGCTC
GACGAGTTGAAGAACGTTCGCGATCCTCTGACGTGTCATGCCAAGTGTGCGGCCGACAGCAAGTGCCAGGGCGCC
AACTTTAACTGGGCCAGCTTCTTCTGTACCCATCAGATTGACTGGGCGGCTGAGATGAAGGACGGAGGCAACGTC
ACGGGTTGTGTGACTTTCCATCCGACGAAGCCGCGGCCCATCTAG
Transcript >Ophun1|1758
ATGGCGGCAATCAAGACCCTCTCCTGGAGCCTTGCGGCCGTCCTCCTCAACTCGCCCTTGCTCACCAAGGCAGAA
AAGGTGGAAGCCAGACCGCTGGGCAAGGACGTGACCATCAAGGGCAACGCCGTGTCGTGGATCAGCCCCGGCGGC
TTCGAAGACGGCTTCCAGTGCCGCAACTCGCGGATCCTCTGCATCAGCGATGACAAGACCATGGCCGCCTGCTGC
GAGGAAAAGAACAAGCTCAAGGGGTCGCTCGAGTCGGGCTTCTACTGCTGCGCTGAAGGACACGACCTTGCTGGC
TCTAAGGAGGTCGGCTACAGTTGCTGCCCGACGGGTCAGCAGTTTGACGGCAAGGTGTGCAAGCTGGTCTGTACG
AATGGCAAGGTGCTCGTCGACGGCAAGTGTGCCTGTCCCGTGGGACTTGAGGAGGCGGCCGAAGGCGGCTGTATC
AAGCCAAAGTGCACCTCTGGGTTGATGACTGGCAAATGCTACATGTTCAAGGGCGAGTCCGGACGTCGTCTGGCC
TACAAGAACAAGCAGTACTCCGAGGCAATCCCTAGTAAGGATACAATTCCAGGGAAATTCCAGCTGTGTAGGGAC
GAAAAGTGCACGCCCAACCTGCCCATCAACCCGAGCCAAGAGATCCATATCCGAGACGTCCACGGCTCTCCCCCG
GACTCAGCCGACGCCAACCAGTGGCTCAACAACGCCAGCGGAGGCAACCACATGGGAAAGACGGCCAAGTACGCC
GAGTCTGGCAACTTTACCATCACGAAGTGGCCCTGCGGCAAGTATTGTCTCAGTGGTCTTCAGACGGGCCTCGGA
CCGGCTTGCCCCAGCGAGGACCCGTCCATCACCTTCTACCGCACTCTCAGCGAGGCCTGTGTCGAGTTTGAGCTG
CTCGAGGTGCCGTGCAAGATCCGGGACAGCAAGAACAACTGCATCTGGAAGGGCAGCCAGAAGTGTTGTGGTAAG
GAGGTGTGTCTCGCAGAAGATGAAACCCCTGAGCCCTCGACCCAGCCCTCGTCATCGCCCTCTTCTTCGTCATCA
CCCTCGACGGCAACCGAAGCCGCCCCCCCCTCGGAGACGAAGCCGCCCAATGCCCAGCTCTGCCCGGATAAGCAC
GGAATGACTCTCGAGGCCAATGGCATCGGCTTCCGCGTCCTCTGCGGCTGGTACTACGCAGCCAAGGACAAGCTC
GACGAGTTGAAGAACGTTCGCGATCCTCTGACGTGTCATGCCAAGTGTGCGGCCGACAGCAAGTGCCAGGGCGCC
AACTTTAACTGGGCCAGCTTCTTCTGTACCCATCAGATTGACTGGGCGGCTGAGATGAAGGACGGAGGCAACGTC
ACGGGTTGTGTGACTTTCCATCCGACGAAGCCGCGGCCCATCTAG
Gene >Ophun1|1758
ATGGCGGCAATCAAGACCCTCTCCTGGAGCCTTGCGGCCGTCCTCCTCAACTCGCCCTTGCTCACCAAGGCAGAA
AAGGTGGAAGCCAGACCGCTGGGCAAGGACGTGACCATCAAGGGCAACGCCGTGTCGTGGATCAGCCCCGGCGGC
TTCGAAGACGGCTTCCAGTGCCGCAACTCGCGGATCCTCTGCATCAGCGATGACAAGACCATGGCCGCCTGCTGC
GAGGAAAAGAACAAGCTCAAGGGGTCGCTCGAGTCGGGCTTCTACTGCTGCGCTGAAGGACACGACCTTGCTGGC
TCTAAGGAGGTCGGCTACAGTTGCTGCCCGACGGGTCAGCAGTTTGACGGCAAGGTGTGCAAGCTGGTCTGTACG
AATGGCAAGGTGCTCGTCGACGGCAAGTGTGCCTGTCCCGTGGGACTTGAGGAGGCGGCCGAAGGCGGCTGTATC
AAGCCAAAGTGCACCTCTGGGTTGATGACTGGTAACTATTTCACACAAGATATACCACCGACATCATATGCTAAC
CCTCTCAGGCAAATGCTACATGTTCAAGGGCGAGTCCGGACGTCGTCTGGCCTACAAGAACAAGCAGTACTCCGA
GGCAATCCCTAGTAAGGATACAATTCCAGGGAAATTCCAGCTGTGTAGGGACGAAAAGTGCACGCCCAACCTGCC
CATCAACCCGAGCCAAGAGATCCATATCCGAGACGTCCACGGCTCTCCCCCGGACTCAGCCGACGCCAACCAGTG
GCTCAACAACGCCAGCGGAGGCAACCACATGGGAAAGACGGCCAAGTACGCCGAGTCTGGCAACTTTACCATCAC
GAAGTGGCCCTGCGGCAAGTATTGTCTCAGTGGTCTTCAGACGGGCCTCGGACCGGCTTGCCCCAGCGAGGACCC
GTCCATCACCTTCTACCGCACTCTCAGCGAGGCCTGTGTCGAGTTTGAGCTGCTCGAGGTGCCGTGCAAGATCCG
GGACAGCAAGAACAACTGCATCTGGAAGGGCAGCCAGAAGTGTTGTGGTAAGGAGGTGTGTCTCGCAGAAGATGA
AACCCCTGAGCCCTCGACCCAGCCCTCGTCATCGCCCTCTTCTTCGTCATCACCCTCGACGGCAACCGAAGCCGC
CCCCCCCTCGGAGACGAAGCCGCCCAATGCCCAGCTCTGCCCGGATAAGCACGGAATGACTCTCGAGGCCAATGG
CATCGGCTTCCGCGTCCTCTGCGGCTGGTACTACGCAGCCAAGGACAAGCTCGACGAGTTGAAGAACGTTCGCGA
TCCTCTGACGTGTCATGCCAAGTGTGCGGCCGACAGCAAGTGCCAGGGCGCCAACTTTAACTGGGCCAGCTTCTT
CTGTACCCATCAGATTGACTGGGCGGCTGAGATGAAGGACGGAGGCAACGTCACGGGTTGTGTGACTTTCCATCC
GACGAAGCCGCGGCCCATCTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail