Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|1756
Gene name
LocationContig_177:14055..16273
Strand+
Gene length (bp)2218
Transcript length (bp)2115
Coding sequence length (bp)2115
Protein length (aa) 705

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02786 CPSase_L_D2 Carbamoyl-phosphate synthase L chain, ATP binding domain 2.0E-74 136 346
PF00289 Biotin_carb_N Biotin carboxylase, N-terminal domain 1.8E-34 27 131
PF02785 Biotin_carb_C Biotin carboxylase C-terminal domain 2.9E-34 364 471
PF00364 Biotin_lipoyl Biotin-requiring enzyme 1.2E-13 634 697
PF07478 Dala_Dala_lig_C D-ala D-ala ligase C-terminus 7.5E-09 163 315
PF13533 Biotin_lipoyl_2 Biotin-lipoyl like 1.8E-05 632 667
PF02222 ATP-grasp ATP-grasp domain 6.7E-08 153 316

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q5I0C3|MCCA_RAT Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial OS=Rattus norvegicus GN=Mccc1 PE=1 SV=1 12 703 0.0E+00
sp|Q96RQ3|MCCA_HUMAN Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial OS=Homo sapiens GN=MCCC1 PE=1 SV=3 13 704 0.0E+00
sp|Q99MR8|MCCA_MOUSE Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial OS=Mus musculus GN=Mccc1 PE=1 SV=2 13 704 2.0E-180
sp|Q54KE6|MCCA_DICDI Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial OS=Dictyostelium discoideum GN=mccA PE=3 SV=1 23 691 4.0E-176
sp|Q42523|MCCA_ARATH Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial OS=Arabidopsis thaliana GN=MCCA PE=1 SV=2 24 696 2.0E-173
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q5I0C3|MCCA_RAT Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial OS=Rattus norvegicus GN=Mccc1 PE=1 SV=1 12 703 0.0E+00
sp|Q96RQ3|MCCA_HUMAN Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial OS=Homo sapiens GN=MCCC1 PE=1 SV=3 13 704 0.0E+00
sp|Q99MR8|MCCA_MOUSE Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial OS=Mus musculus GN=Mccc1 PE=1 SV=2 13 704 2.0E-180
sp|Q54KE6|MCCA_DICDI Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial OS=Dictyostelium discoideum GN=mccA PE=3 SV=1 23 691 4.0E-176
sp|Q42523|MCCA_ARATH Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial OS=Arabidopsis thaliana GN=MCCA PE=1 SV=2 24 696 2.0E-173
sp|Q42777|MCCA_SOYBN Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial OS=Glycine max GN=MCCA PE=1 SV=2 20 696 6.0E-165
sp|Q2QMG2|MCCA_ORYSJ Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial OS=Oryza sativa subsp. japonica GN=MCCA PE=2 SV=2 26 479 2.0E-156
sp|P9WPQ3|BCCA_MYCTU Acetyl-/propionyl-coenzyme A carboxylase alpha chain OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=accA1 PE=1 SV=1 26 682 8.0E-146
sp|P9WPQ2|BCCA_MYCTO Acetyl-/propionyl-coenzyme A carboxylase alpha chain OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=accA1 PE=3 SV=1 26 682 8.0E-146
sp|P0A509|BCCA_MYCBO Acetyl-/propionyl-coenzyme A carboxylase alpha chain OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=accA1 PE=3 SV=1 26 682 8.0E-146
sp|Q19842|PCCA_CAEEL Propionyl-CoA carboxylase alpha chain, mitochondrial OS=Caenorhabditis elegans GN=pcca-1 PE=1 SV=1 26 700 4.0E-131
sp|Q06862|ACCC_NOSS1 Biotin carboxylase OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=accC PE=3 SV=1 26 475 7.0E-131
sp|Q612F5|PCCA_CAEBR Propionyl-CoA carboxylase alpha chain, mitochondrial OS=Caenorhabditis briggsae GN=pcca-1 PE=3 SV=1 26 700 1.0E-128
sp|O34544|ACCC2_BACSU Biotin carboxylase 2 OS=Bacillus subtilis (strain 168) GN=accC2 PE=3 SV=1 29 473 2.0E-124
sp|Q9KDS9|ACCC_BACHD Biotin carboxylase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=accC PE=3 SV=1 26 470 3.0E-124
sp|B9N843|ACCC2_POPTR Biotin carboxylase 2, chloroplastic OS=Populus trichocarpa GN=POPTR_0018s14250g PE=2 SV=2 22 479 5.0E-123
sp|B9HBA8|ACCC1_POPTR Biotin carboxylase 1, chloroplastic OS=Populus trichocarpa GN=POPTRDRAFT_831870 PE=2 SV=1 21 479 2.0E-122
sp|O04983|ACCC_ARATH Biotin carboxylase, chloroplastic OS=Arabidopsis thaliana GN=CAC2 PE=1 SV=1 5 477 2.0E-122
sp|Q58626|PYCA_METJA Pyruvate carboxylase subunit A OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=pycA PE=1 SV=1 26 481 2.0E-121
sp|P49787|ACCC1_BACSU Biotin carboxylase 1 OS=Bacillus subtilis (strain 168) GN=accC1 PE=3 SV=3 26 473 2.0E-120
sp|Q91ZA3|PCCA_MOUSE Propionyl-CoA carboxylase alpha chain, mitochondrial OS=Mus musculus GN=Pcca PE=1 SV=2 24 700 1.0E-119
sp|P05165|PCCA_HUMAN Propionyl-CoA carboxylase alpha chain, mitochondrial OS=Homo sapiens GN=PCCA PE=1 SV=4 24 700 9.0E-118
sp|O27939|PYCA_METTH Pyruvate carboxylase subunit A OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=pycA PE=1 SV=1 26 481 1.0E-116
sp|P14882|PCCA_RAT Propionyl-CoA carboxylase alpha chain, mitochondrial OS=Rattus norvegicus GN=Pcca PE=1 SV=3 24 700 7.0E-116
sp|O30019|PYCA_ARCFU Pyruvate carboxylase subunit A OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=pycA PE=3 SV=1 26 472 1.0E-115
sp|Q8X9B6|ACCC_ECO57 Biotin carboxylase OS=Escherichia coli O157:H7 GN=accC PE=3 SV=1 26 472 9.0E-114
sp|P24182|ACCC_ECOLI Biotin carboxylase OS=Escherichia coli (strain K12) GN=accC PE=1 SV=2 26 472 1.0E-113
sp|P37798|ACCC_PSEAE Biotin carboxylase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=accC PE=1 SV=1 26 472 2.0E-113
sp|D3DJ42|2OCS_HYDTT 2-oxoglutarate carboxylase small subunit OS=Hydrogenobacter thermophilus (strain DSM 6534 / IAM 12695 / TK-6) GN=cfiB PE=1 SV=1 26 472 5.0E-112
sp|Q9KWU4|PYC_BACSU Pyruvate carboxylase OS=Bacillus subtilis (strain 168) GN=pyc PE=3 SV=1 22 471 8.0E-111
sp|O52058|ACCC_ALLVD Biotin carboxylase OS=Allochromatium vinosum (strain ATCC 17899 / DSM 180 / NBRC 103801 / NCIMB 10441 / D) GN=accC PE=3 SV=2 26 473 1.0E-110
sp|O17732|PYC1_CAEEL Pyruvate carboxylase 1 OS=Caenorhabditis elegans GN=pyc-1 PE=1 SV=1 24 496 4.0E-108
sp|P43873|ACCC_HAEIN Biotin carboxylase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=accC PE=1 SV=1 26 472 6.0E-108
sp|A5H0J2|DUR1_LACKL Urea amidolyase OS=Lachancea kluyveri GN=DUR1,2 PE=3 SV=1 24 473 3.0E-106
sp|P52873|PYC_RAT Pyruvate carboxylase, mitochondrial OS=Rattus norvegicus GN=Pc PE=1 SV=2 7 496 1.0E-105
sp|Q05920|PYC_MOUSE Pyruvate carboxylase, mitochondrial OS=Mus musculus GN=Pc PE=1 SV=1 7 496 2.0E-105
sp|P32528|DUR1_YEAST Urea amidolyase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DUR1,2 PE=1 SV=2 26 476 3.0E-105
sp|Q29RK2|PYC_BOVIN Pyruvate carboxylase, mitochondrial OS=Bos taurus GN=PC PE=2 SV=2 7 496 1.0E-104
sp|P11498|PYC_HUMAN Pyruvate carboxylase, mitochondrial OS=Homo sapiens GN=PC PE=1 SV=2 1 496 4.0E-104
sp|P46392|BCCA_MYCLE Acetyl-/propionyl-coenzyme A carboxylase alpha chain OS=Mycobacterium leprae (strain TN) GN=bccA PE=3 SV=2 18 475 7.0E-102
sp|Q0CLK1|PYC_ASPTN Pyruvate carboxylase OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=pyc PE=3 SV=2 16 479 1.0E-98
sp|O93918|PYC_ASPTE Pyruvate carboxylase OS=Aspergillus terreus GN=pyc PE=2 SV=1 16 479 1.0E-98
sp|Q9HES8|PYC_ASPNG Pyruvate carboxylase OS=Aspergillus niger GN=pyc PE=3 SV=1 16 479 2.0E-98
sp|Q9UUE1|PYC_SCHPO Pyruvate carboxylase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pyr1 PE=3 SV=1 11 478 2.0E-98
sp|P38095|LAMA_EMENI Putative urea carboxylase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=lamA PE=2 SV=2 25 479 2.0E-96
sp|P32327|PYC2_YEAST Pyruvate carboxylase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PYC2 PE=1 SV=2 29 478 7.0E-94
sp|Q8X1T3|PYC_PICAN Pyruvate carboxylase OS=Pichia angusta GN=PYC PE=3 SV=1 15 471 8.0E-92
sp|P11154|PYC1_YEAST Pyruvate carboxylase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PYC1 PE=1 SV=2 29 478 3.0E-91
sp|P78992|PYC_PICPA Pyruvate carboxylase OS=Komagataella pastoris GN=PYC1 PE=3 SV=1 13 481 2.0E-86
sp|P11029|ACAC_CHICK Acetyl-CoA carboxylase OS=Gallus gallus GN=ACAC PE=1 SV=1 24 472 6.0E-69
sp|Q00955|ACAC_YEAST Acetyl-CoA carboxylase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ACC1 PE=1 SV=2 26 696 2.0E-68
sp|Q5SWU9|ACACA_MOUSE Acetyl-CoA carboxylase 1 OS=Mus musculus GN=Acaca PE=1 SV=1 24 472 4.0E-68
sp|Q54J08|ACAC_DICDI Acetyl-CoA carboxylase OS=Dictyostelium discoideum GN=accA PE=3 SV=1 24 482 5.0E-68
sp|Q13085|ACACA_HUMAN Acetyl-CoA carboxylase 1 OS=Homo sapiens GN=ACACA PE=1 SV=2 24 472 7.0E-68
sp|Q28559|ACACA_SHEEP Acetyl-CoA carboxylase 1 OS=Ovis aries GN=ACACA PE=2 SV=1 24 472 1.0E-67
sp|Q9TTS3|ACACA_BOVIN Acetyl-CoA carboxylase 1 OS=Bos taurus GN=ACACA PE=2 SV=1 24 472 2.0E-67
sp|Q8S6N5|ACC1_ORYSJ Acetyl-CoA carboxylase 1 OS=Oryza sativa subsp. japonica GN=ACC1 PE=3 SV=1 23 679 4.0E-67
sp|B3LM95|HFA1_YEAS1 Acetyl-CoA carboxylase, mitochondrial OS=Saccharomyces cerevisiae (strain RM11-1a) GN=HFA1 PE=3 SV=2 79 696 3.0E-66
sp|P32874|HFA1_YEAST Acetyl-CoA carboxylase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HFA1 PE=1 SV=2 79 696 9.0E-66
sp|C7GRE4|HFA1_YEAS2 Acetyl-CoA carboxylase, mitochondrial OS=Saccharomyces cerevisiae (strain JAY291) GN=HFA1 PE=3 SV=2 79 696 9.0E-66
sp|C8ZF72|HFA1_YEAS8 Acetyl-CoA carboxylase, mitochondrial OS=Saccharomyces cerevisiae (strain Lalvin EC1118 / Prise de mousse) GN=HFA1 PE=3 SV=2 79 696 2.0E-65
sp|O00763|ACACB_HUMAN Acetyl-CoA carboxylase 2 OS=Homo sapiens GN=ACACB PE=1 SV=3 24 471 3.0E-65
sp|A6ZMR9|HFA1_YEAS7 Acetyl-CoA carboxylase, mitochondrial OS=Saccharomyces cerevisiae (strain YJM789) GN=HFA1 PE=3 SV=2 79 696 4.0E-65
sp|P11497|ACACA_RAT Acetyl-CoA carboxylase 1 OS=Rattus norvegicus GN=Acaca PE=1 SV=1 24 472 6.0E-65
sp|P78820|ACAC_SCHPO Acetyl-CoA carboxylase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cut6 PE=1 SV=2 26 472 5.0E-64
sp|E9Q4Z2|ACACB_MOUSE Acetyl-CoA carboxylase 2 OS=Mus musculus GN=Acacb PE=1 SV=1 24 471 1.0E-63
sp|Q38970|ACC1_ARATH Acetyl-CoA carboxylase 1 OS=Arabidopsis thaliana GN=ACC1 PE=1 SV=1 24 471 1.0E-63
sp|B9FK36|ACC2_ORYSJ Acetyl-CoA carboxylase 2 OS=Oryza sativa subsp. japonica GN=ACC2 PE=3 SV=2 26 471 7.0E-63
sp|F4I1L3|ACC2_ARATH Acetyl-CoA carboxylase 2 OS=Arabidopsis thaliana GN=ACC2 PE=2 SV=1 24 471 3.0E-61
sp|B8D1H3|CARB_HALOH Carbamoyl-phosphate synthase large chain OS=Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562) GN=carB PE=3 SV=1 10 345 3.0E-16
sp|A2BJL3|CARB_HYPBU Carbamoyl-phosphate synthase large chain OS=Hyperthermus butylicus (strain DSM 5456 / JCM 9403 / PLM1-5) GN=carB PE=3 SV=1 75 342 3.0E-13
sp|Q8U085|CARB_PYRFU Carbamoyl-phosphate synthase large chain OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=carB PE=3 SV=1 85 345 5.0E-11
sp|B1I4M8|CARB_DESAP Carbamoyl-phosphate synthase large chain OS=Desulforudis audaxviator (strain MP104C) GN=carB PE=3 SV=1 111 369 8.0E-11
sp|P27708|PYR1_HUMAN CAD protein OS=Homo sapiens GN=CAD PE=1 SV=3 163 346 9.0E-11
sp|Q970U7|CARB_SULTO Carbamoyl-phosphate synthase large chain OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=carB PE=3 SV=1 120 345 5.0E-10
sp|Q91437|PYR1_SQUAC CAD protein OS=Squalus acanthias GN=CAD PE=2 SV=1 124 347 7.0E-10
sp|Q4J8E8|CARB_SULAC Carbamoyl-phosphate synthase large chain OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=carB PE=3 SV=1 120 345 7.0E-10
sp|A5GPT7|PURT_SYNPW Phosphoribosylglycinamide formyltransferase 2 OS=Synechococcus sp. (strain WH7803) GN=purT PE=3 SV=1 29 346 1.0E-09
sp|B2RQC6|PYR1_MOUSE CAD protein OS=Mus musculus GN=Cad PE=1 SV=1 163 346 1.0E-09
sp|O67869|CARB1_AQUAE Carbamoyl-phosphate synthase large chain, N-terminal section OS=Aquifex aeolicus (strain VF5) GN=carB1 PE=3 SV=1 82 345 1.0E-09
sp|P08955|PYR1_MESAU CAD protein OS=Mesocricetus auratus GN=CAD PE=1 SV=4 163 346 1.0E-09
sp|Q3AG69|PURT_SYNSC Phosphoribosylglycinamide formyltransferase 2 OS=Synechococcus sp. (strain CC9605) GN=purT PE=3 SV=1 28 346 2.0E-09
sp|C3MW21|CARB_SULIM Carbamoyl-phosphate synthase large chain OS=Sulfolobus islandicus (strain M.14.25 / Kamchatka #1) GN=carB PE=3 SV=1 120 345 5.0E-09
sp|C3N664|CARB_SULIA Carbamoyl-phosphate synthase large chain OS=Sulfolobus islandicus (strain M.16.27) GN=carB PE=3 SV=1 120 345 5.0E-09
sp|C4KHM7|CARB_SULIK Carbamoyl-phosphate synthase large chain OS=Sulfolobus islandicus (strain M.16.4 / Kamchatka #3) GN=carB PE=3 SV=1 120 345 5.0E-09
sp|C3NEM0|CARB_SULIY Carbamoyl-phosphate synthase large chain OS=Sulfolobus islandicus (strain Y.G.57.14 / Yellowstone #1) GN=carB PE=3 SV=1 120 345 5.0E-09
sp|C3MQE3|CARB_SULIL Carbamoyl-phosphate synthase large chain OS=Sulfolobus islandicus (strain L.S.2.15 / Lassen #1) GN=carB PE=3 SV=1 120 345 5.0E-09
sp|C3NH23|CARB_SULIN Carbamoyl-phosphate synthase large chain OS=Sulfolobus islandicus (strain Y.N.15.51 / Yellowstone #2) GN=carB PE=3 SV=1 120 345 5.0E-09
sp|Q1WVA9|CARB_LACS1 Carbamoyl-phosphate synthase large chain OS=Lactobacillus salivarius (strain UCC118) GN=carB PE=3 SV=1 117 351 7.0E-09
sp|A8F453|CARB_PSELT Carbamoyl-phosphate synthase large chain OS=Pseudothermotoga lettingae (strain ATCC BAA-301 / DSM 14385 / NBRC 107922 / TMO) GN=carB PE=3 SV=1 133 361 1.0E-08
sp|Q59969|CARB_SULSO Carbamoyl-phosphate synthase large chain OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=carB PE=3 SV=1 137 345 1.0E-08
sp|Q05920|PYC_MOUSE Pyruvate carboxylase, mitochondrial OS=Mus musculus GN=Pc PE=1 SV=1 626 698 2.0E-08
sp|Q0SPY4|CARB_CLOPS Carbamoyl-phosphate synthase large chain OS=Clostridium perfringens (strain SM101 / Type A) GN=carB PE=3 SV=1 111 345 2.0E-08
sp|Q8XHB3|CARB_CLOPE Carbamoyl-phosphate synthase large chain OS=Clostridium perfringens (strain 13 / Type A) GN=carB PE=3 SV=1 111 345 2.0E-08
sp|Q9ZB63|CARY_GEOSE Carbamoyl-phosphate synthase arginine-specific large chain OS=Geobacillus stearothermophilus GN=carB PE=1 SV=1 169 345 2.0E-08
sp|C6DEU1|DDL_PECCP D-alanine--D-alanine ligase OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=ddl PE=3 SV=1 120 315 3.0E-08
sp|Q04H29|CARB_OENOB Carbamoyl-phosphate synthase large chain OS=Oenococcus oeni (strain ATCC BAA-331 / PSU-1) GN=carB PE=3 SV=1 111 349 3.0E-08
sp|O28994|CARB_ARCFU Carbamoyl-phosphate synthase large chain OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=carB PE=3 SV=1 111 422 3.0E-08
sp|Q0TM79|CARB_CLOP1 Carbamoyl-phosphate synthase large chain OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) GN=carB PE=3 SV=1 111 345 3.0E-08
sp|P18185|CARY_BACSU Carbamoyl-phosphate synthase arginine-specific large chain OS=Bacillus subtilis (strain 168) GN=carB PE=3 SV=4 117 345 3.0E-08
sp|O17732|PYC1_CAEEL Pyruvate carboxylase 1 OS=Caenorhabditis elegans GN=pyc-1 PE=1 SV=1 626 697 5.0E-08
sp|Q9ZAA7|GCDC_ACIFV Glutaconyl-CoA decarboxylase subunit gamma OS=Acidaminococcus fermentans (strain ATCC 25085 / DSM 20731 / VR4) GN=gcdC PE=1 SV=1 631 699 5.0E-08
sp|A6LPD9|CARB_CLOB8 Carbamoyl-phosphate synthase large chain OS=Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052) GN=carB PE=3 SV=1 111 345 8.0E-08
sp|P31327|CPSM_HUMAN Carbamoyl-phosphate synthase [ammonia], mitochondrial OS=Homo sapiens GN=CPS1 PE=1 SV=2 96 346 1.0E-07
sp|Q7U3B3|PURT_SYNPX Phosphoribosylglycinamide formyltransferase 2 OS=Synechococcus sp. (strain WH8102) GN=purT PE=3 SV=1 27 346 1.0E-07
sp|Q29RK2|PYC_BOVIN Pyruvate carboxylase, mitochondrial OS=Bos taurus GN=PC PE=2 SV=2 626 698 2.0E-07
sp|B5YFT1|DDL_THEYD D-alanine--D-alanine ligase OS=Thermodesulfovibrio yellowstonii (strain ATCC 51303 / DSM 11347 / YP87) GN=ddl PE=3 SV=1 98 315 2.0E-07
sp|Q6HES8|CARB_BACHK Carbamoyl-phosphate synthase large chain OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=carB PE=3 SV=1 117 349 2.0E-07
sp|C1EPQ0|CARB_BACC3 Carbamoyl-phosphate synthase large chain OS=Bacillus cereus (strain 03BB102) GN=carB PE=3 SV=1 117 349 2.0E-07
sp|A0RHQ8|CARB_BACAH Carbamoyl-phosphate synthase large chain OS=Bacillus thuringiensis (strain Al Hakam) GN=carB PE=3 SV=1 117 349 2.0E-07
sp|B7JJX3|CARB_BACC0 Carbamoyl-phosphate synthase large chain OS=Bacillus cereus (strain AH820) GN=carB PE=3 SV=1 117 349 2.0E-07
sp|P52873|PYC_RAT Pyruvate carboxylase, mitochondrial OS=Rattus norvegicus GN=Pc PE=1 SV=2 626 698 3.0E-07
sp|Q81WF2|CARB_BACAN Carbamoyl-phosphate synthase large chain OS=Bacillus anthracis GN=carB PE=3 SV=1 117 349 3.0E-07
sp|C3L740|CARB_BACAC Carbamoyl-phosphate synthase large chain OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=carB PE=3 SV=1 117 349 3.0E-07
sp|C3P656|CARB_BACAA Carbamoyl-phosphate synthase large chain OS=Bacillus anthracis (strain A0248) GN=carB PE=3 SV=1 117 349 3.0E-07
sp|Q38X24|CARB_LACSS Carbamoyl-phosphate synthase large chain OS=Lactobacillus sakei subsp. sakei (strain 23K) GN=carB PE=3 SV=1 120 349 3.0E-07
sp|B2A170|CARB_NATTJ Carbamoyl-phosphate synthase large chain OS=Natranaerobius thermophilus (strain ATCC BAA-1301 / DSM 18059 / JW/NM-WN-LF) GN=carB PE=3 SV=1 163 345 3.0E-07
sp|Q636E0|CARB_BACCZ Carbamoyl-phosphate synthase large chain OS=Bacillus cereus (strain ZK / E33L) GN=carB PE=3 SV=1 117 349 3.0E-07
sp|Q8C196|CPSM_MOUSE Carbamoyl-phosphate synthase [ammonia], mitochondrial OS=Mus musculus GN=Cps1 PE=1 SV=2 96 346 3.0E-07
sp|B9IVW3|CARB_BACCQ Carbamoyl-phosphate synthase large chain OS=Bacillus cereus (strain Q1) GN=carB PE=3 SV=1 117 349 3.0E-07
sp|B7HLM0|CARB_BACC7 Carbamoyl-phosphate synthase large chain OS=Bacillus cereus (strain AH187) GN=carB PE=3 SV=1 117 349 3.0E-07
sp|B2UX86|CARB_CLOBA Carbamoyl-phosphate synthase large chain OS=Clostridium botulinum (strain Alaska E43 / Type E3) GN=carB PE=3 SV=1 111 345 3.0E-07
sp|P07756|CPSM_RAT Carbamoyl-phosphate synthase [ammonia], mitochondrial OS=Rattus norvegicus GN=Cps1 PE=1 SV=1 96 346 3.0E-07
sp|B3WEF5|CARB_LACCB Carbamoyl-phosphate synthase large chain OS=Lactobacillus casei (strain BL23) GN=carB PE=3 SV=1 120 351 3.0E-07
sp|P11498|PYC_HUMAN Pyruvate carboxylase, mitochondrial OS=Homo sapiens GN=PC PE=1 SV=2 626 698 4.0E-07
sp|Q1WVA9|CARB_LACS1 Carbamoyl-phosphate synthase large chain OS=Lactobacillus salivarius (strain UCC118) GN=carB PE=3 SV=1 162 345 4.0E-07
sp|Q038Z2|CARB_LACC3 Carbamoyl-phosphate synthase large chain OS=Lactobacillus casei (strain ATCC 334) GN=carB PE=3 SV=1 120 351 4.0E-07
sp|P20054|PYR1_DICDI Protein PYR1-3 OS=Dictyostelium discoideum GN=pyr1-3 PE=1 SV=3 166 339 4.0E-07
sp|B9KXM5|CARB_THERP Carbamoyl-phosphate synthase large chain OS=Thermomicrobium roseum (strain ATCC 27502 / DSM 5159 / P-2) GN=carB PE=3 SV=1 120 345 4.0E-07
sp|P05990|PYR1_DROME CAD protein OS=Drosophila melanogaster GN=r PE=1 SV=3 169 346 5.0E-07
sp|Q2YXG5|CARB_STAAB Carbamoyl-phosphate synthase large chain OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=carB PE=3 SV=1 117 349 5.0E-07
sp|Q819S3|CARB_BACCR Carbamoyl-phosphate synthase large chain OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=carB PE=3 SV=1 120 349 5.0E-07
sp|B7H6M2|CARB_BACC4 Carbamoyl-phosphate synthase large chain OS=Bacillus cereus (strain B4264) GN=carB PE=3 SV=1 120 349 6.0E-07
sp|P58940|CARB_STAAW Carbamoyl-phosphate synthase large chain OS=Staphylococcus aureus (strain MW2) GN=carB PE=3 SV=1 117 349 6.0E-07
sp|P63740|CARB_STAAN Carbamoyl-phosphate synthase large chain OS=Staphylococcus aureus (strain N315) GN=carB PE=1 SV=1 117 349 7.0E-07
sp|P63739|CARB_STAAM Carbamoyl-phosphate synthase large chain OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=carB PE=3 SV=1 117 349 7.0E-07
sp|A5IS88|CARB_STAA9 Carbamoyl-phosphate synthase large chain OS=Staphylococcus aureus (strain JH9) GN=carB PE=3 SV=1 117 349 7.0E-07
sp|A6U122|CARB_STAA2 Carbamoyl-phosphate synthase large chain OS=Staphylococcus aureus (strain JH1) GN=carB PE=3 SV=1 117 349 7.0E-07
sp|A7X1F4|CARB_STAA1 Carbamoyl-phosphate synthase large chain OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=carB PE=3 SV=1 117 349 7.0E-07
sp|A8Z3P0|CARB_STAAT Carbamoyl-phosphate synthase large chain OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=carB PE=3 SV=1 117 349 7.0E-07
sp|Q6GA10|CARB_STAAS Carbamoyl-phosphate synthase large chain OS=Staphylococcus aureus (strain MSSA476) GN=carB PE=3 SV=1 117 349 7.0E-07
sp|A6QGA4|CARB_STAAE Carbamoyl-phosphate synthase large chain OS=Staphylococcus aureus (strain Newman) GN=carB PE=3 SV=1 117 349 7.0E-07
sp|Q5HGM9|CARB_STAAC Carbamoyl-phosphate synthase large chain OS=Staphylococcus aureus (strain COL) GN=carB PE=3 SV=1 117 349 7.0E-07
sp|Q2FZ72|CARB_STAA8 Carbamoyl-phosphate synthase large chain OS=Staphylococcus aureus (strain NCTC 8325) GN=carB PE=3 SV=1 117 349 7.0E-07
sp|Q2FHN5|CARB_STAA3 Carbamoyl-phosphate synthase large chain OS=Staphylococcus aureus (strain USA300) GN=carB PE=3 SV=1 117 349 7.0E-07
sp|Q6GHN2|CARB_STAAR Carbamoyl-phosphate synthase large chain OS=Staphylococcus aureus (strain MRSA252) GN=carB PE=3 SV=1 117 349 7.0E-07
sp|Q75D66|CARB_ASHGO Carbamoyl-phosphate synthase arginine-specific large chain OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=CPA2 PE=3 SV=2 111 346 7.0E-07
sp|Q7U054|CARB_MYCBO Carbamoyl-phosphate synthase large chain OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=carB PE=3 SV=1 112 342 8.0E-07
sp|Q9UUE1|PYC_SCHPO Pyruvate carboxylase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pyr1 PE=3 SV=1 634 702 1.0E-06
sp|B9DPN2|CARB_STACT Carbamoyl-phosphate synthase large chain OS=Staphylococcus carnosus (strain TM300) GN=carB PE=3 SV=1 117 349 1.0E-06
sp|Q58628|PYCB_METJA Pyruvate carboxylase subunit B OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=pycB PE=1 SV=1 564 700 1.0E-06
sp|Q9CCR2|CARB_MYCLE Carbamoyl-phosphate synthase large chain OS=Mycobacterium leprae (strain TN) GN=carB PE=3 SV=2 112 345 1.0E-06
sp|Q898Z5|DDLB_CLOTE D-alanine--D-alanine ligase B OS=Clostridium tetani (strain Massachusetts / E88) GN=ddlB PE=3 SV=1 98 315 1.0E-06
sp|Q7M8I0|PURT_WOLSU Phosphoribosylglycinamide formyltransferase 2 OS=Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / LMG 7466 / NCTC 11488 / FDC 602W) GN=purT PE=3 SV=1 163 373 1.0E-06
sp|P20054|PYR1_DICDI Protein PYR1-3 OS=Dictyostelium discoideum GN=pyr1-3 PE=1 SV=3 169 345 2.0E-06
sp|Q732I3|CARB_BACC1 Carbamoyl-phosphate synthase large chain OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=carB PE=3 SV=1 117 349 2.0E-06
sp|C4ZEK2|CARB_EUBR3 Carbamoyl-phosphate synthase large chain OS=Eubacterium rectale (strain ATCC 33656 / VPI 0990) GN=carB PE=3 SV=1 120 345 2.0E-06
sp|Q2FLD9|CARB_METHJ Carbamoyl-phosphate synthase large chain OS=Methanospirillum hungatei JF-1 (strain ATCC 27890 / DSM 864 / NBRC 100397 / JF-1) GN=carB PE=3 SV=1 126 345 2.0E-06
sp|A6LPD9|CARB_CLOB8 Carbamoyl-phosphate synthase large chain OS=Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052) GN=carB PE=3 SV=1 111 342 3.0E-06
sp|B2GD06|CARB_LACF3 Carbamoyl-phosphate synthase large chain OS=Lactobacillus fermentum (strain NBRC 3956 / LMG 18251) GN=carB PE=3 SV=1 120 349 3.0E-06
sp|A9VTC6|CARB_BACWK Carbamoyl-phosphate synthase large chain OS=Bacillus weihenstephanensis (strain KBAB4) GN=carB PE=3 SV=1 117 349 3.0E-06
sp|A5GX22|PURT_SYNR3 Phosphoribosylglycinamide formyltransferase 2 OS=Synechococcus sp. (strain RCC307) GN=purT PE=3 SV=1 117 346 3.0E-06
sp|P46537|CARB_BACCL Carbamoyl-phosphate synthase pyrimidine-specific large chain OS=Bacillus caldolyticus GN=pyrAB PE=3 SV=1 117 349 3.0E-06
sp|P18185|CARY_BACSU Carbamoyl-phosphate synthase arginine-specific large chain OS=Bacillus subtilis (strain 168) GN=carB PE=3 SV=4 169 345 4.0E-06
sp|Q8Y665|CARB_LISMO Carbamoyl-phosphate synthase large chain OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=carB PE=3 SV=1 163 351 4.0E-06
sp|P9WPK3|CARB_MYCTU Carbamoyl-phosphate synthase large chain OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=carB PE=1 SV=1 112 342 4.0E-06
sp|P9WPK2|CARB_MYCTO Carbamoyl-phosphate synthase large chain OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=carB PE=3 SV=1 112 342 4.0E-06
sp|C0H419|BLAP_BACSU Biotin/lipoyl attachment protein OS=Bacillus subtilis (strain 168) GN=yngHB PE=1 SV=1 633 697 4.0E-06
sp|A0AJU0|CARB_LISW6 Carbamoyl-phosphate synthase large chain OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=carB PE=3 SV=1 163 351 4.0E-06
sp|O94313|CARB_SCHPO Carbamoyl-phosphate synthase arginine-specific large chain OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=arg4 PE=3 SV=1 124 346 4.0E-06
sp|P25994|CARB_BACSU Carbamoyl-phosphate synthase pyrimidine-specific large chain OS=Bacillus subtilis (strain 168) GN=pyrAB PE=3 SV=1 120 349 4.0E-06
sp|B2UX86|CARB_CLOBA Carbamoyl-phosphate synthase large chain OS=Clostridium botulinum (strain Alaska E43 / Type E3) GN=carB PE=3 SV=1 169 342 5.0E-06
sp|Q4L5Q5|CARB_STAHJ Carbamoyl-phosphate synthase large chain OS=Staphylococcus haemolyticus (strain JCSC1435) GN=carB PE=3 SV=1 116 349 5.0E-06
sp|A7GRL1|CARB_BACCN Carbamoyl-phosphate synthase large chain OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=carB PE=3 SV=1 117 349 5.0E-06
sp|O50302|CARB_GEOSE Carbamoyl-phosphate synthase pyrimidine-specific large chain OS=Geobacillus stearothermophilus GN=pyrAB PE=3 SV=1 117 349 5.0E-06
sp|B8DDR7|CARB_LISMH Carbamoyl-phosphate synthase large chain OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=carB PE=3 SV=1 163 351 5.0E-06
sp|B7IUP6|CARB_BACC2 Carbamoyl-phosphate synthase large chain OS=Bacillus cereus (strain G9842) GN=carB PE=3 SV=1 117 349 5.0E-06
sp|C1KWD4|CARB_LISMC Carbamoyl-phosphate synthase large chain OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=carB PE=3 SV=1 163 351 5.0E-06
sp|Q8CPJ4|CARB_STAES Carbamoyl-phosphate synthase large chain OS=Staphylococcus epidermidis (strain ATCC 12228) GN=carB PE=3 SV=1 116 349 5.0E-06
sp|Q92AH3|CARB_LISIN Carbamoyl-phosphate synthase large chain OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=carB PE=3 SV=1 163 351 5.0E-06
sp|Q0VS00|DDL_ALCBS D-alanine--D-alanine ligase OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=ddl PE=3 SV=1 40 315 6.0E-06
sp|Q6F705|DDL_ACIAD D-alanine--D-alanine ligase OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=ddl PE=3 SV=1 108 315 6.0E-06
sp|Q71YI1|CARB_LISMF Carbamoyl-phosphate synthase large chain OS=Listeria monocytogenes serotype 4b (strain F2365) GN=carB PE=3 SV=1 163 351 6.0E-06
sp|Q5HPY8|CARB_STAEQ Carbamoyl-phosphate synthase large chain OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=carB PE=3 SV=1 116 349 6.0E-06
sp|Q9KF52|PUR2_BACHD Phosphoribosylamine--glycine ligase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=purD PE=3 SV=1 83 245 6.0E-06
sp|B8GEA3|CARB_METPE Carbamoyl-phosphate synthase large chain OS=Methanosphaerula palustris (strain ATCC BAA-1556 / DSM 19958 / E1-9c) GN=carB PE=3 SV=1 123 345 6.0E-06
sp|P02904|BCCP_PROFR Methylmalonyl-CoA carboxyltransferase 1.3S subunit OS=Propionibacterium freudenreichii subsp. shermanii PE=1 SV=1 634 697 6.0E-06
sp|Q9LCT6|DDLB_PSEAE D-alanine--D-alanine ligase B OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=ddlB PE=3 SV=1 108 341 7.0E-06
sp|B2THH3|CARB_CLOBB Carbamoyl-phosphate synthase large chain OS=Clostridium botulinum (strain Eklund 17B / Type B) GN=carB PE=3 SV=1 111 345 7.0E-06
sp|B0K4D7|CARB_THEPX Carbamoyl-phosphate synthase large chain OS=Thermoanaerobacter sp. (strain X514) GN=carB PE=3 SV=1 162 351 7.0E-06
sp|Q49WY4|CARB_STAS1 Carbamoyl-phosphate synthase large chain OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=carB PE=3 SV=1 163 349 9.0E-06
sp|Q0I600|PURT_SYNS3 Phosphoribosylglycinamide formyltransferase 2 OS=Synechococcus sp. (strain CC9311) GN=purT PE=3 SV=2 27 346 9.0E-06
sp|A5D508|CARB_PELTS Carbamoyl-phosphate synthase large chain OS=Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI) GN=carB PE=3 SV=1 120 345 9.0E-06
sp|C4L5W3|CARB_EXISA Carbamoyl-phosphate synthase large chain OS=Exiguobacterium sp. (strain ATCC BAA-1283 / AT1b) GN=carB PE=3 SV=1 118 345 9.0E-06
sp|O27179|PYCB_METTH Pyruvate carboxylase subunit B OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=pycB PE=1 SV=1 603 700 1.0E-05
sp|A5IJL8|CARB_THEP1 Carbamoyl-phosphate synthase large chain OS=Thermotoga petrophila (strain RKU-1 / ATCC BAA-488 / DSM 13995) GN=carB PE=3 SV=1 169 342 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0005524 ATP binding Yes
GO:0008716 D-alanine-D-alanine ligase activity Yes
GO:0030554 adenyl nucleotide binding No
GO:0032555 purine ribonucleotide binding No
GO:0032553 ribonucleotide binding No
GO:0036094 small molecule binding No
GO:0003824 catalytic activity No
GO:0097367 carbohydrate derivative binding No
GO:0097159 organic cyclic compound binding No
GO:0016881 acid-amino acid ligase activity No
GO:0032559 adenyl ribonucleotide binding No
GO:1901363 heterocyclic compound binding No
GO:0017076 purine nucleotide binding No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0016879 ligase activity, forming carbon-nitrogen bonds No
GO:0043167 ion binding No
GO:0003674 molecular_function No
GO:1901265 nucleoside phosphate binding No
GO:0043168 anion binding No
GO:0005488 binding No
GO:0016874 ligase activity No
GO:0000166 nucleotide binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 14 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|1756
MRSVRTRGLCSPWALRRLSSTSCRALESVLIANRGEIALRINRTAERMGIRATTVYTDVDADAWHASAGFRSLGL
GPANGYLDGDKMISLAKRHGIQALHPGYGFLSENAQFARRCEDEGIVFVGPPASAMADMGDKARSKEIMTAANVP
CVPGYHGSEQGEDQLRGHAEAMGFPVLLKSVRGGGGKGMRIVDNTQEFATQLKSARAEARASFGEGGEVMLVEKY
IVRPRHVEVQIFADRHGNTVALGERDCSIQRRHQKMLEESPAPDLDDATRQDLWEKARKAASAVGYVGAGTVEFI
LDKDSGRFYFMEMNTRLQVEHPVTEMVTGLDLVEWQFRIAAGEPLPLDQAQVEARMQTRGSAIEARVYAEDPDRG
FMPDSGKLVRAELTGTDDDVRLDWGFGTGSVVSEAYDGMIAKLIVRGDSRRQAVAKLEAALQRFEIVGVSTNVEF
LKRVCQSPAFIEGDVETGFVDKWREQLFAKLPVPAEVYAQAALGLLERERLRQGRVASPNGESLGFGDEAERTVT
LRVVGREDGEEEAQVGITQTGRGRFDVSVKGKDEPTLFKDVLSSSTLTTVQSRFPSEKITSTVVLRDSELGSEQT
RLTVFQHGVKWELQLVPPKWFEDALGLKEVTASVAAPMPCKVLKLEVAEGDTVQKGDPLVVIESMKMETLIKAPR
KSVVKRLPHKEGDICKAGTILVFFEEEEA*
Coding >Ophun1|1756
ATGCGTTCTGTCCGGACCCGTGGCCTTTGCTCGCCCTGGGCGCTGCGTCGCCTCAGCTCAACCAGCTGCCGGGCG
CTCGAGTCGGTTCTCATCGCCAACCGAGGCGAGATTGCCTTACGAATCAACCGCACGGCTGAGCGCATGGGAATC
CGGGCAACGACCGTCTACACAGACGTCGACGCCGACGCATGGCACGCCTCGGCCGGCTTCCGATCTCTGGGCCTC
GGGCCGGCCAATGGATACCTCGACGGCGACAAGATGATATCGCTGGCCAAGAGACACGGCATCCAGGCGCTTCAT
CCGGGATATGGCTTCCTTTCCGAGAATGCCCAGTTTGCGCGTCGCTGCGAGGACGAGGGTATCGTCTTTGTCGGC
CCGCCAGCGTCTGCCATGGCCGATATGGGCGACAAGGCGCGGAGCAAGGAGATAATGACGGCCGCCAACGTTCCG
TGCGTACCGGGATACCACGGCTCCGAGCAAGGGGAGGATCAGCTGCGAGGTCATGCCGAGGCCATGGGCTTTCCC
GTGCTGCTCAAGAGCGTTCGCGGAGGCGGTGGCAAGGGCATGCGCATTGTGGATAATACCCAAGAGTTTGCGACG
CAGCTGAAGAGTGCGCGGGCTGAAGCAAGGGCTTCGTTCGGTGAGGGCGGCGAGGTGATGCTGGTGGAAAAGTAC
ATTGTTCGGCCGCGGCATGTTGAGGTGCAAATCTTTGCTGACCGTCACGGCAATACGGTGGCCCTGGGCGAACGA
GACTGCAGCATCCAGCGACGGCATCAGAAGATGCTGGAAGAGTCTCCGGCCCCGGATCTTGACGACGCAACTCGG
CAGGATTTGTGGGAAAAGGCCCGGAAGGCGGCTTCGGCAGTGGGTTACGTCGGCGCCGGTACCGTCGAGTTTATC
CTCGACAAGGACAGCGGACGCTTCTACTTTATGGAGATGAATACTCGGCTGCAGGTCGAGCATCCGGTCACGGAA
ATGGTGACGGGTCTGGATCTGGTGGAATGGCAGTTTCGCATCGCTGCCGGCGAGCCTCTTCCTCTGGATCAGGCA
CAAGTCGAAGCCCGGATGCAGACCCGCGGCTCGGCTATTGAAGCCCGCGTCTACGCCGAGGATCCGGACCGGGGC
TTCATGCCGGACTCGGGCAAGTTGGTGCGAGCCGAACTGACGGGGACCGACGATGACGTCCGTCTGGACTGGGGT
TTCGGAACGGGAAGCGTCGTGTCTGAAGCTTACGACGGCATGATTGCCAAACTCATCGTCCGAGGCGACTCGCGA
CGCCAGGCCGTGGCCAAATTGGAGGCGGCACTGCAAAGATTCGAGATTGTGGGCGTCAGCACAAACGTCGAGTTT
CTCAAACGCGTCTGCCAATCGCCAGCCTTTATAGAAGGCGATGTCGAGACGGGCTTTGTCGACAAGTGGCGCGAA
CAACTCTTTGCCAAGCTCCCCGTTCCCGCCGAGGTGTACGCCCAGGCTGCCCTCGGCTTATTGGAACGCGAGCGG
CTACGTCAAGGGAGGGTTGCGTCGCCCAACGGGGAGAGTCTTGGCTTTGGTGACGAGGCTGAGCGGACTGTAACG
CTGCGAGTCGTCGGTCGGGAAGACGGAGAGGAGGAAGCGCAGGTGGGCATCACGCAGACAGGTCGAGGCCGCTTC
GATGTCTCCGTCAAAGGAAAGGATGAGCCGACTCTCTTTAAAGACGTGCTCAGCTCATCGACGCTCACCACGGTC
CAATCTCGTTTCCCCTCTGAGAAGATCACCTCGACTGTCGTGTTGCGTGACTCCGAGTTGGGCTCTGAGCAGACG
AGACTAACTGTCTTTCAACATGGCGTCAAATGGGAGCTCCAGCTTGTGCCTCCCAAGTGGTTTGAAGACGCCCTC
GGTCTCAAAGAGGTGACTGCCTCTGTTGCGGCGCCGATGCCGTGCAAGGTGTTGAAGCTTGAGGTTGCCGAAGGG
GACACGGTGCAGAAGGGGGATCCTCTGGTCGTCATCGAAAGCATGAAGATGGAGACGCTGATCAAGGCTCCGAGG
AAGTCTGTCGTAAAACGACTCCCGCACAAGGAGGGGGACATCTGCAAGGCCGGAACCATACTCGTCTTTTTCGAG
GAGGAAGAGGCCTAG
Transcript >Ophun1|1756
ATGCGTTCTGTCCGGACCCGTGGCCTTTGCTCGCCCTGGGCGCTGCGTCGCCTCAGCTCAACCAGCTGCCGGGCG
CTCGAGTCGGTTCTCATCGCCAACCGAGGCGAGATTGCCTTACGAATCAACCGCACGGCTGAGCGCATGGGAATC
CGGGCAACGACCGTCTACACAGACGTCGACGCCGACGCATGGCACGCCTCGGCCGGCTTCCGATCTCTGGGCCTC
GGGCCGGCCAATGGATACCTCGACGGCGACAAGATGATATCGCTGGCCAAGAGACACGGCATCCAGGCGCTTCAT
CCGGGATATGGCTTCCTTTCCGAGAATGCCCAGTTTGCGCGTCGCTGCGAGGACGAGGGTATCGTCTTTGTCGGC
CCGCCAGCGTCTGCCATGGCCGATATGGGCGACAAGGCGCGGAGCAAGGAGATAATGACGGCCGCCAACGTTCCG
TGCGTACCGGGATACCACGGCTCCGAGCAAGGGGAGGATCAGCTGCGAGGTCATGCCGAGGCCATGGGCTTTCCC
GTGCTGCTCAAGAGCGTTCGCGGAGGCGGTGGCAAGGGCATGCGCATTGTGGATAATACCCAAGAGTTTGCGACG
CAGCTGAAGAGTGCGCGGGCTGAAGCAAGGGCTTCGTTCGGTGAGGGCGGCGAGGTGATGCTGGTGGAAAAGTAC
ATTGTTCGGCCGCGGCATGTTGAGGTGCAAATCTTTGCTGACCGTCACGGCAATACGGTGGCCCTGGGCGAACGA
GACTGCAGCATCCAGCGACGGCATCAGAAGATGCTGGAAGAGTCTCCGGCCCCGGATCTTGACGACGCAACTCGG
CAGGATTTGTGGGAAAAGGCCCGGAAGGCGGCTTCGGCAGTGGGTTACGTCGGCGCCGGTACCGTCGAGTTTATC
CTCGACAAGGACAGCGGACGCTTCTACTTTATGGAGATGAATACTCGGCTGCAGGTCGAGCATCCGGTCACGGAA
ATGGTGACGGGTCTGGATCTGGTGGAATGGCAGTTTCGCATCGCTGCCGGCGAGCCTCTTCCTCTGGATCAGGCA
CAAGTCGAAGCCCGGATGCAGACCCGCGGCTCGGCTATTGAAGCCCGCGTCTACGCCGAGGATCCGGACCGGGGC
TTCATGCCGGACTCGGGCAAGTTGGTGCGAGCCGAACTGACGGGGACCGACGATGACGTCCGTCTGGACTGGGGT
TTCGGAACGGGAAGCGTCGTGTCTGAAGCTTACGACGGCATGATTGCCAAACTCATCGTCCGAGGCGACTCGCGA
CGCCAGGCCGTGGCCAAATTGGAGGCGGCACTGCAAAGATTCGAGATTGTGGGCGTCAGCACAAACGTCGAGTTT
CTCAAACGCGTCTGCCAATCGCCAGCCTTTATAGAAGGCGATGTCGAGACGGGCTTTGTCGACAAGTGGCGCGAA
CAACTCTTTGCCAAGCTCCCCGTTCCCGCCGAGGTGTACGCCCAGGCTGCCCTCGGCTTATTGGAACGCGAGCGG
CTACGTCAAGGGAGGGTTGCGTCGCCCAACGGGGAGAGTCTTGGCTTTGGTGACGAGGCTGAGCGGACTGTAACG
CTGCGAGTCGTCGGTCGGGAAGACGGAGAGGAGGAAGCGCAGGTGGGCATCACGCAGACAGGTCGAGGCCGCTTC
GATGTCTCCGTCAAAGGAAAGGATGAGCCGACTCTCTTTAAAGACGTGCTCAGCTCATCGACGCTCACCACGGTC
CAATCTCGTTTCCCCTCTGAGAAGATCACCTCGACTGTCGTGTTGCGTGACTCCGAGTTGGGCTCTGAGCAGACG
AGACTAACTGTCTTTCAACATGGCGTCAAATGGGAGCTCCAGCTTGTGCCTCCCAAGTGGTTTGAAGACGCCCTC
GGTCTCAAAGAGGTGACTGCCTCTGTTGCGGCGCCGATGCCGTGCAAGGTGTTGAAGCTTGAGGTTGCCGAAGGG
GACACGGTGCAGAAGGGGGATCCTCTGGTCGTCATCGAAAGCATGAAGATGGAGACGCTGATCAAGGCTCCGAGG
AAGTCTGTCGTAAAACGACTCCCGCACAAGGAGGGGGACATCTGCAAGGCCGGAACCATACTCGTCTTTTTCGAG
GAGGAAGAGGCCTAG
Gene >Ophun1|1756
ATGCGTTCTGTCCGGACCCGTGGCCTTTGCTCGCCCTGGGCGCTGCGTCGCCTCAGCTCAACCAGCTGCCGGGCG
CTCGAGTCGGTTCTCATCGCCAACCGAGGCGAGATTGCCTTACGAATCAACCGCACGGCTGAGCGCATGGGAATC
CGGGCAACGACCGTCTACACAGACGTCGACGCCGACGCATGGCACGCCTCGGCCGGCTTCCGATCTCTGGGCCTC
GGGCCGGCCAATGGATACCTCGACGGCGACAAGATGATATCGCTGGCCAAGAGACACGGCATCCAGGCGCTTCAT
CCGGGATATGGCTTCCTTTCCGAGAATGCCCAGTTTGCGCGTCGCTGCGAGGACGAGGGTATCGTCTTTGTCGGC
CCGCCAGCGTCTGCCATGGCCGATATGGGCGACAAGGCGCGGAGCAAGGAGATAATGACGGCCGCCAACGTTCCG
TGCGTACCGGGATACCACGGCTCCGAGCAAGGGGAGGATCAGCTGCGAGGTCATGCCGAGGCCATGGGCTTTCCC
GTGCTGCTCAAGAGCGTTCGCGGAGGCGGTGGCAAGGGCATGCGCATTGTGGATAATACCCAAGAGTTTGCGACG
CAGCTGAAGAGTGCGCGGGCTGAAGCAAGGGCTTCGTTCGGTGAGGGCGGCGAGGTGATGCTGGTGGAAAAGTAC
ATTGTTCGGCCGCGGCATGTTGAGGTGCAAATCTTTGCTGACCGTCACGGCAATACGGTGGCCCTGGGCGAACGA
GACTGCAGCATCCAGCGACGGCATCAGAAGATGCTGGAAGAGTCTCCGGCCCCGGATCTTGACGACGCAACTCGG
CAGGATTTGTGGGAAAAGGCCCGGAAGGCGGCTTCGGCAGTGGGTTACGTCGGCGCCGGTACCGTCGAGTTTATC
CTCGACAAGGACAGCGGACGCTTCTACTTTATGGAGATGAATACTCGGCTGCAGGTCGAGCATCCGGTCACGGAA
ATGGTGACGGGTCTGGATCTGGTGGAATGGCAGTTTCGCATCGCTGCCGGCGAGCCTCTTCCTCTGGATCAGGCA
CAAGTCGAAGCCCGGATGCAGACCCGCGGCTCGGCTATTGAAGCCCGCGTCTACGCCGAGGATCCGGACCGGGGC
TTCATGCCGGACTCGGGCAAGTTGGTGCGAGCCGAACTGACGGGGACCGACGATGACGTCCGTCTGGACTGGGGT
TTCGGAACGGGAAGCGTCGTGTCTGAAGCTTACGACGGCATGATTGCCAAACTCATCGTCCGAGGCGACTCGCGA
CGCCAGGCCGTGGCCAAATTGGAGGCGGCACTGCAAAGATTCGAGATTGTGGGCGTCAGCACAAACGTCGAGTTT
CTCAAACGCGTCTGCCAATCGCCAGCCTTTATAGAAGGCGATGTCGAGACGGGCTTTGTCGACAAGTGGCGCGAA
CAACTCTTTGCCAAGCTCCCCGTTCCCGCCGAGGTGTACGCCCAGGCTGCCCTCGGCTTATTGGAACGCGAGCGG
CTACGTCAAGGGAGGGTTGCGTCGCCCAACGGGGAGAGTCTTGGCTTTGGTGACGAGGCTGAGCGGACTGTAACG
CTGCGAGTCGTCGGTCGGGAAGACGGAGAGGAGGAAGCGCAGGTGGGCATCACGCAGACAGGTCGAGGCCGCTTC
GATGTCTCCGTCAAAGGAAAGGATGAGCCGACTCTCTTTAAAGACGTGCTCAGCTCATCGACGCTCACCACGGTC
CAATCTCGTTTCCCCTCTGAGAAGATCACCTCGACTGTCGTGTTGCGTGACTCCGAGTTGGGCTCTGAGCAGACG
AGACTAACTGTCTTTCAACATGGCGTCAAATGGGAGCTCCAGCTTGTGCCTCCCAAGTGGTTTGAAGACGCCCTC
GGTCTCAAAGAGGTGACTGCCTCTGTTGCGGCGCCGATGCCGTGCAAGGTGTTGAAGCTTGAGGTTGCCGAAGGG
GACACGGTGCAGAAGGGGGATCCTCTGGTCGTGTATGTGAAGTCGAGTTCAAGGCTGGACGAGGCTAACGCTTTA
TACAGCATCGAAAGCATGAAGATGGAGACGCTGATCAAGGCTCCGAGGAAGTCTGTCGTAAAACGACTCCCGCAC
AAGGAGGGGGTAAGTTGGGTTTCTTTCGACGGCCTCATGGGCGTGGCTGATGATCGACACGTAGGACATCTGCAA
GGCCGGAACCATACTCGTCTTTTTCGAGGAGGAAGAGGCCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail