Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|1752
Gene name
LocationContig_177:5849..6962
Strand+
Gene length (bp)1113
Transcript length (bp)1020
Coding sequence length (bp)1020
Protein length (aa) 340

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF06687 SUR7 SUR7/PalI family 1.8E-25 44 238

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q07651|FMP45_YEAST SUR7 family protein FMP45 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FMP45 PE=1 SV=1 58 256 4.0E-18
sp|Q5A4M8|SUR7_CANAL Protein SUR7 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SUR7 PE=1 SV=1 47 309 5.0E-13
sp|P40169|YNT4_YEAST Uncharacterized plasma membrane protein YNL194C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YNL194C PE=1 SV=1 45 308 1.0E-12
sp|P54003|SUR7_YEAST Protein SUR7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SUR7 PE=1 SV=1 53 309 3.0E-12

GO

GO Term Description Terminal node
GO:0005886 plasma membrane Yes
GO:0110165 cellular anatomical entity No
GO:0016020 membrane No
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 69 0.5

Transmembrane Domains

Domain # Start End Length
1 39 61 22
2 142 164 22
3 177 199 22
4 219 241 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|1752
MAYQPDNTAQPDGDLAAHQPDNSRQHQTRSRRWLRRLKYTPLATIGIFWLLLGAILLWFIILSGVTRGTPLKHTY
FLRADTSNITGAREITQWTYFLICGDKNRDCHAHGAQSFGRAWAPDAENVPPRLAGNWDQRASFHYFFMWRFGWV
FLIFVFFFIHVALFSALIACCGRRGSIFTLLMCIITWFWYTLAVSIITAVFCQARSKFHQAGRKARIGSWAFGFL
WGSYACVILACFFFLWASRAFKRKDKDHDDYRPAAGAIGAGAGSAGAAYWRRRSDSLPRRSHERDRDDRSLDTRD
HHDRADDQSHHDCNPDEMSDSTTDHDMFQQRPRYKEIIA*
Coding >Ophun1|1752
ATGGCATACCAGCCTGACAACACGGCACAGCCCGACGGCGACTTGGCGGCCCACCAGCCCGATAACTCGAGACAA
CACCAGACGCGAAGTCGAAGATGGCTCCGCAGACTGAAATACACCCCACTCGCCACCATCGGCATCTTCTGGCTC
CTCCTCGGCGCCATCCTCCTCTGGTTCATCATCCTCAGCGGCGTCACCCGCGGCACGCCCCTTAAGCACACCTAC
TTTCTCCGCGCCGACACCAGCAACATAACGGGCGCCCGCGAAATCACCCAATGGACTTACTTTCTGATCTGTGGA
GACAAAAACCGCGACTGTCATGCCCATGGCGCCCAGTCGTTTGGAAGAGCCTGGGCACCGGATGCTGAGAACGTG
CCGCCGCGACTGGCTGGCAACTGGGACCAGCGTGCTAGTTTCCACTACTTTTTTATGTGGCGCTTTGGATGGGTG
TTTCTCATCTTTGTATTCTTTTTCATCCACGTTGCTCTCTTCAGCGCCCTGATTGCCTGCTGTGGACGTCGGGGC
TCCATCTTTACTCTTCTGATGTGTATCATTACCTGGTTCTGGTACACTCTCGCCGTGTCCATCATCACAGCCGTG
TTTTGTCAAGCTCGGAGCAAGTTCCACCAAGCAGGGAGAAAAGCAAGAATAGGTTCCTGGGCCTTTGGCTTCCTC
TGGGGCTCCTACGCCTGCGTCATACTCGCCTGCTTCTTCTTCCTCTGGGCATCACGAGCCTTTAAGAGAAAGGAC
AAGGACCACGACGATTATAGGCCCGCCGCCGGAGCCATCGGTGCTGGAGCTGGGTCTGCGGGCGCCGCATACTGG
CGAAGACGCAGCGACAGCCTGCCGCGACGGAGTCATGAAAGGGATCGTGACGACCGGAGCCTGGACACCCGGGAC
CACCACGATCGTGCCGACGATCAGAGCCATCATGACTGCAATCCAGACGAGATGAGCGATTCTACAACCGATCAC
GATATGTTTCAACAACGCCCCAGGTACAAGGAGATAATTGCCTGA
Transcript >Ophun1|1752
ATGGCATACCAGCCTGACAACACGGCACAGCCCGACGGCGACTTGGCGGCCCACCAGCCCGATAACTCGAGACAA
CACCAGACGCGAAGTCGAAGATGGCTCCGCAGACTGAAATACACCCCACTCGCCACCATCGGCATCTTCTGGCTC
CTCCTCGGCGCCATCCTCCTCTGGTTCATCATCCTCAGCGGCGTCACCCGCGGCACGCCCCTTAAGCACACCTAC
TTTCTCCGCGCCGACACCAGCAACATAACGGGCGCCCGCGAAATCACCCAATGGACTTACTTTCTGATCTGTGGA
GACAAAAACCGCGACTGTCATGCCCATGGCGCCCAGTCGTTTGGAAGAGCCTGGGCACCGGATGCTGAGAACGTG
CCGCCGCGACTGGCTGGCAACTGGGACCAGCGTGCTAGTTTCCACTACTTTTTTATGTGGCGCTTTGGATGGGTG
TTTCTCATCTTTGTATTCTTTTTCATCCACGTTGCTCTCTTCAGCGCCCTGATTGCCTGCTGTGGACGTCGGGGC
TCCATCTTTACTCTTCTGATGTGTATCATTACCTGGTTCTGGTACACTCTCGCCGTGTCCATCATCACAGCCGTG
TTTTGTCAAGCTCGGAGCAAGTTCCACCAAGCAGGGAGAAAAGCAAGAATAGGTTCCTGGGCCTTTGGCTTCCTC
TGGGGCTCCTACGCCTGCGTCATACTCGCCTGCTTCTTCTTCCTCTGGGCATCACGAGCCTTTAAGAGAAAGGAC
AAGGACCACGACGATTATAGGCCCGCCGCCGGAGCCATCGGTGCTGGAGCTGGGTCTGCGGGCGCCGCATACTGG
CGAAGACGCAGCGACAGCCTGCCGCGACGGAGTCATGAAAGGGATCGTGACGACCGGAGCCTGGACACCCGGGAC
CACCACGATCGTGCCGACGATCAGAGCCATCATGACTGCAATCCAGACGAGATGAGCGATTCTACAACCGATCAC
GATATGTTTCAACAACGCCCCAGGTACAAGGAGATAATTGCCTGA
Gene >Ophun1|1752
ATGGCATACCAGCCTGACAACACGGCACAGCCCGACGGCGACTTGGCGGCCCACCAGCCCGATAACTCGAGACAA
CACCAGACGCGAAGTCGAAGATGGCTCCGCAGACTGAAATGTGAGTCTTGCTCCATACCCTTCGCCACACTACTA
ACATCATCAGACACCCCACTCGCCACCATCGGCATCTTCTGGCTCCTCCTCGGCGCCATCCTCCTCTGGTTCATC
ATCCTCAGCGGCGTCACCCGCGGCACGCCCCTTAAGCACACCTACTTTCTCCGCGCCGACACCAGCAACATAACG
GGCGCCCGCGAAATCACCCAATGGACTTACTTTCTGATCTGTGGAGACAAAAACCGCGACTGTCATGCCCATGGC
GCCCAGTCGTTTGGAAGAGCCTGGGCACCGGATGCTGAGAACGTGCCGCCGCGACTGGCTGGCAACTGGGACCAG
CGTGCTAGTTTCCACTACTTTTTTATGTGGCGCTTTGGATGGGTGTTTCTCATCTTTGTATTCTTTTTCATCCAC
GTTGCTCTCTTCAGCGCCCTGATTGCCTGCTGTGGACGTCGGGGCTCCATCTTTACTCTTCTGATGTGTATCATT
ACCTGGTTCTGGTACACTCTCGCCGTGTCCATCATCACGTACGGTCTTTTCTCTTCCTTACAGTTCAGTATGCTA
ACTCTACATAGAGCCGTGTTTTGTCAAGCTCGGAGCAAGTTCCACCAAGCAGGGAGAAAAGCAAGAATAGGTTCC
TGGGCCTTTGGCTTCCTCTGGGGCTCCTACGCCTGCGTCATACTCGCCTGCTTCTTCTTCCTCTGGGCATCACGA
GCCTTTAAGAGAAAGGACAAGGACCACGACGATTATAGGCCCGCCGCCGGAGCCATCGGTGCTGGAGCTGGGTCT
GCGGGCGCCGCATACTGGCGAAGACGCAGCGACAGCCTGCCGCGACGGAGTCATGAAAGGGATCGTGACGACCGG
AGCCTGGACACCCGGGACCACCACGATCGTGCCGACGATCAGAGCCATCATGACTGCAATCCAGACGAGATGAGC
GATTCTACAACCGATCACGATATGTTTCAACAACGCCCCAGGTACAAGGAGATAATTGCCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail