Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|1752
Gene name
LocationContig_177:5849..6962
Strand+
Gene length (bp)1113
Transcript length (bp)1020
Coding sequence length (bp)1020
Protein length (aa) 340

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF06687 SUR7 SUR7/PalI family 1.8E-25 44 238

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q07651|FMP45_YEAST SUR7 family protein FMP45 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FMP45 PE=1 SV=1 58 256 4.0E-18
sp|Q5A4M8|SUR7_CANAL Protein SUR7 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SUR7 PE=1 SV=1 47 309 5.0E-13
sp|P40169|YNT4_YEAST Uncharacterized plasma membrane protein YNL194C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YNL194C PE=1 SV=1 45 308 1.0E-12
sp|P54003|SUR7_YEAST Protein SUR7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SUR7 PE=1 SV=1 53 309 3.0E-12

GO

GO Term Description Terminal node
GO:0005886 plasma membrane Yes
GO:0110165 cellular anatomical entity No
GO:0016020 membrane No
GO:0005575 cellular_component No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

Domain # Start End Length
1 39 61 22
2 142 164 22
3 177 199 22
4 219 241 22

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup2103
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2791
Ophiocordyceps australis map64 (Brazil) OphauB2|2817
Ophiocordyceps camponoti-floridani Ophcf2|00807
Ophiocordyceps camponoti-rufipedis Ophun1|1752 (this protein)
Ophiocordyceps kimflemingae Ophio5|6450
Ophiocordyceps subramaniannii Hirsu2|248

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|1752
MAYQPDNTAQPDGDLAAHQPDNSRQHQTRSRRWLRRLKYTPLATIGIFWLLLGAILLWFIILSGVTRGTPLKHTY
FLRADTSNITGAREITQWTYFLICGDKNRDCHAHGAQSFGRAWAPDAENVPPRLAGNWDQRASFHYFFMWRFGWV
FLIFVFFFIHVALFSALIACCGRRGSIFTLLMCIITWFWYTLAVSIITAVFCQARSKFHQAGRKARIGSWAFGFL
WGSYACVILACFFFLWASRAFKRKDKDHDDYRPAAGAIGAGAGSAGAAYWRRRSDSLPRRSHERDRDDRSLDTRD
HHDRADDQSHHDCNPDEMSDSTTDHDMFQQRPRYKEIIA*
Coding >Ophun1|1752
ATGGCATACCAGCCTGACAACACGGCACAGCCCGACGGCGACTTGGCGGCCCACCAGCCCGATAACTCGAGACAA
CACCAGACGCGAAGTCGAAGATGGCTCCGCAGACTGAAATACACCCCACTCGCCACCATCGGCATCTTCTGGCTC
CTCCTCGGCGCCATCCTCCTCTGGTTCATCATCCTCAGCGGCGTCACCCGCGGCACGCCCCTTAAGCACACCTAC
TTTCTCCGCGCCGACACCAGCAACATAACGGGCGCCCGCGAAATCACCCAATGGACTTACTTTCTGATCTGTGGA
GACAAAAACCGCGACTGTCATGCCCATGGCGCCCAGTCGTTTGGAAGAGCCTGGGCACCGGATGCTGAGAACGTG
CCGCCGCGACTGGCTGGCAACTGGGACCAGCGTGCTAGTTTCCACTACTTTTTTATGTGGCGCTTTGGATGGGTG
TTTCTCATCTTTGTATTCTTTTTCATCCACGTTGCTCTCTTCAGCGCCCTGATTGCCTGCTGTGGACGTCGGGGC
TCCATCTTTACTCTTCTGATGTGTATCATTACCTGGTTCTGGTACACTCTCGCCGTGTCCATCATCACAGCCGTG
TTTTGTCAAGCTCGGAGCAAGTTCCACCAAGCAGGGAGAAAAGCAAGAATAGGTTCCTGGGCCTTTGGCTTCCTC
TGGGGCTCCTACGCCTGCGTCATACTCGCCTGCTTCTTCTTCCTCTGGGCATCACGAGCCTTTAAGAGAAAGGAC
AAGGACCACGACGATTATAGGCCCGCCGCCGGAGCCATCGGTGCTGGAGCTGGGTCTGCGGGCGCCGCATACTGG
CGAAGACGCAGCGACAGCCTGCCGCGACGGAGTCATGAAAGGGATCGTGACGACCGGAGCCTGGACACCCGGGAC
CACCACGATCGTGCCGACGATCAGAGCCATCATGACTGCAATCCAGACGAGATGAGCGATTCTACAACCGATCAC
GATATGTTTCAACAACGCCCCAGGTACAAGGAGATAATTGCCTGA
Transcript >Ophun1|1752
ATGGCATACCAGCCTGACAACACGGCACAGCCCGACGGCGACTTGGCGGCCCACCAGCCCGATAACTCGAGACAA
CACCAGACGCGAAGTCGAAGATGGCTCCGCAGACTGAAATACACCCCACTCGCCACCATCGGCATCTTCTGGCTC
CTCCTCGGCGCCATCCTCCTCTGGTTCATCATCCTCAGCGGCGTCACCCGCGGCACGCCCCTTAAGCACACCTAC
TTTCTCCGCGCCGACACCAGCAACATAACGGGCGCCCGCGAAATCACCCAATGGACTTACTTTCTGATCTGTGGA
GACAAAAACCGCGACTGTCATGCCCATGGCGCCCAGTCGTTTGGAAGAGCCTGGGCACCGGATGCTGAGAACGTG
CCGCCGCGACTGGCTGGCAACTGGGACCAGCGTGCTAGTTTCCACTACTTTTTTATGTGGCGCTTTGGATGGGTG
TTTCTCATCTTTGTATTCTTTTTCATCCACGTTGCTCTCTTCAGCGCCCTGATTGCCTGCTGTGGACGTCGGGGC
TCCATCTTTACTCTTCTGATGTGTATCATTACCTGGTTCTGGTACACTCTCGCCGTGTCCATCATCACAGCCGTG
TTTTGTCAAGCTCGGAGCAAGTTCCACCAAGCAGGGAGAAAAGCAAGAATAGGTTCCTGGGCCTTTGGCTTCCTC
TGGGGCTCCTACGCCTGCGTCATACTCGCCTGCTTCTTCTTCCTCTGGGCATCACGAGCCTTTAAGAGAAAGGAC
AAGGACCACGACGATTATAGGCCCGCCGCCGGAGCCATCGGTGCTGGAGCTGGGTCTGCGGGCGCCGCATACTGG
CGAAGACGCAGCGACAGCCTGCCGCGACGGAGTCATGAAAGGGATCGTGACGACCGGAGCCTGGACACCCGGGAC
CACCACGATCGTGCCGACGATCAGAGCCATCATGACTGCAATCCAGACGAGATGAGCGATTCTACAACCGATCAC
GATATGTTTCAACAACGCCCCAGGTACAAGGAGATAATTGCCTGA
Gene >Ophun1|1752
ATGGCATACCAGCCTGACAACACGGCACAGCCCGACGGCGACTTGGCGGCCCACCAGCCCGATAACTCGAGACAA
CACCAGACGCGAAGTCGAAGATGGCTCCGCAGACTGAAATGTGAGTCTTGCTCCATACCCTTCGCCACACTACTA
ACATCATCAGACACCCCACTCGCCACCATCGGCATCTTCTGGCTCCTCCTCGGCGCCATCCTCCTCTGGTTCATC
ATCCTCAGCGGCGTCACCCGCGGCACGCCCCTTAAGCACACCTACTTTCTCCGCGCCGACACCAGCAACATAACG
GGCGCCCGCGAAATCACCCAATGGACTTACTTTCTGATCTGTGGAGACAAAAACCGCGACTGTCATGCCCATGGC
GCCCAGTCGTTTGGAAGAGCCTGGGCACCGGATGCTGAGAACGTGCCGCCGCGACTGGCTGGCAACTGGGACCAG
CGTGCTAGTTTCCACTACTTTTTTATGTGGCGCTTTGGATGGGTGTTTCTCATCTTTGTATTCTTTTTCATCCAC
GTTGCTCTCTTCAGCGCCCTGATTGCCTGCTGTGGACGTCGGGGCTCCATCTTTACTCTTCTGATGTGTATCATT
ACCTGGTTCTGGTACACTCTCGCCGTGTCCATCATCACGTACGGTCTTTTCTCTTCCTTACAGTTCAGTATGCTA
ACTCTACATAGAGCCGTGTTTTGTCAAGCTCGGAGCAAGTTCCACCAAGCAGGGAGAAAAGCAAGAATAGGTTCC
TGGGCCTTTGGCTTCCTCTGGGGCTCCTACGCCTGCGTCATACTCGCCTGCTTCTTCTTCCTCTGGGCATCACGA
GCCTTTAAGAGAAAGGACAAGGACCACGACGATTATAGGCCCGCCGCCGGAGCCATCGGTGCTGGAGCTGGGTCT
GCGGGCGCCGCATACTGGCGAAGACGCAGCGACAGCCTGCCGCGACGGAGTCATGAAAGGGATCGTGACGACCGG
AGCCTGGACACCCGGGACCACCACGATCGTGCCGACGATCAGAGCCATCATGACTGCAATCCAGACGAGATGAGC
GATTCTACAACCGATCACGATATGTTTCAACAACGCCCCAGGTACAAGGAGATAATTGCCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail