Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|1750
Gene name
LocationContig_177:1818..3902
Strand-
Gene length (bp)2084
Transcript length (bp)1992
Coding sequence length (bp)1992
Protein length (aa) 664

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00474 SSF Sodium:solute symporter family 3.8E-23 48 465

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O94469|DUR31_SCHPO Probable urea active transporter 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dur3-1 PE=3 SV=1 6 658 0.0E+00
sp|P33413|DUR3_YEAST Urea active transporter OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DUR3 PE=1 SV=2 6 642 0.0E+00
sp|F4KD71|DUR3_ARATH Urea-proton symporter DUR3 OS=Arabidopsis thaliana GN=DUR3 PE=1 SV=1 8 647 1.0E-164
sp|Q7XBS0|DUR3_ORYSJ Urea-proton symporter DUR3 OS=Oryza sativa subsp. japonica GN=DUR3 PE=1 SV=1 6 642 3.0E-163
sp|Q9URY6|DUR33_SCHPO Probable urea active transporter 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dur3-3 PE=3 SV=1 8 657 4.0E-156
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O94469|DUR31_SCHPO Probable urea active transporter 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dur3-1 PE=3 SV=1 6 658 0.0E+00
sp|P33413|DUR3_YEAST Urea active transporter OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DUR3 PE=1 SV=2 6 642 0.0E+00
sp|F4KD71|DUR3_ARATH Urea-proton symporter DUR3 OS=Arabidopsis thaliana GN=DUR3 PE=1 SV=1 8 647 1.0E-164
sp|Q7XBS0|DUR3_ORYSJ Urea-proton symporter DUR3 OS=Oryza sativa subsp. japonica GN=DUR3 PE=1 SV=1 6 642 3.0E-163
sp|Q9URY6|DUR33_SCHPO Probable urea active transporter 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dur3-3 PE=3 SV=1 8 657 4.0E-156
sp|Q8TFG0|DUR32_SCHPO Probable urea active transporter 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dur3-2 PE=3 SV=1 6 646 6.0E-128
sp|O06493|OPUE_BACSU Osmoregulated proline transporter OpuE OS=Bacillus subtilis (strain 168) GN=opuE PE=1 SV=1 95 486 4.0E-07
sp|P45174|PUTP_HAEIN Sodium/proline symporter OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=putP PE=3 SV=1 116 420 3.0E-06
sp|P96169|SGLT_VIBPH Sodium/glucose cotransporter OS=Vibrio parahaemolyticus GN=sglT PE=1 SV=2 21 470 4.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0022857 transmembrane transporter activity Yes
GO:0016020 membrane Yes
GO:0055085 transmembrane transport Yes
GO:0051179 localization No
GO:0005215 transporter activity No
GO:0051234 establishment of localization No
GO:0003674 molecular_function No
GO:0009987 cellular process No
GO:0005575 cellular_component No
GO:0006810 transport No
GO:0110165 cellular anatomical entity No
GO:0008150 biological_process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.5

Transmembrane Domains

Domain # Start End Length
1 13 35 22
2 56 78 22
3 88 110 22
4 136 158 22
5 162 184 22
6 191 213 22
7 249 271 22
8 284 306 22
9 342 364 22
10 402 424 22
11 428 450 22
12 455 477 22
13 497 519 22
14 570 592 22
15 607 629 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|1750
MTSPGPALSQGYGYGIVLGLGFAFAVLMIFITYLLKRFNNEVQTSEMFNTAGRSVKSGLVAAAVVSSWTWAATLL
QSTGVGYRYGVSGPFFYAAGATCQVLLFATLAITLKKRAPNCHTFLEAVHARYGRPAHLTFIGFGLATNVLVSLM
LIAGGAATVNALTGVNTVAAIFLMPVPVVAYTLIGGLKATFITDYIHGFAVIIIVIIFALQVYARSDVLGSPAAV
YDRLVAAAASHPVPGNQDGSYLTMRSSGGIIFFVINIVGNFGTVFLDNAYYNKAIAAHPVHALPGYIMGGAAWFA
IPWLTATTLGLAGLALESSPRFPTYPDRMTEAEVSAGLVLPYAAVALLGKGGAVMTLIIIFLAVTSSFNAELVAT
SSIFTYDIYRTYVRPSASGRHLIRMSHVCMMLYTMVICLASIGLWYNGISLGYLYLLMGVIISSGVVPAVLTLLW
SRQNRWAATFTPIIGTCCAIVAWLVTAHKTCGRLDVECTGSNNPMLVGNLTALLSPLVLVPALCLIFGFDRYDWV
SMAAIRKADDADVLDHASLDEEARQELTRAREVDAYTERRQLDRAFKVACFVTISMTLALLVLWPMPMYGTGYIF
SVRFFTGWVAVGIAWIFGSLIAIGLYPLWESRATLMRVVRAMVKGKRRPLTFIEEKEGGVKGR*
Coding >Ophun1|1750
ATGACCTCTCCCGGCCCGGCACTGAGCCAAGGCTATGGCTATGGCATCGTCCTCGGCCTCGGCTTCGCATTTGCC
GTTCTCATGATCTTCATCACATACCTGCTCAAGCGGTTCAACAACGAGGTCCAGACGTCGGAAATGTTCAACACG
GCCGGTCGCAGCGTCAAGTCTGGCCTCGTGGCCGCCGCCGTCGTCTCCTCCTGGACCTGGGCCGCGACGCTGCTC
CAGAGCACGGGTGTTGGATACCGCTACGGAGTCTCTGGTCCTTTTTTTTACGCAGCGGGAGCAACATGCCAGGTT
CTTTTGTTTGCGACTCTCGCCATCACGCTGAAGAAGCGGGCGCCCAACTGCCACACCTTTCTCGAAGCCGTTCAT
GCCCGCTACGGGAGGCCAGCCCATCTGACCTTTATCGGCTTCGGACTCGCCACCAATGTGCTCGTATCGCTGATG
CTCATCGCCGGCGGCGCGGCCACTGTTAATGCGCTGACGGGGGTCAATACCGTGGCCGCCATCTTTCTCATGCCC
GTCCCCGTCGTGGCTTACACGCTCATCGGCGGGCTCAAGGCGACATTCATCACCGACTACATCCATGGCTTTGCC
GTCATCATCATCGTCATCATCTTTGCTCTCCAGGTCTACGCCAGGTCCGACGTTCTGGGGAGCCCGGCGGCGGTG
TACGATCGCCTCGTCGCAGCCGCTGCCTCGCATCCCGTTCCCGGTAACCAAGATGGGAGCTACCTTACCATGAGA
AGCAGCGGCGGAATCATCTTCTTCGTCATCAACATTGTTGGAAACTTTGGTACAGTCTTCTTGGACAACGCCTAC
TACAACAAGGCCATCGCCGCTCATCCGGTGCATGCCCTACCAGGCTACATCATGGGCGGTGCTGCCTGGTTCGCT
ATCCCGTGGTTGACGGCCACGACGCTGGGCCTGGCTGGGCTGGCACTCGAGTCCAGCCCTCGCTTCCCGACCTAC
CCTGACCGCATGACAGAGGCCGAAGTCTCGGCTGGTCTGGTGCTTCCGTACGCTGCTGTCGCTCTCCTGGGCAAG
GGCGGCGCCGTCATGACGCTCATCATCATCTTTCTCGCCGTCACGTCGTCTTTCAACGCCGAGCTGGTGGCAACG
TCGTCCATATTCACTTACGACATATATCGTACCTATGTGCGGCCCAGCGCCAGCGGCAGACACCTGATACGCATG
TCGCACGTCTGCATGATGCTGTATACCATGGTCATTTGCCTCGCCTCCATCGGCCTCTGGTACAACGGCATCTCG
CTGGGCTATCTGTACCTGCTGATGGGCGTCATCATCTCGTCCGGAGTCGTTCCTGCGGTTCTGACGCTGCTCTGG
AGTCGACAGAACCGGTGGGCGGCGACGTTTACCCCCATCATCGGCACCTGCTGCGCCATCGTTGCATGGCTCGTC
ACTGCGCACAAGACTTGCGGCCGACTGGACGTCGAGTGCACGGGGTCCAACAATCCCATGTTGGTTGGCAACCTG
ACGGCTCTCTTATCGCCGCTGGTGCTGGTACCGGCGCTGTGTCTGATCTTTGGATTCGATCGATACGACTGGGTG
TCCATGGCAGCCATTCGCAAGGCCGACGACGCAGACGTGCTTGACCACGCGTCGCTCGACGAAGAAGCCCGGCAG
GAGTTGACTCGGGCAAGAGAGGTCGACGCCTATACGGAGAGGCGACAGCTCGACCGGGCCTTCAAGGTGGCCTGC
TTCGTCACGATTAGCATGACGCTGGCGTTGTTGGTTCTCTGGCCGATGCCCATGTACGGCACGGGCTACATCTTT
TCCGTACGCTTCTTTACGGGCTGGGTGGCGGTGGGCATCGCGTGGATCTTTGGCTCTTTGATAGCCATCGGTCTG
TACCCTCTGTGGGAGAGTCGGGCGACTTTGATGCGGGTGGTGAGGGCCATGGTAAAGGGGAAGCGGAGACCATTG
ACGTTTATTGAGGAAAAGGAAGGCGGTGTCAAAGGACGATGA
Transcript >Ophun1|1750
ATGACCTCTCCCGGCCCGGCACTGAGCCAAGGCTATGGCTATGGCATCGTCCTCGGCCTCGGCTTCGCATTTGCC
GTTCTCATGATCTTCATCACATACCTGCTCAAGCGGTTCAACAACGAGGTCCAGACGTCGGAAATGTTCAACACG
GCCGGTCGCAGCGTCAAGTCTGGCCTCGTGGCCGCCGCCGTCGTCTCCTCCTGGACCTGGGCCGCGACGCTGCTC
CAGAGCACGGGTGTTGGATACCGCTACGGAGTCTCTGGTCCTTTTTTTTACGCAGCGGGAGCAACATGCCAGGTT
CTTTTGTTTGCGACTCTCGCCATCACGCTGAAGAAGCGGGCGCCCAACTGCCACACCTTTCTCGAAGCCGTTCAT
GCCCGCTACGGGAGGCCAGCCCATCTGACCTTTATCGGCTTCGGACTCGCCACCAATGTGCTCGTATCGCTGATG
CTCATCGCCGGCGGCGCGGCCACTGTTAATGCGCTGACGGGGGTCAATACCGTGGCCGCCATCTTTCTCATGCCC
GTCCCCGTCGTGGCTTACACGCTCATCGGCGGGCTCAAGGCGACATTCATCACCGACTACATCCATGGCTTTGCC
GTCATCATCATCGTCATCATCTTTGCTCTCCAGGTCTACGCCAGGTCCGACGTTCTGGGGAGCCCGGCGGCGGTG
TACGATCGCCTCGTCGCAGCCGCTGCCTCGCATCCCGTTCCCGGTAACCAAGATGGGAGCTACCTTACCATGAGA
AGCAGCGGCGGAATCATCTTCTTCGTCATCAACATTGTTGGAAACTTTGGTACAGTCTTCTTGGACAACGCCTAC
TACAACAAGGCCATCGCCGCTCATCCGGTGCATGCCCTACCAGGCTACATCATGGGCGGTGCTGCCTGGTTCGCT
ATCCCGTGGTTGACGGCCACGACGCTGGGCCTGGCTGGGCTGGCACTCGAGTCCAGCCCTCGCTTCCCGACCTAC
CCTGACCGCATGACAGAGGCCGAAGTCTCGGCTGGTCTGGTGCTTCCGTACGCTGCTGTCGCTCTCCTGGGCAAG
GGCGGCGCCGTCATGACGCTCATCATCATCTTTCTCGCCGTCACGTCGTCTTTCAACGCCGAGCTGGTGGCAACG
TCGTCCATATTCACTTACGACATATATCGTACCTATGTGCGGCCCAGCGCCAGCGGCAGACACCTGATACGCATG
TCGCACGTCTGCATGATGCTGTATACCATGGTCATTTGCCTCGCCTCCATCGGCCTCTGGTACAACGGCATCTCG
CTGGGCTATCTGTACCTGCTGATGGGCGTCATCATCTCGTCCGGAGTCGTTCCTGCGGTTCTGACGCTGCTCTGG
AGTCGACAGAACCGGTGGGCGGCGACGTTTACCCCCATCATCGGCACCTGCTGCGCCATCGTTGCATGGCTCGTC
ACTGCGCACAAGACTTGCGGCCGACTGGACGTCGAGTGCACGGGGTCCAACAATCCCATGTTGGTTGGCAACCTG
ACGGCTCTCTTATCGCCGCTGGTGCTGGTACCGGCGCTGTGTCTGATCTTTGGATTCGATCGATACGACTGGGTG
TCCATGGCAGCCATTCGCAAGGCCGACGACGCAGACGTGCTTGACCACGCGTCGCTCGACGAAGAAGCCCGGCAG
GAGTTGACTCGGGCAAGAGAGGTCGACGCCTATACGGAGAGGCGACAGCTCGACCGGGCCTTCAAGGTGGCCTGC
TTCGTCACGATTAGCATGACGCTGGCGTTGTTGGTTCTCTGGCCGATGCCCATGTACGGCACGGGCTACATCTTT
TCCGTACGCTTCTTTACGGGCTGGGTGGCGGTGGGCATCGCGTGGATCTTTGGCTCTTTGATAGCCATCGGTCTG
TACCCTCTGTGGGAGAGTCGGGCGACTTTGATGCGGGTGGTGAGGGCCATGGTAAAGGGGAAGCGGAGACCATTG
ACGTTTATTGAGGAAAAGGAAGGCGGTGTCAAAGGACGATGA
Gene >Ophun1|1750
ATGACCTCTCCCGGCCCGGCACTGAGCCAAGGCTATGGCTATGGCATCGTCCTCGGCCTCGGCTTCGCATTTGCC
GTTCTCATGGTTCGTCCGTCCCTGCTCTGGTCCTTGGTGATTCGCTGACTTGATAGATCTTCATCACATACCTGC
TCAAGCGGTTCAACAACGAGGTCCAGACGTCGGAAATGTTCAACACGGCCGGTCGCAGCGTCAAGTCTGGCCTCG
TGGCCGCCGCCGTCGTCTCCTCCTGGACCTGGGCCGCGACGCTGCTCCAGAGCACGGGTGTTGGATACCGCTACG
GAGTCTCTGGTCCTTTTTTTTACGCAGCGGGAGCAACATGCCAGGTTCTTTTGTTTGCGACTCTCGCCATCACGC
TGAAGAAGCGGGCGCCCAACTGCCACACCTTTCTCGAAGCCGTTCATGCCCGCTACGGGAGGCCAGCCCATCTGA
CCTTTATCGGCTTCGGACTCGCCACCAATGTGCTCGTATCGCTGATGCTCATCGCCGGCGGCGCGGCCACTGTTA
ATGCGCTGACGGGGGTCAATACCGTGGCCGCCATCTTTCTCATGCCCGTCCCCGTCGTGGCTTACACGCTCATCG
GCGGGCTCAAGGCGACATTCATCACCGACTACATCCATGGCTTTGCCGTCATCATCATCGTCATCATCTTTGCTC
TCCAGGTCTACGCCAGGTCCGACGTTCTGGGGAGCCCGGCGGCGGTGTACGATCGCCTCGTCGCAGCCGCTGCCT
CGCATCCCGTTCCCGGTAACCAAGATGGGAGCTACCTTACCATGAGAAGCAGCGGCGGAATCATCTTCTTCGTCA
TCAACATTGTTGGAAACTTTGGTACAGTCTTCTTGGACAACGCCTACTACAACAAGGCCATCGCCGCTCATCCGG
TGCATGCCCTACCAGGCTACATCATGGGCGGTGCTGCCTGGTTCGCTATCCCGTGGTTGACGGCCACGACGCTGG
GCCTGGCTGGGCTGGCACTCGAGTCCAGCCCTCGCTTCCCGACCTACCCTGACCGCATGACAGAGGCCGAAGTCT
CGGCTGGTCTGGTGCTTCCGTACGCTGCTGTCGCTCTCCTGGGCAAGGGCGGCGCCGTCATGACGCTCATCATCA
TCTTTCTCGCCGTCACGTCGTCTTTCAACGCCGAGCTGGTGGCAACGTCGTCCATATTCACTTACGACATATATC
GTACCTATGTGCGGCCCAGCGCCAGCGGCAGACACCTGATACGCATGTCGCACGTCTGCATGATGCTGTATACCA
TGGTCATTTGCCTCGCCTCCATCGGCCTCTGGTACAACGGCATCTCGCTGGGCTATCTGTACCTGCTGATGGGCG
TCATCATCTCGTCCGGAGTCGTTCCTGCGGTTCTGACGCTGCTCTGGAGTCGACAGAACCGGTGGGCGGCGACGT
TTACCCCCATCATCGGCACCTGCTGCGCCATCGTTGCATGGCTCGTCACTGCGCACAAGACTTGCGGCCGACTGG
ACGTCGAGTGCACGGGGTCCAACAATCCCATGTTGGTTGGCAACCTGACGGCTCTCTTATCGCCGCTGGTGCTGG
TACCGGCGCTGTGTCTGATCTTTGGATTCGATCGATACGACTGGGTGTCCATGGCAGCCATTCGCAAGGCCGACG
ACGCAGACGTGCTTGACCACGCGTCGCTCGACGAAGAAGCCCGGCAGGAGTTGACTCGGGCAAGAGAGGTCGACG
CCTATACGGAGAGGCGACAGCTCGACCGGGCCTTCAAGGTGGCCTGCTTCGTCACGATTAGCATGTGAGAACCCT
TGGACTCATGGAGACGATAGCTGACGGCGGACAGGACGCTGGCGTTGTTGGTTCTCTGGCCGATGCCCATGTACG
GCACGGGCTACATCTTTTCCGTACGCTTCTTTACGGGCTGGGTGGCGGTGGGCATCGCGTGGATCTTTGGCTCTT
TGATAGCCATCGGTCTGTACCCTCTGTGGGAGAGTCGGGCGACTTTGATGCGGGTGGTGAGGGCCATGGTAAAGG
GGAAGCGGAGACCATTGACGTTTATTGAGGAAAAGGAAGGCGGTGTCAAAGGACGATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail