Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|1749
Gene name
LocationContig_177:44..1498
Strand-
Gene length (bp)1454
Transcript length (bp)1407
Coding sequence length (bp)1407
Protein length (aa) 469

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04030 ALO D-arabinono-1,4-lactone oxidase 2.3E-68 199 462
PF01565 FAD_binding_4 FAD binding domain 1.6E-31 40 174

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q7SGY1|ALO_NEUCR Putative D-arabinono-1,4-lactone oxidase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=alo-1 PE=3 SV=1 16 465 7.0E-176
sp|Q6CG88|ALO_YARLI D-arabinono-1,4-lactone oxidase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=ALO1 PE=3 SV=1 23 460 4.0E-105
sp|Q6CSY3|ALO_KLULA D-arabinono-1,4-lactone oxidase OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=ALO1 PE=3 SV=1 17 468 1.0E-103
sp|Q752Y3|ALO_ASHGO D-arabinono-1,4-lactone oxidase OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=ALO1 PE=3 SV=1 25 468 3.0E-101
sp|Q6FS20|ALO_CANGA D-arabinono-1,4-lactone oxidase OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=ALO1 PE=3 SV=1 21 468 6.0E-100
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q7SGY1|ALO_NEUCR Putative D-arabinono-1,4-lactone oxidase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=alo-1 PE=3 SV=1 16 465 7.0E-176
sp|Q6CG88|ALO_YARLI D-arabinono-1,4-lactone oxidase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=ALO1 PE=3 SV=1 23 460 4.0E-105
sp|Q6CSY3|ALO_KLULA D-arabinono-1,4-lactone oxidase OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=ALO1 PE=3 SV=1 17 468 1.0E-103
sp|Q752Y3|ALO_ASHGO D-arabinono-1,4-lactone oxidase OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=ALO1 PE=3 SV=1 25 468 3.0E-101
sp|Q6FS20|ALO_CANGA D-arabinono-1,4-lactone oxidase OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=ALO1 PE=3 SV=1 21 468 6.0E-100
sp|P54783|ALO_YEAST D-arabinono-1,4-lactone oxidase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ALO1 PE=1 SV=1 19 468 2.0E-98
sp|O93852|ALO_CANAL D-arabinono-1,4-lactone oxidase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ALO1 PE=3 SV=1 20 461 1.0E-96
sp|Q6BZA0|ALO_DEBHA D-arabinono-1,4-lactone oxidase OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=ALO1 PE=3 SV=2 28 461 3.0E-89
sp|Q9HDX8|ALO_SCHPO D-arabinono-1,4-lactone oxidase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=alo1 PE=3 SV=1 31 459 2.0E-81
sp|Q90YK3|GGLO_SCYTO L-gulonolactone oxidase OS=Scyliorhinus torazame GN=GULO PE=2 SV=1 31 457 6.0E-73
sp|Q3ZC33|GGLO_BOVIN L-gulonolactone oxidase OS=Bos taurus GN=GULO PE=2 SV=3 30 457 3.0E-62
sp|P58710|GGLO_MOUSE L-gulonolactone oxidase OS=Mus musculus GN=Gulo PE=1 SV=3 30 457 2.0E-61
sp|Q8HXW0|GGLO_PIG L-gulonolactone oxidase OS=Sus scrofa GN=GULO PE=2 SV=3 30 457 5.0E-61
sp|P10867|GGLO_RAT L-gulonolactone oxidase OS=Rattus norvegicus GN=Gulo PE=1 SV=3 30 457 4.0E-58
sp|P9WIT3|GULDH_MYCTU L-gulono-1,4-lactone dehydrogenase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv1771 PE=1 SV=1 31 457 5.0E-37
sp|P9WIT2|GULDH_MYCTO L-gulono-1,4-lactone dehydrogenase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT1821 PE=3 SV=1 31 457 5.0E-37
sp|O47881|GLDH_BRAOL L-galactono-1,4-lactone dehydrogenase, mitochondrial OS=Brassica oleracea PE=1 SV=1 27 250 1.0E-28
sp|Q9SU56|GLDH_ARATH L-galactono-1,4-lactone dehydrogenase, mitochondrial OS=Arabidopsis thaliana GN=GLDH PE=1 SV=1 27 250 5.0E-27
sp|Q2QXY1|GLDH2_ORYSJ L-galactono-1,4-lactone dehydrogenase 2, mitochondrial OS=Oryza sativa subsp. japonica GN=GLDH2 PE=2 SV=1 27 258 7.0E-26
sp|Q2RAP0|GLDH1_ORYSJ L-galactono-1,4-lactone dehydrogenase 1, mitochondrial OS=Oryza sativa subsp. japonica GN=GLDH1 PE=2 SV=1 27 258 7.0E-24
sp|Q9ZBU1|XYOA_STRCO Probable xylitol oxidase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=xyoA PE=1 SV=1 31 209 2.0E-17
sp|O81032|GGLO6_ARATH Probable L-gulonolactone oxidase 6 OS=Arabidopsis thaliana GN=GULLO6 PE=3 SV=1 46 254 2.0E-15
sp|Q6NQ66|GGLO2_ARATH L-gulonolactone oxidase 2 OS=Arabidopsis thaliana GN=GULLO2 PE=1 SV=1 46 255 2.0E-15
sp|Q9KX73|XYOA_STRSI Xylitol oxidase OS=Streptomyces sp. (strain IKD472 / FERM P-14339) GN=xyoA PE=1 SV=1 85 250 6.0E-15
sp|O81030|GGLO5_ARATH L-gulonolactone oxidase 5 OS=Arabidopsis thaliana GN=GULLO5 PE=1 SV=1 46 254 9.0E-15
sp|Q9FM82|GGLO4_ARATH Probable L-gulonolactone oxidase 4 OS=Arabidopsis thaliana GN=GULLO4 PE=2 SV=1 46 254 4.0E-14
sp|Q9C614|GGLO1_ARATH Probable L-gulonolactone oxidase 1 OS=Arabidopsis thaliana GN=GULLO1 PE=3 SV=1 20 254 1.0E-12
sp|Q5BQE6|DHC24_RAT Delta(24)-sterol reductase OS=Rattus norvegicus GN=Dhcr24 PE=2 SV=2 30 206 4.0E-11
sp|Q8VCH6|DHC24_MOUSE Delta(24)-sterol reductase OS=Mus musculus GN=Dhcr24 PE=1 SV=1 30 206 6.0E-11
sp|Q60HC5|DHC24_MACFA Delta(24)-sterol reductase OS=Macaca fascicularis GN=DHCR24 PE=2 SV=2 30 206 6.0E-11
sp|Q15392|DHC24_HUMAN Delta(24)-sterol reductase OS=Homo sapiens GN=DHCR24 PE=1 SV=2 30 206 6.0E-11
sp|Q54H55|Y8969_DICDI FAD-linked oxidoreductase DDB_G0289697 OS=Dictyostelium discoideum GN=DDB_G0289697 PE=2 SV=1 5 209 3.0E-10
sp|B8B7X6|D2HDH_ORYSI Probable D-2-hydroxyglutarate dehydrogenase, mitochondrial OS=Oryza sativa subsp. indica GN=D2HGDH PE=3 SV=1 32 237 6.0E-09
sp|Q7XI14|D2HDH_ORYSJ Probable D-2-hydroxyglutarate dehydrogenase, mitochondrial OS=Oryza sativa subsp. japonica GN=D2HGDH PE=3 SV=1 32 237 7.0E-09
sp|Q8N465|D2HDH_HUMAN D-2-hydroxyglutarate dehydrogenase, mitochondrial OS=Homo sapiens GN=D2HGDH PE=1 SV=3 32 211 3.0E-08
sp|Q9V778|ADAS_DROME Alkyldihydroxyacetonephosphate synthase OS=Drosophila melanogaster GN=CG10253 PE=2 SV=1 26 205 3.0E-08
sp|Q796P5|YITY_BACSU Uncharacterized FAD-linked oxidoreductase YitY OS=Bacillus subtilis (strain 168) GN=yitY PE=3 SV=2 56 202 4.0E-08
sp|Q8CIM3|D2HDH_MOUSE D-2-hydroxyglutarate dehydrogenase, mitochondrial OS=Mus musculus GN=D2hgdh PE=1 SV=3 32 211 5.0E-08
sp|P94535|GLCD_BACSU Glycolate oxidase subunit GlcD OS=Bacillus subtilis (strain 168) GN=glcD PE=3 SV=1 36 251 5.0E-08
sp|P84850|D2HDH_RAT D-2-hydroxyglutarate dehydrogenase, mitochondrial OS=Rattus norvegicus GN=D2hgdh PE=3 SV=1 32 211 7.0E-08
sp|Q94AX4|DLD_ARATH D-lactate dehydrogenase [cytochrome], mitochondrial OS=Arabidopsis thaliana GN=DLD PE=1 SV=1 1 209 1.0E-07
sp|Q86WU2|LDHD_HUMAN Probable D-lactate dehydrogenase, mitochondrial OS=Homo sapiens GN=LDHD PE=1 SV=1 40 170 3.0E-07
sp|A0R607|DPRE1_MYCS2 FAD-dependent decaprenylphosphoryl-beta-D-ribofuranose 2-oxidase OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=dprE1 PE=1 SV=2 45 253 4.0E-07
sp|P43485|MCRA_STRLA Mitomycin radical oxidase OS=Streptomyces lavendulae GN=mcrA PE=1 SV=2 38 205 5.0E-07
sp|Q7TNG8|LDHD_MOUSE Probable D-lactate dehydrogenase, mitochondrial OS=Mus musculus GN=Ldhd PE=1 SV=1 40 206 1.0E-06
sp|Q6Z955|CKX11_ORYSJ Cytokinin dehydrogenase 11 OS=Oryza sativa subsp. japonica GN=CKX11 PE=2 SV=1 32 206 1.0E-06
sp|P08159|HDNO_ARTOX 6-hydroxy-D-nicotine oxidase OS=Arthrobacter oxydans PE=1 SV=2 26 202 2.0E-06
sp|P77748|YDIJ_ECOLI Uncharacterized protein YdiJ OS=Escherichia coli (strain K12) GN=ydiJ PE=3 SV=1 31 169 8.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016020 membrane Yes
GO:0016491 oxidoreductase activity Yes
GO:0003885 D-arabinono-1,4-lactone oxidase activity Yes
GO:0050660 flavin adenine dinucleotide binding Yes
GO:0003824 catalytic activity No
GO:1901265 nucleoside phosphate binding No
GO:0043168 anion binding No
GO:0043167 ion binding No
GO:1901363 heterocyclic compound binding No
GO:0036094 small molecule binding No
GO:0097159 organic cyclic compound binding No
GO:0005575 cellular_component No
GO:0000166 nucleotide binding No
GO:0110165 cellular anatomical entity No
GO:0005488 binding No
GO:0016899 oxidoreductase activity, acting on the CH-OH group of donors, oxygen as acceptor No
GO:0003674 molecular_function No
GO:0016614 oxidoreductase activity, acting on CH-OH group of donors No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 63 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|1749
MNPLATSLEKATGDEDDGIPFRARRNHVHRTWAGTFTSLPELYIQPQTIAEVEKAVRLAQQRGRRIVTTGSGHSP
SSLTCTSSWMLNLDHLSRIVSLDSQTGIVVVEAGIRLGALTETLSRHGLALPNLGSIDQQSIAGALATGTHGSSL
RHGLVSEAVTGLRITLAGGRTERCDARVRPELFRAALLSLGALGVVVEVTIQAVPAFDIAWRQRMDAEARMLESW
REGTLWTQAEFVRVWWFPYTRRAVVWRGDKTERAVTMDEEQRGRGDGAKGWLDGVWPRISFNLHRGLLWLAHWVP
SVLPTVEWLVFGLEYGFADGTETGAVEPGRRALLMDCLYSQFVNEWALPLHRGPEALARLGAWLHGLPAEHPDHY
GRPIPFPVAGLYVHAPIEVRVCDTTKSKPRPLLDPTADNTPTLFLNATLYRPFGLNPPCHHRYYQAFEWLMSDLD
GRPHWAKNFLAGRAEGRG*
Coding >Ophun1|1749
ATGAACCCTTTAGCGACCAGCCTCGAAAAAGCCACCGGCGATGAAGACGACGGCATCCCGTTCCGGGCTCGGAGA
AACCACGTGCACCGCACATGGGCCGGGACCTTTACCAGCCTCCCCGAGCTCTACATTCAACCCCAGACCATCGCC
GAAGTCGAAAAAGCAGTGAGACTGGCGCAGCAGCGCGGACGACGCATCGTGACGACGGGAAGCGGTCACTCGCCG
TCGAGTCTGACTTGCACGTCAAGCTGGATGCTCAATCTAGACCACCTCTCACGCATCGTCTCCCTCGACAGCCAA
ACAGGCATCGTCGTCGTCGAAGCCGGCATCCGACTCGGAGCCCTCACAGAAACCCTCTCCCGCCACGGCCTCGCG
CTCCCCAACCTAGGAAGCATAGACCAGCAGTCCATCGCCGGCGCGCTGGCAACGGGCACGCACGGAAGCAGTCTC
CGTCACGGGCTCGTCTCCGAGGCAGTCACCGGGTTGCGCATCACGCTGGCGGGCGGCCGCACCGAGAGATGCGAC
GCGCGCGTTCGGCCCGAGTTGTTTCGCGCGGCGTTGCTTTCGCTGGGGGCGTTGGGCGTCGTCGTCGAGGTTACC
ATCCAGGCGGTGCCGGCGTTTGACATTGCGTGGCGGCAGAGGATGGATGCCGAGGCGCGGATGCTGGAGTCGTGG
CGGGAGGGGACCTTGTGGACGCAGGCCGAGTTTGTGCGCGTTTGGTGGTTTCCTTACACGCGGAGGGCTGTTGTC
TGGCGGGGGGATAAGACGGAGAGGGCGGTGACGATGGATGAGGAGCAGAGGGGGAGAGGGGATGGTGCCAAGGGC
TGGTTGGATGGAGTATGGCCGCGGATCAGCTTCAATCTTCATCGTGGACTGCTGTGGCTGGCTCACTGGGTGCCT
TCGGTGCTGCCGACGGTTGAGTGGCTCGTCTTTGGGCTGGAGTATGGCTTCGCGGATGGGACTGAGACTGGGGCA
GTTGAGCCGGGGAGACGGGCCCTGCTGATGGACTGTCTCTACTCGCAGTTCGTCAACGAATGGGCCTTGCCGCTG
CATCGAGGACCGGAGGCTCTGGCCCGGCTTGGAGCCTGGCTTCACGGCCTACCGGCGGAACATCCGGATCACTAC
GGACGGCCGATACCGTTCCCGGTTGCAGGGCTATACGTCCACGCGCCCATCGAGGTGCGCGTCTGCGACACAACA
AAGAGCAAACCACGCCCCCTCCTCGACCCAACCGCCGACAACACTCCAACCCTCTTCCTCAACGCGACGCTCTAC
CGCCCCTTCGGCCTCAACCCGCCCTGCCACCACCGCTACTACCAAGCCTTCGAGTGGCTGATGAGCGACCTGGAC
GGCCGGCCGCACTGGGCGAAGAACTTCTTGGCGGGCAGGGCCGAGGGGCGAGGTTGA
Transcript >Ophun1|1749
ATGAACCCTTTAGCGACCAGCCTCGAAAAAGCCACCGGCGATGAAGACGACGGCATCCCGTTCCGGGCTCGGAGA
AACCACGTGCACCGCACATGGGCCGGGACCTTTACCAGCCTCCCCGAGCTCTACATTCAACCCCAGACCATCGCC
GAAGTCGAAAAAGCAGTGAGACTGGCGCAGCAGCGCGGACGACGCATCGTGACGACGGGAAGCGGTCACTCGCCG
TCGAGTCTGACTTGCACGTCAAGCTGGATGCTCAATCTAGACCACCTCTCACGCATCGTCTCCCTCGACAGCCAA
ACAGGCATCGTCGTCGTCGAAGCCGGCATCCGACTCGGAGCCCTCACAGAAACCCTCTCCCGCCACGGCCTCGCG
CTCCCCAACCTAGGAAGCATAGACCAGCAGTCCATCGCCGGCGCGCTGGCAACGGGCACGCACGGAAGCAGTCTC
CGTCACGGGCTCGTCTCCGAGGCAGTCACCGGGTTGCGCATCACGCTGGCGGGCGGCCGCACCGAGAGATGCGAC
GCGCGCGTTCGGCCCGAGTTGTTTCGCGCGGCGTTGCTTTCGCTGGGGGCGTTGGGCGTCGTCGTCGAGGTTACC
ATCCAGGCGGTGCCGGCGTTTGACATTGCGTGGCGGCAGAGGATGGATGCCGAGGCGCGGATGCTGGAGTCGTGG
CGGGAGGGGACCTTGTGGACGCAGGCCGAGTTTGTGCGCGTTTGGTGGTTTCCTTACACGCGGAGGGCTGTTGTC
TGGCGGGGGGATAAGACGGAGAGGGCGGTGACGATGGATGAGGAGCAGAGGGGGAGAGGGGATGGTGCCAAGGGC
TGGTTGGATGGAGTATGGCCGCGGATCAGCTTCAATCTTCATCGTGGACTGCTGTGGCTGGCTCACTGGGTGCCT
TCGGTGCTGCCGACGGTTGAGTGGCTCGTCTTTGGGCTGGAGTATGGCTTCGCGGATGGGACTGAGACTGGGGCA
GTTGAGCCGGGGAGACGGGCCCTGCTGATGGACTGTCTCTACTCGCAGTTCGTCAACGAATGGGCCTTGCCGCTG
CATCGAGGACCGGAGGCTCTGGCCCGGCTTGGAGCCTGGCTTCACGGCCTACCGGCGGAACATCCGGATCACTAC
GGACGGCCGATACCGTTCCCGGTTGCAGGGCTATACGTCCACGCGCCCATCGAGGTGCGCGTCTGCGACACAACA
AAGAGCAAACCACGCCCCCTCCTCGACCCAACCGCCGACAACACTCCAACCCTCTTCCTCAACGCGACGCTCTAC
CGCCCCTTCGGCCTCAACCCGCCCTGCCACCACCGCTACTACCAAGCCTTCGAGTGGCTGATGAGCGACCTGGAC
GGCCGGCCGCACTGGGCGAAGAACTTCTTGGCGGGCAGGGCCGAGGGGCGAGGTTGA
Gene >Ophun1|1749
ATGAACCCTTTAGCGACCAGCCTCGAAAAAGCCACCGGCGATGAAGACGACGGCATCCCGTTCCGGGCTCGGAGA
AACCACGTGCACCGCACATGGGCCGGGACCTTTACCAGCCTCCCCGAGCTCTACATTCAACCCCAGACCATCGCC
GAAGTCGAAAAAGCAGTGAGACTGGCGCAGCAGCGCGGACGACGCATCGTGACGACGGGAAGCGGTCACTCGCCG
TCGAGTCTGACTTGCACGTCAAGCTGGATGCTCAATCTAGACCACCTCTCACGCATCGTCTCCCTCGACAGCCAA
ACAGGCATCGTCGTCGTCGAAGCCGGCATCCGACTCGGAGCCCTCACAGAAACCCTCTCCCGCCACGGCCTCGCG
CTCCCCAACCTAGGAAGCATAGACCAGCAGTCCATCGCCGGCGCGCTGGCAACGGGCACGCACGGAAGCAGTCTC
CGTCACGGGCTCGTCTCCGAGGCAGTCACCGGGTTGCGCATCACGCTGGCGGGCGGCCGCACCGAGAGATGCGAC
GCGCGCGTTCGGCCCGAGTTGTTTCGCGCGGCGTTGCTTTCGCTGGGGGCGTTGGGCGTCGTCGTCGAGGTTACC
ATCCAGGCGGTGCCGGCGTTTGACATTGCGTGGCGGCAGAGGATGGATGCCGAGGCGCGGATGCTGGAGTCGTGG
CGGGAGGGGACCTTGTGGACGCAGGCCGAGTTTGTGCGCGTTTGGTGGTTTCCTTACACGCGGAGGGCTGTTGTC
TGGCGGGGGGATAAGACGGAGAGGGCGGTGACGATGGATGAGGAGCAGAGGGGGAGAGGGGATGGTGCCAAGGGC
TGGTTGGATGGAGTATGGCCGCGGATCAGCTTCAATCTTCATCGTGGACTGCTGTGGCTGGCTCACTGGGTGCCT
TCGGTGCTGCCGACGGTTGAGTGGCTCGTCTTTGGGCTGGAGTATGGCTTCGCGGATGGGACTGAGACTGGGGCA
GTTGAGCCGGGGAGACGGGCCCTGCTGATGGACTGTCTCTACTCGCAGTTCGTCAACGAATGGGCCTTGCCGCTG
CATCGAGGACCGGAGGCTCTGGCCCGGCTTGGAGCCTGGCTTCACGGCCTACCGGCGGAACATCCGGATCACTAC
GGACGGCCGATACCGTTCCCGGTTGCAGGGCTATACGTCCACGCGCCCATCGAGGTGCGCGTCTGCGACACAACA
AAGAGCAAACCACGCCCCCTCCTCGACCCAACCGCCGACAACACTCCAACCCTCTTCCTCAACGCGACGCTCTAC
CGCCCCTTCGGCCTCAACCCGCCCTGCCACCACCGCTACTACCAAGCCTTCGAGTGGCTGATGAGCGACCTGGAC
GGCCGGCCGCACTGGGCGAAGAACTTCTTGGCGGGCAGGGCCGAGGTGGAGGCCATGTACGGCGCGCGGCTGCTG
GAGTTTCGGCGGGTGAGGGGCGAGGTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail