Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|1745
Gene name
LocationContig_176:29588..29944
Strand-
Gene length (bp)356
Transcript length (bp)294
Coding sequence length (bp)294
Protein length (aa) 98

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q09730|SFT1_SCHPO Protein transport protein sft1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sft1 PE=3 SV=1 10 97 3.0E-10
sp|P43682|SFT1_YEAST Protein transport protein SFT1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SFT1 PE=1 SV=1 5 96 2.0E-07
sp|Q9NYM9|BET1L_HUMAN BET1-like protein OS=Homo sapiens GN=BET1L PE=1 SV=1 8 94 4.0E-06
sp|Q5RBX2|BET1L_PONAB BET1-like protein OS=Pongo abelii GN=BET1L PE=3 SV=1 8 94 6.0E-06

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 39 0.45

Transmembrane Domains

Domain # Start End Length
1 73 95 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|1745
MAEAYERERQNNNRLDELSAKVSALRGVTIDIYDNARAQDVIDNTSETFSSMATQLKGSAGRMTRMAAAGNKVAV
LKLSAILVAVFVVVYYALRLFL*
Coding >Ophun1|1745
ATGGCTGAGGCGTACGAGCGCGAGAGGCAGAATAACAACCGGCTGGATGAGCTTTCGGCCAAGGTGTCTGCCCTG
CGGGGCGTGACGATTGACATTTACGACAATGCGCGTGCGCAGGACGTCATCGACAATACCTCGGAGACGTTTTCT
TCCATGGCGACGCAGCTCAAGGGCTCGGCTGGGAGGATGACGCGCATGGCTGCCGCGGGGAACAAGGTGGCCGTC
TTGAAGCTATCCGCCATTCTCGTCGCCGTCTTTGTCGTTGTTTACTACGCTCTCAGGCTGTTTCTTTAG
Transcript >Ophun1|1745
ATGGCTGAGGCGTACGAGCGCGAGAGGCAGAATAACAACCGGCTGGATGAGCTTTCGGCCAAGGTGTCTGCCCTG
CGGGGCGTGACGATTGACATTTACGACAATGCGCGTGCGCAGGACGTCATCGACAATACCTCGGAGACGTTTTCT
TCCATGGCGACGCAGCTCAAGGGCTCGGCTGGGAGGATGACGCGCATGGCTGCCGCGGGGAACAAGGTGGCCGTC
TTGAAGCTATCCGCCATTCTCGTCGCCGTCTTTGTCGTTGTTTACTACGCTCTCAGGCTGTTTCTTTAG
Gene >Ophun1|1745
ATGGCTGAGGCGTACGAGCGCGAGAGGCAGAATAACAACCGGCTGGATGAGCTTTCGGCCAAGGTGTCTGCCCTG
CGGGGCGTGACGATTGACATTTACGACAATGCGCGTGCGCAGGACGTCATCGACAATACCGTTTGTTTTCCCCCT
CTCTCTCTTGTTGGAAGGCTTCTCTGGCTGACGGTGATGCTGCAAAGTCGGAGACGTTTTCTTCCATGGCGACGC
AGCTCAAGGGCTCGGCTGGGAGGATGACGCGCATGGCTGCCGCGGGGAACAAGGTGGCCGTCTTGAAGCTATCCG
CCATTCTCGTCGCCGTCTTTGTCGTTGTTTACTACGCTCTCAGGCTGTTTCTTTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail