Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|1743
Gene name
LocationContig_176:24601..27145
Strand-
Gene length (bp)2544
Transcript length (bp)1794
Coding sequence length (bp)1794
Protein length (aa) 598

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00108 Thiolase_N Thiolase, N-terminal domain 3.1E-69 212 467
PF01641 SelR SelR domain 6.5E-42 67 181
PF02803 Thiolase_C Thiolase, C-terminal domain 1.9E-41 476 593

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q05493|THIK_YARLI 3-ketoacyl-CoA thiolase, peroxisomal OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=POT1 PE=3 SV=1 182 597 2.0E-148
sp|P33291|THIKB_CANTR 3-ketoacyl-CoA thiolase B, peroxisomal OS=Candida tropicalis PE=3 SV=1 182 597 3.0E-125
sp|Q56WD9|THIK2_ARATH 3-ketoacyl-CoA thiolase 2, peroxisomal OS=Arabidopsis thaliana GN=PED1 PE=1 SV=2 210 594 3.0E-124
sp|P27796|THIK_YEAST 3-ketoacyl-CoA thiolase, peroxisomal OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=POT1 PE=1 SV=1 183 597 2.0E-123
sp|P07871|THIKB_RAT 3-ketoacyl-CoA thiolase B, peroxisomal OS=Rattus norvegicus GN=Acaa1b PE=1 SV=2 206 594 8.0E-122
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q05493|THIK_YARLI 3-ketoacyl-CoA thiolase, peroxisomal OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=POT1 PE=3 SV=1 182 597 2.0E-148
sp|P33291|THIKB_CANTR 3-ketoacyl-CoA thiolase B, peroxisomal OS=Candida tropicalis PE=3 SV=1 182 597 3.0E-125
sp|Q56WD9|THIK2_ARATH 3-ketoacyl-CoA thiolase 2, peroxisomal OS=Arabidopsis thaliana GN=PED1 PE=1 SV=2 210 594 3.0E-124
sp|P27796|THIK_YEAST 3-ketoacyl-CoA thiolase, peroxisomal OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=POT1 PE=1 SV=1 183 597 2.0E-123
sp|P07871|THIKB_RAT 3-ketoacyl-CoA thiolase B, peroxisomal OS=Rattus norvegicus GN=Acaa1b PE=1 SV=2 206 594 8.0E-122
sp|P21775|THIKA_RAT 3-ketoacyl-CoA thiolase A, peroxisomal OS=Rattus norvegicus GN=Acaa1a PE=1 SV=2 206 594 2.0E-121
sp|Q8LF48|THIK1_ARATH 3-ketoacyl-CoA thiolase 1, peroxisomal OS=Arabidopsis thaliana GN=KAT1 PE=2 SV=2 210 594 2.0E-121
sp|P33290|THIKA_CANTR 3-ketoacyl-CoA thiolase A, peroxisomal OS=Candida tropicalis PE=3 SV=1 182 597 2.0E-120
sp|Q8VCH0|THIKB_MOUSE 3-ketoacyl-CoA thiolase B, peroxisomal OS=Mus musculus GN=Acaa1b PE=1 SV=1 204 594 2.0E-119
sp|Q921H8|THIKA_MOUSE 3-ketoacyl-CoA thiolase A, peroxisomal OS=Mus musculus GN=Acaa1a PE=1 SV=1 203 594 2.0E-119
sp|P09110|THIK_HUMAN 3-ketoacyl-CoA thiolase, peroxisomal OS=Homo sapiens GN=ACAA1 PE=1 SV=2 211 594 4.0E-119
sp|Q570C8|THIK5_ARATH 3-ketoacyl-CoA thiolase 5, peroxisomal OS=Arabidopsis thaliana GN=KAT5 PE=2 SV=2 210 594 5.0E-115
sp|O32177|FADA_BACSU 3-ketoacyl-CoA thiolase OS=Bacillus subtilis (strain 168) GN=fadA PE=2 SV=1 211 594 6.0E-83
sp|B6EGU1|FADA_ALISL 3-ketoacyl-CoA thiolase OS=Aliivibrio salmonicida (strain LFI1238) GN=fadA PE=3 SV=1 211 594 2.0E-76
sp|Q8CQN7|THLA_STAES Probable acetyl-CoA acyltransferase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=SE_2384 PE=3 SV=1 228 593 8.0E-74
sp|Q5HS07|THLA_STAEQ Probable acetyl-CoA acyltransferase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=SERP0032 PE=3 SV=1 228 593 8.0E-74
sp|Q18AR0|THLA_PEPD6 Acetyl-CoA acetyltransferase OS=Peptoclostridium difficile (strain 630) GN=thlA PE=1 SV=1 211 593 2.0E-73
sp|Q5E8X7|FADA_VIBF1 3-ketoacyl-CoA thiolase OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=fadA PE=3 SV=2 211 594 3.0E-73
sp|P07097|THIL_ZOORA Acetyl-CoA acetyltransferase OS=Zoogloea ramigera GN=phbA PE=1 SV=4 213 591 1.0E-72
sp|B5FEW7|FADA_VIBFM 3-ketoacyl-CoA thiolase OS=Vibrio fischeri (strain MJ11) GN=fadA PE=3 SV=1 211 594 1.0E-72
sp|Q8SVA6|THIK_ENCCU 3-ketoacyl-CoA thiolase, peroxisomal OS=Encephalitozoon cuniculi (strain GB-M1) GN=FOX3 PE=1 SV=1 210 594 1.0E-72
sp|Q5HIU0|THLA_STAAC Probable acetyl-CoA acyltransferase OS=Staphylococcus aureus (strain COL) GN=SACOL0426 PE=3 SV=1 212 593 9.0E-71
sp|Q2G124|THLA_STAA8 Probable acetyl-CoA acyltransferase OS=Staphylococcus aureus (strain NCTC 8325) GN=SAOUHSC_00336 PE=3 SV=1 212 593 3.0E-70
sp|Q2FJQ9|THLA_STAA3 Probable acetyl-CoA acyltransferase OS=Staphylococcus aureus (strain USA300) GN=SAUSA300_0355 PE=3 SV=1 212 593 3.0E-70
sp|Q6GJW4|THLA_STAAR Probable acetyl-CoA acyltransferase OS=Staphylococcus aureus (strain MRSA252) GN=SAR0351 PE=3 SV=1 212 593 3.0E-70
sp|Q8NY95|THLA_STAAW Probable acetyl-CoA acyltransferase OS=Staphylococcus aureus (strain MW2) GN=MW0330 PE=3 SV=1 212 593 4.0E-70
sp|Q6GCB8|THLA_STAAS Probable acetyl-CoA acyltransferase OS=Staphylococcus aureus (strain MSSA476) GN=SAS0330 PE=3 SV=1 212 593 4.0E-70
sp|P45363|THIL_THIVI Acetyl-CoA acetyltransferase OS=Thiocystis violacea GN=phbA PE=3 SV=1 209 591 1.0E-69
sp|Q7A7L2|THLA_STAAN Probable acetyl-CoA acyltransferase OS=Staphylococcus aureus (strain N315) GN=SA0342 PE=1 SV=1 212 593 2.0E-69
sp|Q99WM3|THLA_STAAM Probable acetyl-CoA acyltransferase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=SAV0354 PE=3 SV=1 212 593 2.0E-69
sp|Q9I2A8|ATOB_PSEAE Acetyl-CoA acetyltransferase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=atoB PE=3 SV=1 211 591 3.0E-69
sp|P45369|THIL_ALLVD Acetyl-CoA acetyltransferase OS=Allochromatium vinosum (strain ATCC 17899 / DSM 180 / NBRC 103801 / NCIMB 10441 / D) GN=phbA PE=3 SV=2 209 591 4.0E-69
sp|Q2YVF5|THLA_STAAB Probable acetyl-CoA acyltransferase OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=SAB0304 PE=3 SV=1 212 593 5.0E-69
sp|P50174|THIL_RHIME Acetyl-CoA acetyltransferase OS=Rhizobium meliloti (strain 1021) GN=phbA PE=3 SV=1 212 591 1.0E-68
sp|A1TZR8|FADA_MARHV 3-ketoacyl-CoA thiolase OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=fadA PE=3 SV=1 227 594 1.0E-67
sp|A7MQM5|FADA_CROS8 3-ketoacyl-CoA thiolase OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=fadA PE=3 SV=1 210 594 3.0E-67
sp|Q2SD23|FADA_HAHCH 3-ketoacyl-CoA thiolase OS=Hahella chejuensis (strain KCTC 2396) GN=fadA PE=3 SV=1 211 594 4.0E-67
sp|P45359|THLA_CLOAB Acetyl-CoA acetyltransferase OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=thlA PE=1 SV=1 211 591 5.0E-67
sp|Q5QXH8|FADA_IDILO 3-ketoacyl-CoA thiolase OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=fadA PE=3 SV=1 211 594 1.0E-66
sp|P54810|THIL_PARDE Acetyl-CoA acetyltransferase OS=Paracoccus denitrificans GN=phaA PE=3 SV=1 228 591 1.0E-66
sp|A6VVM8|FADA_MARMS 3-ketoacyl-CoA thiolase OS=Marinomonas sp. (strain MWYL1) GN=fadA PE=3 SV=1 210 594 1.0E-66
sp|A8ACZ3|FADA_CITK8 3-ketoacyl-CoA thiolase OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=fadA PE=3 SV=1 210 594 2.0E-66
sp|P44873|ATOB_HAEIN Acetyl-CoA acetyltransferase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=atoB PE=3 SV=1 210 593 2.0E-66
sp|Q3YVC2|FADA_SHISS 3-ketoacyl-CoA thiolase OS=Shigella sonnei (strain Ss046) GN=fadA PE=3 SV=1 210 594 8.0E-66
sp|Q31UE3|FADA_SHIBS 3-ketoacyl-CoA thiolase OS=Shigella boydii serotype 4 (strain Sb227) GN=fadA PE=3 SV=1 210 594 8.0E-66
sp|P14611|THIL_CUPNH Acetyl-CoA acetyltransferase OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=phbA PE=1 SV=1 211 591 2.0E-65
sp|P0A2H7|FADA_SALTY 3-ketoacyl-CoA thiolase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=fadA PE=1 SV=1 210 594 2.0E-65
sp|P0A2H8|FADA_SALTI 3-ketoacyl-CoA thiolase OS=Salmonella typhi GN=fadA PE=3 SV=1 210 594 2.0E-65
sp|Q5PKQ3|FADA_SALPA 3-ketoacyl-CoA thiolase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=fadA PE=3 SV=1 210 594 2.0E-65
sp|A6TGM3|FADA_KLEP7 3-ketoacyl-CoA thiolase OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=fadA PE=3 SV=1 210 594 2.0E-65
sp|Q57HM7|FADA_SALCH 3-ketoacyl-CoA thiolase OS=Salmonella choleraesuis (strain SC-B67) GN=fadA PE=3 SV=1 210 594 2.0E-65
sp|B7LTZ0|FADA_ESCF3 3-ketoacyl-CoA thiolase OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=fadA PE=3 SV=1 210 594 3.0E-65
sp|A7ZU50|FADA_ECO24 3-ketoacyl-CoA thiolase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=fadA PE=3 SV=1 210 594 3.0E-65
sp|A8G8D0|FADA_SERP5 3-ketoacyl-CoA thiolase OS=Serratia proteamaculans (strain 568) GN=fadA PE=3 SV=1 210 594 6.0E-65
sp|Q6LW07|FADA_PHOPR 3-ketoacyl-CoA thiolase OS=Photobacterium profundum GN=fadA PE=3 SV=1 210 594 6.0E-65
sp|Q9BWD1|THIC_HUMAN Acetyl-CoA acetyltransferase, cytosolic OS=Homo sapiens GN=ACAT2 PE=1 SV=2 209 591 6.0E-65
sp|A8A6V0|FADA_ECOHS 3-ketoacyl-CoA thiolase OS=Escherichia coli O9:H4 (strain HS) GN=fadA PE=3 SV=1 210 594 7.0E-65
sp|Q9ZHI1|THIL_CHRVO Acetyl-CoA acetyltransferase OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=phaA PE=3 SV=2 211 591 8.0E-65
sp|Q9F0Y6|FADA_ENTCL 3-ketoacyl-CoA thiolase OS=Enterobacter cloacae GN=fadA PE=3 SV=1 210 594 1.0E-64
sp|Q8X8J4|FADA_ECO57 3-ketoacyl-CoA thiolase OS=Escherichia coli O157:H7 GN=fadA PE=3 SV=1 210 594 1.0E-64
sp|Q1R467|FADA_ECOUT 3-ketoacyl-CoA thiolase OS=Escherichia coli (strain UTI89 / UPEC) GN=fadA PE=3 SV=1 210 594 2.0E-64
sp|A1AI32|FADA_ECOK1 3-ketoacyl-CoA thiolase OS=Escherichia coli O1:K1 / APEC GN=fadA PE=3 SV=1 210 594 2.0E-64
sp|P21151|FADA_ECOLI 3-ketoacyl-CoA thiolase OS=Escherichia coli (strain K12) GN=fadA PE=1 SV=3 210 594 2.0E-64
sp|Q83PG2|FADA_SHIFL 3-ketoacyl-CoA thiolase OS=Shigella flexneri GN=fadA PE=3 SV=1 210 594 3.0E-64
sp|Q0SZ35|FADA_SHIF8 3-ketoacyl-CoA thiolase OS=Shigella flexneri serotype 5b (strain 8401) GN=fadA PE=3 SV=1 210 594 3.0E-64
sp|Q3K9D9|FADA_PSEPF 3-ketoacyl-CoA thiolase OS=Pseudomonas fluorescens (strain Pf0-1) GN=fadA PE=3 SV=1 211 594 5.0E-64
sp|Q4KFC3|FADA_PSEF5 3-ketoacyl-CoA thiolase OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=fadA PE=3 SV=1 211 594 5.0E-64
sp|Q8FBI3|FADA_ECOL6 3-ketoacyl-CoA thiolase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=fadA PE=3 SV=1 210 594 5.0E-64
sp|A4WFX5|FADA_ENT38 3-ketoacyl-CoA thiolase OS=Enterobacter sp. (strain 638) GN=fadA PE=3 SV=1 210 594 6.0E-64
sp|Q32A20|FADA_SHIDS 3-ketoacyl-CoA thiolase OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=fadA PE=3 SV=1 210 594 7.0E-64
sp|A0KEL0|FADA_AERHH 3-ketoacyl-CoA thiolase OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=fadA PE=3 SV=1 211 594 2.0E-63
sp|Q0TAL1|FADA_ECOL5 3-ketoacyl-CoA thiolase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=fadA PE=3 SV=1 210 594 3.0E-63
sp|P76461|ATOB_ECOLI Acetyl-CoA acetyltransferase OS=Escherichia coli (strain K12) GN=atoB PE=1 SV=1 211 593 6.0E-63
sp|Q0KBP1|BKTB_CUPNH Beta-ketothiolase BktB OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=bktB PE=1 SV=1 211 594 6.0E-63
sp|Q1Q8K0|FADA_PSYCK 3-ketoacyl-CoA thiolase OS=Psychrobacter cryohalolentis (strain K5) GN=fadA PE=3 SV=1 211 593 7.0E-63
sp|A4Y1B5|FADA_SHEPC 3-ketoacyl-CoA thiolase OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=fadA PE=3 SV=1 213 594 1.0E-62
sp|A6WH99|FADA_SHEB8 3-ketoacyl-CoA thiolase OS=Shewanella baltica (strain OS185) GN=fadA PE=3 SV=1 213 594 1.0E-62
sp|Q0VNZ7|FADA_ALCBS 3-ketoacyl-CoA thiolase OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=fadA PE=3 SV=1 211 593 1.0E-62
sp|Q8EKS0|FADA_SHEON 3-ketoacyl-CoA thiolase OS=Shewanella oneidensis (strain MR-1) GN=fadA PE=3 SV=1 213 594 1.0E-62
sp|Q4ZRA1|FADA_PSEU2 3-ketoacyl-CoA thiolase OS=Pseudomonas syringae pv. syringae (strain B728a) GN=fadA PE=3 SV=1 211 594 2.0E-62
sp|Q0HPB8|FADA_SHESM 3-ketoacyl-CoA thiolase OS=Shewanella sp. (strain MR-4) GN=fadA PE=3 SV=1 213 594 2.0E-62
sp|Q4FQC7|FADA_PSYA2 3-ketoacyl-CoA thiolase OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=fadA PE=3 SV=1 211 593 3.0E-62
sp|P28790|FADA_PSEFR 3-ketoacyl-CoA thiolase OS=Pseudomonas fragi GN=fadA PE=1 SV=2 211 594 3.0E-62
sp|Q87ZB3|FADA_PSESM 3-ketoacyl-CoA thiolase OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=fadA PE=3 SV=1 211 594 4.0E-62
sp|A0KR49|FADA_SHESA 3-ketoacyl-CoA thiolase OS=Shewanella sp. (strain ANA-3) GN=fadA PE=3 SV=1 213 594 4.0E-62
sp|Q0I0T4|FADA_SHESR 3-ketoacyl-CoA thiolase OS=Shewanella sp. (strain MR-7) GN=fadA PE=3 SV=1 213 594 5.0E-62
sp|A3CYJ3|FADA_SHEB5 3-ketoacyl-CoA thiolase OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=fadA PE=3 SV=1 213 594 8.0E-62
sp|Q12TB5|FADA_SHEDO 3-ketoacyl-CoA thiolase OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=fadA PE=3 SV=1 213 594 8.0E-62
sp|B2VFE0|FADA_ERWT9 3-ketoacyl-CoA thiolase OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=fadA PE=3 SV=1 210 594 9.0E-62
sp|A1RDW3|FADA_SHESW 3-ketoacyl-CoA thiolase OS=Shewanella sp. (strain W3-18-1) GN=fadA PE=3 SV=1 213 594 1.0E-61
sp|A1JIG3|FADA_YERE8 3-ketoacyl-CoA thiolase OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=fadA PE=3 SV=1 210 594 1.0E-61
sp|Q6DAP6|FADA_PECAS 3-ketoacyl-CoA thiolase OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=fadA PE=3 SV=1 210 594 3.0E-61
sp|C6DI66|FADA_PECCP 3-ketoacyl-CoA thiolase OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=fadA PE=3 SV=1 210 594 4.0E-61
sp|Q48GW4|FADA_PSE14 3-ketoacyl-CoA thiolase OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=fadA PE=3 SV=1 211 594 5.0E-61
sp|A4STF3|FADA_AERS4 3-ketoacyl-CoA thiolase OS=Aeromonas salmonicida (strain A449) GN=fadA PE=3 SV=1 211 594 8.0E-61
sp|Q3IJ24|FADA_PSEHT 3-ketoacyl-CoA thiolase OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=fadA PE=3 SV=1 210 594 1.0E-60
sp|Q02PH7|FADA_PSEAB 3-ketoacyl-CoA thiolase OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=fadA PE=3 SV=1 211 594 1.0E-60
sp|A6V383|FADA_PSEA7 3-ketoacyl-CoA thiolase OS=Pseudomonas aeruginosa (strain PA7) GN=fadA PE=3 SV=1 211 594 1.0E-60
sp|Q9HZJ3|FADA_PSEAE 3-ketoacyl-CoA thiolase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=fadA PE=3 SV=1 211 594 2.0E-60
sp|P0C7L2|PAAJ_ECOLI 3-oxoadipyl-CoA/3-oxo-5,6-dehydrosuberyl-CoA thiolase OS=Escherichia coli (strain K12) GN=paaJ PE=1 SV=1 228 594 2.0E-60
sp|A0R1Y7|FADA4_MYCS2 Probable acetyl-CoA acetyltransferase OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=MSMEG_4920 PE=1 SV=2 213 589 2.0E-60
sp|Q9I6R0|PCAF_PSEAE Beta-ketoadipyl-CoA thiolase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=pcaF PE=3 SV=1 209 591 3.0E-60
sp|P0C7L3|PAAJ_ECOLX Beta-ketoadipyl-CoA thiolase OS=Escherichia coli GN=paaJ PE=3 SV=1 228 594 4.0E-60
sp|Q87TP0|FADA_VIBPA 3-ketoacyl-CoA thiolase OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=fadA PE=3 SV=1 205 594 4.0E-60
sp|Q8DDK5|FADA_VIBVU 3-ketoacyl-CoA thiolase OS=Vibrio vulnificus (strain CMCP6) GN=fadA PE=3 SV=1 211 594 6.0E-60
sp|Q7MQI0|FADA_VIBVY 3-ketoacyl-CoA thiolase OS=Vibrio vulnificus (strain YJ016) GN=fadA PE=3 SV=1 211 594 7.0E-60
sp|Q66FR9|FADA_YERPS 3-ketoacyl-CoA thiolase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=fadA PE=3 SV=1 210 594 1.0E-59
sp|A4TR28|FADA_YERPP 3-ketoacyl-CoA thiolase OS=Yersinia pestis (strain Pestoides F) GN=fadA PE=3 SV=1 210 594 1.0E-59
sp|Q1CNA0|FADA_YERPN 3-ketoacyl-CoA thiolase OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=fadA PE=3 SV=1 210 594 1.0E-59
sp|Q8ZAM9|FADA_YERPE 3-ketoacyl-CoA thiolase OS=Yersinia pestis GN=fadA PE=3 SV=1 210 594 1.0E-59
sp|Q1C2C3|FADA_YERPA 3-ketoacyl-CoA thiolase OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=fadA PE=3 SV=1 210 594 1.0E-59
sp|A7FDF1|FADA_YERP3 3-ketoacyl-CoA thiolase OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=fadA PE=3 SV=1 210 594 1.0E-59
sp|A4XSM9|FADA_PSEMY 3-ketoacyl-CoA thiolase OS=Pseudomonas mendocina (strain ymp) GN=fadA PE=3 SV=1 211 594 1.0E-59
sp|Q08A40|FADA_SHEFN 3-ketoacyl-CoA thiolase OS=Shewanella frigidimarina (strain NCIMB 400) GN=fadA PE=3 SV=1 213 594 2.0E-59
sp|Q489W4|FADA_COLP3 3-ketoacyl-CoA thiolase OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=fadA PE=3 SV=1 210 594 2.0E-59
sp|A3Q8U3|FADA_SHELP 3-ketoacyl-CoA thiolase OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=fadA PE=3 SV=1 213 594 3.0E-59
sp|Q21KB1|FADA_SACD2 3-ketoacyl-CoA thiolase OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=fadA PE=3 SV=1 211 593 4.0E-59
sp|A5WH98|FADA_PSYWF 3-ketoacyl-CoA thiolase OS=Psychrobacter sp. (strain PRwf-1) GN=fadA PE=3 SV=1 211 593 5.0E-59
sp|A5W6G9|FADA_PSEP1 3-ketoacyl-CoA thiolase OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=fadA PE=3 SV=1 211 594 6.0E-59
sp|Q8CAY6|THIC_MOUSE Acetyl-CoA acetyltransferase, cytosolic OS=Mus musculus GN=Acat2 PE=1 SV=2 209 591 7.0E-59
sp|Q9R9W0|FADA_PSEPU 3-ketoacyl-CoA thiolase OS=Pseudomonas putida GN=fadA PE=3 SV=1 211 594 7.0E-59
sp|Q88L01|FADA_PSEPK 3-ketoacyl-CoA thiolase OS=Pseudomonas putida (strain KT2440) GN=fadA PE=3 SV=1 211 594 7.0E-59
sp|Q1I7D5|FADA_PSEE4 3-ketoacyl-CoA thiolase OS=Pseudomonas entomophila (strain L48) GN=fadA PE=3 SV=1 211 594 8.0E-59
sp|Q93Q11|FADA_PSEOL 3-ketoacyl-CoA thiolase OS=Pseudomonas oleovorans GN=fadA PE=3 SV=1 211 594 1.0E-58
sp|Q1QUW9|FADA_CHRSD 3-ketoacyl-CoA thiolase OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=fadA PE=3 SV=1 211 594 4.0E-58
sp|A1S1I7|FADA_SHEAM 3-ketoacyl-CoA thiolase OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=fadA PE=3 SV=1 213 594 6.0E-58
sp|Q9KNI0|FADA_VIBCH 3-ketoacyl-CoA thiolase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=fadA PE=3 SV=1 210 594 6.0E-58
sp|Q5XI22|THIC_RAT Acetyl-CoA acetyltransferase, cytosolic OS=Rattus norvegicus GN=Acat2 PE=1 SV=1 209 591 1.0E-57
sp|A5F464|FADA_VIBC3 3-ketoacyl-CoA thiolase OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=fadA PE=3 SV=1 210 594 1.0E-57
sp|Q7MZ91|FADA_PHOLL 3-ketoacyl-CoA thiolase OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=fadA PE=3 SV=1 210 593 1.0E-57
sp|B0VE46|FADA_ACIBY 3-ketoacyl-CoA thiolase OS=Acinetobacter baumannii (strain AYE) GN=fadA PE=3 SV=1 211 593 2.0E-56
sp|B0VLX5|FADA_ACIBS 3-ketoacyl-CoA thiolase OS=Acinetobacter baumannii (strain SDF) GN=fadA PE=3 SV=1 211 593 2.0E-56
sp|B2I2J8|FADA_ACIBC 3-ketoacyl-CoA thiolase OS=Acinetobacter baumannii (strain ACICU) GN=fadA PE=3 SV=1 211 593 2.0E-56
sp|B7I3P0|FADA_ACIB5 3-ketoacyl-CoA thiolase OS=Acinetobacter baumannii (strain AB0057) GN=fadA PE=3 SV=1 211 593 2.0E-56
sp|B7H1I1|FADA_ACIB3 3-ketoacyl-CoA thiolase OS=Acinetobacter baumannii (strain AB307-0294) GN=fadA PE=3 SV=1 211 593 2.0E-56
sp|Q51956|PCAF_PSEPU Beta-ketoadipyl-CoA thiolase OS=Pseudomonas putida GN=pcaF PE=3 SV=1 276 591 3.0E-56
sp|Q8BWT1|THIM_MOUSE 3-ketoacyl-CoA thiolase, mitochondrial OS=Mus musculus GN=Acaa2 PE=1 SV=3 212 593 3.0E-56
sp|P13437|THIM_RAT 3-ketoacyl-CoA thiolase, mitochondrial OS=Rattus norvegicus GN=Acaa2 PE=2 SV=1 212 593 3.0E-56
sp|Q15ZF4|FADA_PSEA6 3-ketoacyl-CoA thiolase OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=fadA PE=3 SV=1 211 594 8.0E-56
sp|A3M1H9|FADA_ACIBT 3-ketoacyl-CoA thiolase OS=Acinetobacter baumannii (strain ATCC 17978 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377) GN=fadA PE=3 SV=2 211 593 1.0E-55
sp|P45855|THL_BACSU Acetyl-CoA acetyltransferase OS=Bacillus subtilis (strain 168) GN=mmgA PE=2 SV=2 213 589 1.0E-55
sp|A4VKA4|FADA_PSEU5 3-ketoacyl-CoA thiolase OS=Pseudomonas stutzeri (strain A1501) GN=fadA PE=3 SV=1 211 594 2.0E-55
sp|Q86AD9|THIL1_DICDI Probable acetyl-CoA acetyltransferase OS=Dictyostelium discoideum GN=DDB_G0271544 PE=2 SV=1 185 587 2.0E-55
sp|Q6FF69|FADA_ACIAD 3-ketoacyl-CoA thiolase OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=fadA PE=3 SV=1 211 593 1.0E-54
sp|Q3T0R7|THIM_BOVIN 3-ketoacyl-CoA thiolase, mitochondrial OS=Bos taurus GN=ACAA2 PE=2 SV=1 212 593 1.0E-54
sp|P42765|THIM_HUMAN 3-ketoacyl-CoA thiolase, mitochondrial OS=Homo sapiens GN=ACAA2 PE=1 SV=2 212 593 3.0E-54
sp|Q43935|CATF_ACIAD Beta-ketoadipyl-CoA thiolase OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=catF PE=3 SV=1 214 593 6.0E-54
sp|Q5RES5|THIM_PONAB 3-ketoacyl-CoA thiolase, mitochondrial OS=Pongo abelii GN=ACAA2 PE=2 SV=1 212 593 6.0E-54
sp|Q46939|YQEF_ECOLI Probable acetyl-CoA acetyltransferase OS=Escherichia coli (strain K12) GN=yqeF PE=3 SV=2 211 591 7.0E-54
sp|Q8VPF1|PCAF_PSEKB Beta-ketoadipyl-CoA thiolase OS=Pseudomonas knackmussii (strain DSM 6978 / LMG 23759 / B13) GN=pcaF PE=1 SV=1 215 591 2.0E-53
sp|Q43974|PCAF_ACIAD Beta-ketoadipyl-CoA thiolase OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=pcaF PE=1 SV=1 214 593 4.0E-53
sp|Q9FIK7|THIC2_ARATH Probable acetyl-CoA acetyltransferase, cytosolic 2 OS=Arabidopsis thaliana GN=At5g47720 PE=2 SV=1 211 593 1.0E-52
sp|Q9UQW6|THIL_SCHPO Acetyl-CoA acetyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=erg10 PE=2 SV=1 211 595 1.0E-52
sp|Q9Y7K1|YGL4_SCHPO Uncharacterized protein C216.04c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC216.04c PE=3 SV=1 57 181 5.0E-52
sp|O53871|Y0859_MYCTU Putative acyltransferase Rv0859 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=fadA PE=1 SV=1 209 593 9.0E-52
sp|P46707|FADA4_MYCLE Probable acetyl-CoA acetyltransferase OS=Mycobacterium leprae (strain TN) GN=fadA4 PE=3 SV=1 213 589 1.0E-50
sp|Q6L8K7|THIL_YARLI Acetyl-CoA acetyltransferase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=PAT1 PE=3 SV=1 203 593 3.0E-50
sp|Q22100|THILH_CAEEL Acetyl-CoA acetyltransferase homolog, mitochondrial OS=Caenorhabditis elegans GN=kat-1 PE=1 SV=2 235 587 6.0E-49
sp|P9WG69|FADA4_MYCTU Probable acetyl-CoA acetyltransferase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=fadA4 PE=1 SV=1 213 589 9.0E-49
sp|P9WG68|FADA4_MYCTO Probable acetyl-CoA acetyltransferase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=fadA4 PE=3 SV=1 213 589 9.0E-49
sp|P66927|FADA4_MYCBO Probable acetyl-CoA acetyltransferase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=fadA4 PE=3 SV=1 213 589 9.0E-49
sp|Q8S4Y1|THIC1_ARATH Acetyl-CoA acetyltransferase, cytosolic 1 OS=Arabidopsis thaliana GN=AAT1 PE=2 SV=1 211 575 1.0E-48
sp|Q12598|THIA_CANTR Acetyl-CoA acetyltransferase IA OS=Candida tropicalis GN=PACTA PE=1 SV=3 257 595 4.0E-48
sp|Q10L32|MSRB5_ORYSJ Peptide methionine sulfoxide reductase B5 OS=Oryza sativa subsp. japonica GN=MSRB5 PE=2 SV=1 62 182 2.0E-47
sp|Q9C5C8|MSRB2_ARATH Peptide methionine sulfoxide reductase B2, chloroplastic OS=Arabidopsis thaliana GN=MSRB2 PE=1 SV=1 62 182 3.0E-47
sp|Q04677|THIB_CANTR Acetyl-CoA acetyltransferase IB OS=Candida tropicalis GN=PACTB PE=1 SV=3 257 595 4.0E-47
sp|Q5HRH3|VRAB_STAEQ Putative acetyl-CoA C-acetyltransferase VraB OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=vraB PE=3 SV=1 213 568 6.0E-47
sp|Q8CTR0|VRAB_STAES Putative acetyl-CoA C-acetyltransferase VraB OS=Staphylococcus epidermidis (strain ATCC 12228) GN=vraB PE=3 SV=1 213 568 7.0E-47
sp|A6WQ26|FADI_SHEB8 3-ketoacyl-CoA thiolase OS=Shewanella baltica (strain OS185) GN=fadI PE=3 SV=1 199 597 1.0E-46
sp|Q9M0Z6|MSRB3_ARATH Peptide methionine sulfoxide reductase B3 OS=Arabidopsis thaliana GN=MSRB3 PE=2 SV=2 52 182 1.0E-46
sp|A9KTW7|FADI_SHEB9 3-ketoacyl-CoA thiolase OS=Shewanella baltica (strain OS195) GN=fadI PE=3 SV=1 199 597 2.0E-46
sp|A3D685|FADI_SHEB5 3-ketoacyl-CoA thiolase OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=fadI PE=3 SV=1 199 597 2.0E-46
sp|B8EE97|FADI_SHEB2 3-ketoacyl-CoA thiolase OS=Shewanella baltica (strain OS223) GN=fadI PE=3 SV=1 199 597 2.0E-46
sp|Q9ZS91|MSRB5_ARATH Peptide methionine sulfoxide reductase B5 OS=Arabidopsis thaliana GN=MSRB5 PE=1 SV=1 62 182 4.0E-46
sp|A1RI91|FADI_SHESW 3-ketoacyl-CoA thiolase OS=Shewanella sp. (strain W3-18-1) GN=fadI PE=3 SV=1 199 597 7.0E-46
sp|A4Y898|FADI_SHEPC 3-ketoacyl-CoA thiolase OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=fadI PE=3 SV=1 199 597 9.0E-46
sp|Q6AZA0|THIL_DANRE Acetyl-CoA acetyltransferase, mitochondrial OS=Danio rerio GN=acat1 PE=2 SV=1 210 595 1.0E-45
sp|A8FTR6|FADI_SHESH 3-ketoacyl-CoA thiolase OS=Shewanella sediminis (strain HAW-EB3) GN=fadI PE=3 SV=1 199 581 1.0E-45
sp|B8CPY7|FADI_SHEPW 3-ketoacyl-CoA thiolase OS=Shewanella piezotolerans (strain WP3 / JCM 13877) GN=fadI PE=3 SV=1 199 578 1.0E-45
sp|P41338|THIL_YEAST Acetyl-CoA acetyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ERG10 PE=1 SV=3 258 593 2.0E-45
sp|Q6AUK5|MSRB3_ORYSJ Peptide methionine sulfoxide reductase B3, chloroplastic OS=Oryza sativa subsp. japonica GN=MSRB3 PE=2 SV=1 62 182 7.0E-45
sp|P10551|THIL_SACMO Acetyl-CoA acetyltransferase OS=Saccharomyces pastorianus (strain ATCC 76670 / Carlsberg bottom yeast no.2 / CBS 1503 / CLIB 180 / NBRC 10610 / NRRL Y-1525) GN=ERG10 PE=3 SV=1 258 593 8.0E-45
sp|P17764|THIL_RAT Acetyl-CoA acetyltransferase, mitochondrial OS=Rattus norvegicus GN=Acat1 PE=1 SV=1 200 595 9.0E-45
sp|Q6NU46|THILA_XENLA Acetyl-CoA acetyltransferase A, mitochondrial OS=Xenopus laevis GN=acat1-a PE=2 SV=1 189 595 1.0E-44
sp|A8GH87|FADI_SERP5 3-ketoacyl-CoA thiolase OS=Serratia proteamaculans (strain 568) GN=fadI PE=3 SV=1 204 581 1.0E-44
sp|Q8QZT1|THIL_MOUSE Acetyl-CoA acetyltransferase, mitochondrial OS=Mus musculus GN=Acat1 PE=1 SV=1 210 595 1.0E-44
sp|Q29RZ0|THIL_BOVIN Acetyl-CoA acetyltransferase, mitochondrial OS=Bos taurus GN=ACAT1 PE=2 SV=1 210 595 2.0E-44
sp|B0TL22|FADI_SHEHH 3-ketoacyl-CoA thiolase OS=Shewanella halifaxensis (strain HAW-EB4) GN=fadI PE=3 SV=1 199 578 3.0E-44
sp|Q9M0Z5|MSRB4_ARATH Peptide methionine sulfoxide reductase B4 OS=Arabidopsis thaliana GN=MSRB4 PE=2 SV=1 62 182 4.0E-44
sp|A1S7L7|FADI_SHEAM 3-ketoacyl-CoA thiolase OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=fadI PE=3 SV=1 199 581 5.0E-44
sp|O07618|YHFS_BACSU Putative acetyl-CoA C-acetyltransferase YhfS OS=Bacillus subtilis (strain 168) GN=yhfS PE=2 SV=1 211 572 5.0E-44
sp|Q07ZP7|FADI_SHEFN 3-ketoacyl-CoA thiolase OS=Shewanella frigidimarina (strain NCIMB 400) GN=fadI PE=3 SV=1 199 578 6.0E-44
sp|O49707|MSRB8_ARATH Peptide methionine sulfoxide reductase B8 OS=Arabidopsis thaliana GN=MSRB8 PE=2 SV=1 62 182 8.0E-44
sp|Q6GN02|THILB_XENLA Acetyl-CoA acetyltransferase B, mitochondrial OS=Xenopus laevis GN=acat1-b PE=2 SV=1 189 595 8.0E-44
sp|Q12P12|FADI_SHEDO 3-ketoacyl-CoA thiolase OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=fadI PE=3 SV=1 199 578 1.0E-43
sp|Q3IEE3|FADI_PSEHT 3-ketoacyl-CoA thiolase OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=fadI PE=3 SV=1 208 574 1.0E-43
sp|A8H5T2|FADI_SHEPA 3-ketoacyl-CoA thiolase OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=fadI PE=3 SV=1 199 578 2.0E-43
sp|Q5BKN8|THIL_XENTR Acetyl-CoA acetyltransferase, mitochondrial OS=Xenopus tropicalis GN=acat1 PE=2 SV=1 181 595 2.0E-43
sp|Q8VY86|MSRB7_ARATH Peptide methionine sulfoxide reductase B7 OS=Arabidopsis thaliana GN=MSRB7 PE=2 SV=1 62 182 3.0E-43
sp|Q8GWF4|MSRB6_ARATH Peptide methionine sulfoxide reductase B6 OS=Arabidopsis thaliana GN=MSRB6 PE=2 SV=1 62 182 3.0E-43
sp|Q8HXY6|THIL_MACFA Acetyl-CoA acetyltransferase, mitochondrial OS=Macaca fascicularis GN=ACAT1 PE=2 SV=1 248 595 7.0E-43
sp|B1KKT1|FADI_SHEWM 3-ketoacyl-CoA thiolase OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=fadI PE=3 SV=1 199 581 7.0E-43
sp|Q0HWN4|FADI_SHESR 3-ketoacyl-CoA thiolase OS=Shewanella sp. (strain MR-7) GN=fadI PE=3 SV=1 199 578 1.0E-42
sp|Q0HKD2|FADI_SHESM 3-ketoacyl-CoA thiolase OS=Shewanella sp. (strain MR-4) GN=fadI PE=3 SV=1 199 578 1.0E-42
sp|A0KV75|FADI_SHESA 3-ketoacyl-CoA thiolase OS=Shewanella sp. (strain ANA-3) GN=fadI PE=3 SV=1 199 578 1.0E-42
sp|Q84JT6|MSRB9_ARATH Peptide methionine sulfoxide reductase B9 OS=Arabidopsis thaliana GN=MSRB9 PE=2 SV=1 62 191 1.0E-42
sp|A9MJ36|FADI_SALAR 3-ketoacyl-CoA thiolase OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=fadI PE=3 SV=1 204 578 1.0E-42
sp|Q5QXN5|FADI_IDILO 3-ketoacyl-CoA thiolase OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=fadI PE=3 SV=1 202 581 1.0E-42
sp|Q8ECP6|FADI_SHEON 3-ketoacyl-CoA thiolase OS=Shewanella oneidensis (strain MR-1) GN=fadI PE=3 SV=1 199 578 1.0E-42
sp|A9N452|FADI_SALPB 3-ketoacyl-CoA thiolase OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=fadI PE=3 SV=1 204 578 1.0E-42
sp|A5F2P1|FADI_VIBC3 3-ketoacyl-CoA thiolase OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=fadI PE=3 SV=2 200 574 2.0E-42
sp|B5R3S0|FADI_SALEP 3-ketoacyl-CoA thiolase OS=Salmonella enteritidis PT4 (strain P125109) GN=fadI PE=3 SV=1 204 578 2.0E-42
sp|B5FPN2|FADI_SALDC 3-ketoacyl-CoA thiolase OS=Salmonella dublin (strain CT_02021853) GN=fadI PE=3 SV=1 204 578 2.0E-42
sp|B5EZS0|FADI_SALA4 3-ketoacyl-CoA thiolase OS=Salmonella agona (strain SL483) GN=fadI PE=3 SV=1 204 578 2.0E-42
sp|Q9KT59|FADI_VIBCH 3-ketoacyl-CoA thiolase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=fadI PE=3 SV=2 200 574 2.0E-42
sp|A3QFP4|FADI_SHELP 3-ketoacyl-CoA thiolase OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=fadI PE=3 SV=1 202 578 3.0E-42
sp|P24752|THIL_HUMAN Acetyl-CoA acetyltransferase, mitochondrial OS=Homo sapiens GN=ACAT1 PE=1 SV=1 248 595 3.0E-42
sp|B5BBA0|FADI_SALPK 3-ketoacyl-CoA thiolase OS=Salmonella paratyphi A (strain AKU_12601) GN=fadI PE=3 SV=1 204 578 4.0E-42
sp|C0PZX5|FADI_SALPC 3-ketoacyl-CoA thiolase OS=Salmonella paratyphi C (strain RKS4594) GN=fadI PE=3 SV=1 204 578 4.0E-42
sp|B4TCA9|FADI_SALHS 3-ketoacyl-CoA thiolase OS=Salmonella heidelberg (strain SL476) GN=fadI PE=3 SV=1 204 578 5.0E-42
sp|Q8ZNA6|FADI_SALTY 3-ketoacyl-CoA thiolase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=fadI PE=3 SV=1 204 578 5.0E-42
sp|Q5PCX7|FADI_SALPA 3-ketoacyl-CoA thiolase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=fadI PE=3 SV=1 204 578 5.0E-42
sp|Q8Z4Y9|FADI_SALTI 3-ketoacyl-CoA thiolase OS=Salmonella typhi GN=fadI PE=3 SV=1 204 578 5.0E-42
sp|B4TQC3|FADI_SALSV 3-ketoacyl-CoA thiolase OS=Salmonella schwarzengrund (strain CVM19633) GN=fadI PE=3 SV=1 204 578 7.0E-42
sp|B4SZR1|FADI_SALNS 3-ketoacyl-CoA thiolase OS=Salmonella newport (strain SL254) GN=fadI PE=3 SV=1 204 578 7.0E-42
sp|Q7N287|FADI_PHOLL 3-ketoacyl-CoA thiolase OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=fadI PE=3 SV=1 207 597 9.0E-42
sp|Q6LTK4|FADI_PHOPR 3-ketoacyl-CoA thiolase OS=Photobacterium profundum GN=fadI PE=3 SV=1 202 574 9.0E-42
sp|Q57LW5|FADI_SALCH 3-ketoacyl-CoA thiolase OS=Salmonella choleraesuis (strain SC-B67) GN=fadI PE=3 SV=1 204 578 2.0E-41
sp|B7MY17|FADI_ECO81 3-ketoacyl-CoA thiolase OS=Escherichia coli O81 (strain ED1a) GN=fadI PE=3 SV=1 204 578 4.0E-41
sp|Q5E3U0|FADI_VIBF1 3-ketoacyl-CoA thiolase OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=fadI PE=3 SV=1 192 578 4.0E-41
sp|A8ADP1|FADI_CITK8 3-ketoacyl-CoA thiolase OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=fadI PE=3 SV=1 204 578 4.0E-41
sp|B7LLC9|FADI_ESCF3 3-ketoacyl-CoA thiolase OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=fadI PE=3 SV=1 204 578 4.0E-41
sp|B1LME8|FADI_ECOSM 3-ketoacyl-CoA thiolase OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=fadI PE=3 SV=1 204 578 7.0E-41
sp|B5FGB5|FADI_VIBFM 3-ketoacyl-CoA thiolase OS=Vibrio fischeri (strain MJ11) GN=fadI PE=3 SV=1 192 578 8.0E-41
sp|Q8FFG3|FADI_ECOL6 3-ketoacyl-CoA thiolase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=fadI PE=3 SV=1 204 578 8.0E-41
sp|B7N5V3|FADI_ECOLU 3-ketoacyl-CoA thiolase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=fadI PE=3 SV=1 204 578 8.0E-41
sp|Q5HIA0|VRAB_STAAC Putative acetyl-CoA C-acetyltransferase VraB OS=Staphylococcus aureus (strain COL) GN=vraB PE=3 SV=1 210 594 9.0E-41
sp|Q6GBR1|VRAB_STAAS Putative acetyl-CoA C-acetyltransferase VraB OS=Staphylococcus aureus (strain MSSA476) GN=vraB PE=3 SV=1 210 594 1.0E-40
sp|Q7A1P9|VRAB_STAAW Putative acetyl-CoA C-acetyltransferase VraB OS=Staphylococcus aureus (strain MW2) GN=vraB PE=3 SV=1 210 594 1.0E-40
sp|Q7A768|VRAB_STAAN Putative acetyl-CoA C-acetyltransferase VraB OS=Staphylococcus aureus (strain N315) GN=vraB PE=3 SV=1 210 594 1.0E-40
sp|Q7A2W9|VRAB_STAAM Putative acetyl-CoA C-acetyltransferase VraB OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=vraB PE=3 SV=1 210 594 1.0E-40
sp|Q9KWK4|VRAB_STAA1 Putative acetyl-CoA C-acetyltransferase VraB OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=vraB PE=3 SV=1 210 594 1.0E-40
sp|A4SMT9|FADI_AERS4 3-ketoacyl-CoA thiolase OS=Aeromonas salmonicida (strain A449) GN=fadI PE=3 SV=1 203 597 1.0E-40
sp|Q47ZB6|FADI_COLP3 3-ketoacyl-CoA thiolase OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=fadI PE=3 SV=1 202 581 1.0E-40
sp|B7UFZ9|FADI_ECO27 3-ketoacyl-CoA thiolase OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=fadI PE=3 SV=1 204 578 1.0E-40
sp|Q0T2E5|FADI_SHIF8 3-ketoacyl-CoA thiolase OS=Shigella flexneri serotype 5b (strain 8401) GN=fadI PE=3 SV=1 204 578 2.0E-40
sp|A0KK76|FADI_AERHH 3-ketoacyl-CoA thiolase OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=fadI PE=3 SV=1 203 597 2.0E-40
sp|Q1R971|FADI_ECOUT 3-ketoacyl-CoA thiolase OS=Escherichia coli (strain UTI89 / UPEC) GN=fadI PE=3 SV=1 204 578 2.0E-40
sp|Q0TFA5|FADI_ECOL5 3-ketoacyl-CoA thiolase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=fadI PE=3 SV=1 204 578 2.0E-40
sp|A1ADI9|FADI_ECOK1 3-ketoacyl-CoA thiolase OS=Escherichia coli O1:K1 / APEC GN=fadI PE=3 SV=1 204 578 2.0E-40
sp|B7MGV8|FADI_ECO45 3-ketoacyl-CoA thiolase OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=fadI PE=3 SV=1 204 578 2.0E-40
sp|B7NP25|FADI_ECO7I 3-ketoacyl-CoA thiolase OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=fadI PE=3 SV=1 204 578 2.0E-40
sp|Q6GJ93|VRAB_STAAR Putative acetyl-CoA C-acetyltransferase VraB OS=Staphylococcus aureus (strain MRSA252) GN=vraB PE=3 SV=1 210 594 2.0E-40
sp|B7LBJ6|FADI_ECO55 3-ketoacyl-CoA thiolase OS=Escherichia coli (strain 55989 / EAEC) GN=fadI PE=3 SV=1 204 578 2.0E-40
sp|P76503|FADI_ECOLI 3-ketoacyl-CoA thiolase OS=Escherichia coli (strain K12) GN=fadI PE=1 SV=1 204 578 2.0E-40
sp|B1X9L5|FADI_ECODH 3-ketoacyl-CoA thiolase OS=Escherichia coli (strain K12 / DH10B) GN=fadI PE=3 SV=1 204 578 2.0E-40
sp|C4ZVN3|FADI_ECOBW 3-ketoacyl-CoA thiolase OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=fadI PE=3 SV=1 204 578 2.0E-40
sp|A8A2L1|FADI_ECOHS 3-ketoacyl-CoA thiolase OS=Escherichia coli O9:H4 (strain HS) GN=fadI PE=3 SV=1 204 578 2.0E-40
sp|Q87MM2|FADI_VIBPA 3-ketoacyl-CoA thiolase OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=fadI PE=3 SV=1 200 574 2.0E-40
sp|Q8DB48|FADI_VIBVU 3-ketoacyl-CoA thiolase OS=Vibrio vulnificus (strain CMCP6) GN=fadI PE=3 SV=1 200 574 2.0E-40
sp|O46629|ECHB_BOVIN Trifunctional enzyme subunit beta, mitochondrial OS=Bos taurus GN=HADHB PE=2 SV=1 176 593 2.0E-40
sp|B6I6Q5|FADI_ECOSE 3-ketoacyl-CoA thiolase OS=Escherichia coli (strain SE11) GN=fadI PE=3 SV=1 204 578 3.0E-40
sp|B7M6M3|FADI_ECO8A 3-ketoacyl-CoA thiolase OS=Escherichia coli O8 (strain IAI1) GN=fadI PE=3 SV=1 204 578 3.0E-40
sp|A7ZPF9|FADI_ECO24 3-ketoacyl-CoA thiolase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=fadI PE=3 SV=1 204 578 3.0E-40
sp|A1JK23|FADI_YERE8 3-ketoacyl-CoA thiolase OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=fadI PE=3 SV=1 204 569 3.0E-40
sp|B1IXA4|FADI_ECOLC 3-ketoacyl-CoA thiolase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=fadI PE=3 SV=1 204 578 4.0E-40
sp|B2TWV5|FADI_SHIB3 3-ketoacyl-CoA thiolase OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=fadI PE=3 SV=1 204 578 5.0E-40
sp|A4WCW7|FADI_ENT38 3-ketoacyl-CoA thiolase OS=Enterobacter sp. (strain 638) GN=fadI PE=3 SV=1 204 578 5.0E-40
sp|Q7MIS4|FADI_VIBVY 3-ketoacyl-CoA thiolase OS=Vibrio vulnificus (strain YJ016) GN=fadI PE=3 SV=1 200 574 7.0E-40
sp|Q3YZM1|FADI_SHISS 3-ketoacyl-CoA thiolase OS=Shigella sonnei (strain Ss046) GN=fadI PE=3 SV=1 204 578 9.0E-40
sp|Q15VA3|FADI_PSEA6 3-ketoacyl-CoA thiolase OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=fadI PE=3 SV=1 199 574 1.0E-39
sp|B5YXY5|FADI_ECO5E 3-ketoacyl-CoA thiolase OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=fadI PE=3 SV=1 204 578 2.0E-39
sp|Q8XCN9|FADI_ECO57 3-ketoacyl-CoA thiolase OS=Escherichia coli O157:H7 GN=fadI PE=3 SV=1 204 578 2.0E-39
sp|Q31YB6|FADI_SHIBS 3-ketoacyl-CoA thiolase OS=Shigella boydii serotype 4 (strain Sb227) GN=fadI PE=3 SV=1 204 578 3.0E-39
sp|A7MH80|FADI_CROS8 3-ketoacyl-CoA thiolase OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=fadI PE=3 SV=1 204 578 4.0E-39
sp|Q32DJ3|FADI_SHIDS 3-ketoacyl-CoA thiolase OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=fadI PE=3 SV=1 204 578 7.0E-39
sp|Q83K95|FADI_SHIFL 3-ketoacyl-CoA thiolase OS=Shigella flexneri GN=fadI PE=3 SV=1 204 578 9.0E-39
sp|Q6D2L6|FADI_PECAS 3-ketoacyl-CoA thiolase OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=fadI PE=3 SV=1 204 569 2.0E-38
sp|B1JGG1|FADI_YERPY 3-ketoacyl-CoA thiolase OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=fadI PE=3 SV=1 204 569 3.0E-38
sp|Q668V0|FADI_YERPS 3-ketoacyl-CoA thiolase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=fadI PE=3 SV=1 204 569 3.0E-38
sp|A4TM83|FADI_YERPP 3-ketoacyl-CoA thiolase OS=Yersinia pestis (strain Pestoides F) GN=fadI PE=3 SV=1 204 569 3.0E-38
sp|Q1CHK1|FADI_YERPN 3-ketoacyl-CoA thiolase OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=fadI PE=3 SV=1 204 569 3.0E-38
sp|Q8ZD46|FADI_YERPE 3-ketoacyl-CoA thiolase OS=Yersinia pestis GN=fadI PE=3 SV=1 204 569 3.0E-38
sp|B2K8J6|FADI_YERPB 3-ketoacyl-CoA thiolase OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=fadI PE=3 SV=1 204 569 3.0E-38
sp|Q1C659|FADI_YERPA 3-ketoacyl-CoA thiolase OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=fadI PE=3 SV=1 204 569 3.0E-38
sp|A7FGK0|FADI_YERP3 3-ketoacyl-CoA thiolase OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=fadI PE=3 SV=1 204 569 3.0E-38
sp|B4RTU9|FADI_ALTMD 3-ketoacyl-CoA thiolase OS=Alteromonas macleodii (strain DSM 17117 / Deep ecotype) GN=fadI PE=3 SV=1 201 574 6.0E-38
sp|P55084|ECHB_HUMAN Trifunctional enzyme subunit beta, mitochondrial OS=Homo sapiens GN=HADHB PE=1 SV=3 201 593 6.0E-38
sp|Q5R1W7|ECHB_PANTR Trifunctional enzyme subunit beta, mitochondrial OS=Pan troglodytes GN=HADHB PE=2 SV=1 201 593 7.0E-38
sp|B5XVW1|FADI_KLEP3 3-ketoacyl-CoA thiolase OS=Klebsiella pneumoniae (strain 342) GN=fadI PE=3 SV=1 204 578 8.0E-38
sp|Q60587|ECHB_RAT Trifunctional enzyme subunit beta, mitochondrial OS=Rattus norvegicus GN=Hadhb PE=1 SV=1 160 593 9.0E-38
sp|A9R7W9|FADI_YERPG 3-ketoacyl-CoA thiolase OS=Yersinia pestis bv. Antiqua (strain Angola) GN=fadI PE=3 SV=1 204 569 1.0E-37
sp|Q8HXX4|ECHB_MACFA Trifunctional enzyme subunit beta, mitochondrial OS=Macaca fascicularis GN=HADHB PE=2 SV=1 201 593 2.0E-37
sp|A6TC20|FADI_KLEP7 3-ketoacyl-CoA thiolase OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=fadI PE=3 SV=1 204 578 3.0E-37
sp|C6DAL8|FADI_PECCP 3-ketoacyl-CoA thiolase OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=fadI PE=3 SV=1 204 569 3.0E-37
sp|Q99JY0|ECHB_MOUSE Trifunctional enzyme subunit beta, mitochondrial OS=Mus musculus GN=Hadhb PE=1 SV=1 196 593 5.0E-37
sp|P34255|YKA3_CAEEL Uncharacterized protein B0303.3 OS=Caenorhabditis elegans GN=B0303.3 PE=3 SV=1 206 590 3.0E-34
sp|P25566|MXR2_YEAST Peptide methionine sulfoxide reductase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MXR2 PE=1 SV=1 26 181 4.0E-34
sp|B2VJ10|FADI_ERWT9 3-ketoacyl-CoA thiolase OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=fadI PE=3 SV=1 204 569 2.0E-33
sp|Q4L3Q1|VRAB_STAHJ Putative acetyl-CoA C-acetyltransferase VraB OS=Staphylococcus haemolyticus (strain JCSC1435) GN=vraB PE=3 SV=1 292 594 6.0E-33
sp|Q6ADJ8|MSRB_LEIXX Peptide methionine sulfoxide reductase MsrB OS=Leifsonia xyli subsp. xyli (strain CTCB07) GN=msrB PE=3 SV=1 56 182 2.0E-32
sp|Q8UGX7|MSRB_AGRFC Peptide methionine sulfoxide reductase MsrB OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=msrB PE=3 SV=1 55 180 1.0E-31
sp|Q8PWF5|MSRB_METMA Peptide methionine sulfoxide reductase MsrB OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=msrB PE=3 SV=1 62 182 1.0E-31
sp|Q46EH1|MSRB_METBF Peptide methionine sulfoxide reductase MsrB OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=msrB PE=3 SV=1 62 182 2.0E-30
sp|A4G5V5|MSRB_HERAR Peptide methionine sulfoxide reductase MsrB OS=Herminiimonas arsenicoxydans GN=msrB PE=3 SV=1 57 181 1.0E-29
sp|C5BR54|MSRB_TERTT Peptide methionine sulfoxide reductase MsrB OS=Teredinibacter turnerae (strain ATCC 39867 / T7901) GN=msrB PE=3 SV=1 57 181 5.0E-29
sp|Q87MS5|MSRB_VIBPA Peptide methionine sulfoxide reductase MsrB OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=msrB PE=3 SV=1 63 182 2.0E-27
sp|Q8F7W8|MSRB_LEPIN Peptide methionine sulfoxide reductase MsrB OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=msrB PE=3 SV=3 57 181 8.0E-27
sp|Q72NN2|MSRB_LEPIC Peptide methionine sulfoxide reductase MsrB OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) GN=msrB PE=3 SV=3 57 181 8.0E-27
sp|B0VC45|MSRB_ACIBY Peptide methionine sulfoxide reductase MsrB OS=Acinetobacter baumannii (strain AYE) GN=msrB PE=3 SV=1 63 181 2.0E-26
sp|A3M4Q3|MSRB_ACIBT Peptide methionine sulfoxide reductase MsrB OS=Acinetobacter baumannii (strain ATCC 17978 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377) GN=msrB PE=3 SV=2 63 181 2.0E-26
sp|B2HYT2|MSRB_ACIBC Peptide methionine sulfoxide reductase MsrB OS=Acinetobacter baumannii (strain ACICU) GN=msrB PE=3 SV=1 63 181 2.0E-26
sp|B7I415|MSRB_ACIB5 Peptide methionine sulfoxide reductase MsrB OS=Acinetobacter baumannii (strain AB0057) GN=msrB PE=3 SV=1 63 181 2.0E-26
sp|B7H3X2|MSRB_ACIB3 Peptide methionine sulfoxide reductase MsrB OS=Acinetobacter baumannii (strain AB307-0294) GN=msrB PE=3 SV=1 63 181 2.0E-26
sp|P34436|YL56_CAEEL Uncharacterized protein F44E2.6 OS=Caenorhabditis elegans GN=F44E2.6 PE=3 SV=1 60 182 3.0E-26
sp|B0VR86|MSRB_ACIBS Peptide methionine sulfoxide reductase MsrB OS=Acinetobacter baumannii (strain SDF) GN=msrB PE=3 SV=1 63 181 3.0E-26
sp|Q1QXV3|MSRB_CHRSD Peptide methionine sulfoxide reductase MsrB OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=msrB PE=3 SV=1 57 182 8.0E-26
sp|A2SGN7|MSRB_METPP Peptide methionine sulfoxide reductase MsrB OS=Methylibium petroleiphilum (strain PM1) GN=msrB PE=3 SV=1 62 181 8.0E-26
sp|Q92RA4|MSRB1_RHIME Peptide methionine sulfoxide reductase MsrB 1 OS=Rhizobium meliloti (strain 1021) GN=msrB1 PE=3 SV=2 63 180 1.0E-25
sp|Q3SJU1|MSRB_THIDA Peptide methionine sulfoxide reductase MsrB OS=Thiobacillus denitrificans (strain ATCC 25259) GN=msrB PE=3 SV=1 57 181 3.0E-25
sp|Q2SJP9|MSRB_HAHCH Peptide methionine sulfoxide reductase MsrB OS=Hahella chejuensis (strain KCTC 2396) GN=msrB PE=3 SV=1 62 181 3.0E-25
sp|Q88LQ6|MSRB_PSEPK Peptide methionine sulfoxide reductase MsrB OS=Pseudomonas putida (strain KT2440) GN=msrB PE=3 SV=1 62 182 5.0E-25
sp|C3K735|MSRB_PSEFS Peptide methionine sulfoxide reductase MsrB OS=Pseudomonas fluorescens (strain SBW25) GN=msrB PE=3 SV=1 62 182 6.0E-25
sp|O26807|MSRB_METTH Peptide methionine sulfoxide reductase MsrB OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=msrB PE=1 SV=1 47 181 1.0E-24
sp|Q21LK2|MSRB_SACD2 Peptide methionine sulfoxide reductase MsrB OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=msrB PE=3 SV=1 62 181 1.0E-24
sp|Q4K8U5|MSRB_PSEF5 Peptide methionine sulfoxide reductase MsrB OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=msrB PE=3 SV=1 62 182 1.0E-24
sp|B0KUQ0|MSRB_PSEPG Peptide methionine sulfoxide reductase MsrB OS=Pseudomonas putida (strain GB-1) GN=msrB PE=3 SV=1 62 182 2.0E-24
sp|Q8XYL1|MSRB_RALSO Peptide methionine sulfoxide reductase MsrB OS=Ralstonia solanacearum (strain GMI1000) GN=msrB PE=3 SV=1 62 181 3.0E-24
sp|Q48FR2|MSRB_PSE14 Peptide methionine sulfoxide reductase MsrB OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=msrB PE=3 SV=1 62 182 4.0E-24
sp|Q4ZQC6|MSRB_PSEU2 Peptide methionine sulfoxide reductase MsrB OS=Pseudomonas syringae pv. syringae (strain B728a) GN=msrB PE=3 SV=1 62 182 6.0E-24
sp|C5CNS9|MSRB_VARPS Peptide methionine sulfoxide reductase MsrB OS=Variovorax paradoxus (strain S110) GN=msrB PE=3 SV=1 57 181 6.0E-24
sp|Q3K935|MSRB_PSEPF Peptide methionine sulfoxide reductase MsrB OS=Pseudomonas fluorescens (strain Pf0-1) GN=msrB PE=3 SV=1 62 182 7.0E-24
sp|Q6FAL8|MSRB_ACIAD Peptide methionine sulfoxide reductase MsrB OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=msrB PE=3 SV=1 63 181 8.0E-24
sp|B4RUW0|MSRB_ALTMD Peptide methionine sulfoxide reductase MsrB OS=Alteromonas macleodii (strain DSM 17117 / Deep ecotype) GN=msrB PE=3 SV=1 64 182 1.0E-23
sp|Q47EU6|MSRB_DECAR Peptide methionine sulfoxide reductase MsrB OS=Dechloromonas aromatica (strain RCB) GN=msrB PE=3 SV=1 62 181 1.0E-23
sp|A5GQT3|MSRB_SYNR3 Peptide methionine sulfoxide reductase MsrB OS=Synechococcus sp. (strain RCC307) GN=msrB PE=3 SV=1 60 181 1.0E-23
sp|Q89EM9|MSRB_BRADU Peptide methionine sulfoxide reductase MsrB OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=msrB PE=3 SV=1 63 181 1.0E-23
sp|Q1ID16|MSRB_PSEE4 Peptide methionine sulfoxide reductase MsrB OS=Pseudomonas entomophila (strain L48) GN=msrB PE=3 SV=1 63 182 2.0E-23
sp|Q12AE4|MSRB_POLSJ Peptide methionine sulfoxide reductase MsrB OS=Polaromonas sp. (strain JS666 / ATCC BAA-500) GN=msrB PE=3 SV=1 57 181 5.0E-23
sp|A1VNB7|MSRB_POLNA Peptide methionine sulfoxide reductase MsrB OS=Polaromonas naphthalenivorans (strain CJ2) GN=msrB PE=3 SV=1 62 181 5.0E-23
sp|B1J4W5|MSRB_PSEPW Peptide methionine sulfoxide reductase MsrB OS=Pseudomonas putida (strain W619) GN=msrB PE=3 SV=1 63 182 8.0E-23
sp|A6T7R0|MSRB_KLEP7 Peptide methionine sulfoxide reductase MsrB OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=msrB PE=3 SV=1 61 181 9.0E-23
sp|A5W756|MSRB_PSEP1 Peptide methionine sulfoxide reductase MsrB OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=msrB PE=3 SV=1 62 182 1.0E-22
sp|B5XS71|MSRB_KLEP3 Peptide methionine sulfoxide reductase MsrB OS=Klebsiella pneumoniae (strain 342) GN=msrB PE=3 SV=1 61 181 2.0E-22
sp|B7MVQ9|MSRB_ECO81 Peptide methionine sulfoxide reductase MsrB OS=Escherichia coli O81 (strain ED1a) GN=msrB PE=3 SV=1 61 181 2.0E-22
sp|C1DRM1|MSRB_AZOVD Peptide methionine sulfoxide reductase MsrB OS=Azotobacter vinelandii (strain DJ / ATCC BAA-1303) GN=msrB PE=3 SV=1 62 181 2.0E-22
sp|Q83L66|MSRB_SHIFL Peptide methionine sulfoxide reductase MsrB OS=Shigella flexneri GN=msrB PE=3 SV=1 61 181 3.0E-22
sp|Q0T4Y5|MSRB_SHIF8 Peptide methionine sulfoxide reductase MsrB OS=Shigella flexneri serotype 5b (strain 8401) GN=msrB PE=3 SV=1 61 181 3.0E-22
sp|Q321R4|MSRB_SHIBS Peptide methionine sulfoxide reductase MsrB OS=Shigella boydii serotype 4 (strain Sb227) GN=msrB PE=3 SV=1 61 181 3.0E-22
sp|B1IPF3|MSRB_ECOLC Peptide methionine sulfoxide reductase MsrB OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=msrB PE=3 SV=1 61 181 3.0E-22
sp|A8A0X0|MSRB_ECOHS Peptide methionine sulfoxide reductase MsrB OS=Escherichia coli O9:H4 (strain HS) GN=msrB PE=3 SV=1 61 181 3.0E-22
sp|B7M1J2|MSRB_ECO8A Peptide methionine sulfoxide reductase MsrB OS=Escherichia coli O8 (strain IAI1) GN=msrB PE=3 SV=1 61 181 3.0E-22
sp|B7MAY9|MSRB_ECO45 Peptide methionine sulfoxide reductase MsrB OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=msrB PE=3 SV=1 61 181 3.0E-22
sp|Q0A706|MSRB_ALKEH Peptide methionine sulfoxide reductase MsrB OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=msrB PE=3 SV=1 62 182 4.0E-22
sp|Q7MMC4|MSRB_VIBVY Peptide methionine sulfoxide reductase MsrB OS=Vibrio vulnificus (strain YJ016) GN=msrB PE=3 SV=1 63 195 5.0E-22
sp|Q8D849|MSRB_VIBVU Peptide methionine sulfoxide reductase MsrB OS=Vibrio vulnificus (strain CMCP6) GN=msrB PE=3 SV=2 63 195 8.0E-22
sp|Q885Q1|MSRB_PSESM Peptide methionine sulfoxide reductase MsrB OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=msrB PE=3 SV=1 62 182 1.0E-21
sp|B5F860|MSRB_SALA4 Peptide methionine sulfoxide reductase MsrB OS=Salmonella agona (strain SL483) GN=msrB PE=3 SV=1 61 181 1.0E-21
sp|B7LQ21|MSRB_ESCF3 Peptide methionine sulfoxide reductase MsrB OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=msrB PE=3 SV=1 61 181 1.0E-21
sp|Q6NW52|MSRB2_DANRE Methionine-R-sulfoxide reductase B2, mitochondrial OS=Danio rerio GN=msrb2 PE=2 SV=1 14 182 1.0E-21
sp|B1JLG2|MSRB_YERPY Peptide methionine sulfoxide reductase MsrB OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=msrB PE=3 SV=1 72 181 2.0E-21
sp|Q66AP6|MSRB_YERPS Peptide methionine sulfoxide reductase MsrB OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=msrB PE=3 SV=1 72 181 2.0E-21
sp|A4TJB4|MSRB_YERPP Peptide methionine sulfoxide reductase MsrB OS=Yersinia pestis (strain Pestoides F) GN=msrB PE=3 SV=1 72 181 2.0E-21
sp|Q1CJ76|MSRB_YERPN Peptide methionine sulfoxide reductase MsrB OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=msrB PE=3 SV=1 72 181 2.0E-21
sp|A9R9C4|MSRB_YERPG Peptide methionine sulfoxide reductase MsrB OS=Yersinia pestis bv. Antiqua (strain Angola) GN=msrB PE=3 SV=1 72 181 2.0E-21
sp|Q8ZEK7|MSRB_YERPE Peptide methionine sulfoxide reductase MsrB OS=Yersinia pestis GN=msrB PE=3 SV=1 72 181 2.0E-21
sp|B2K3R4|MSRB_YERPB Peptide methionine sulfoxide reductase MsrB OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=msrB PE=3 SV=1 72 181 2.0E-21
sp|Q1C7U0|MSRB_YERPA Peptide methionine sulfoxide reductase MsrB OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=msrB PE=3 SV=1 72 181 2.0E-21
sp|A7FI81|MSRB_YERP3 Peptide methionine sulfoxide reductase MsrB OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=msrB PE=3 SV=1 72 181 2.0E-21
sp|P65449|MSRB_SALTY Peptide methionine sulfoxide reductase MsrB OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=msrB PE=3 SV=1 61 181 2.0E-21
sp|P65450|MSRB_SALTI Peptide methionine sulfoxide reductase MsrB OS=Salmonella typhi GN=msrB PE=3 SV=1 61 181 2.0E-21
sp|B4TUA8|MSRB_SALSV Peptide methionine sulfoxide reductase MsrB OS=Salmonella schwarzengrund (strain CVM19633) GN=msrB PE=3 SV=1 61 181 2.0E-21
sp|A9N292|MSRB_SALPB Peptide methionine sulfoxide reductase MsrB OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=msrB PE=3 SV=1 61 181 2.0E-21
sp|B4T3Y1|MSRB_SALNS Peptide methionine sulfoxide reductase MsrB OS=Salmonella newport (strain SL254) GN=msrB PE=3 SV=1 61 181 2.0E-21
sp|B4TGC8|MSRB_SALHS Peptide methionine sulfoxide reductase MsrB OS=Salmonella heidelberg (strain SL476) GN=msrB PE=3 SV=1 61 181 2.0E-21
sp|B5FJF9|MSRB_SALDC Peptide methionine sulfoxide reductase MsrB OS=Salmonella dublin (strain CT_02021853) GN=msrB PE=3 SV=1 61 181 2.0E-21
sp|A9MFH4|MSRB_SALAR Peptide methionine sulfoxide reductase MsrB OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=msrB PE=3 SV=1 61 181 2.0E-21
sp|Q0BEH0|MSRB_BURCM Peptide methionine sulfoxide reductase MsrB OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=msrB PE=3 SV=1 51 181 3.0E-21
sp|Q8INK9|MSRB_DROME Methionine-R-sulfoxide reductase B1 OS=Drosophila melanogaster GN=SelR PE=1 SV=3 64 181 3.0E-21
sp|A4JEZ1|MSRB_BURVG Peptide methionine sulfoxide reductase MsrB OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=msrB PE=3 SV=1 51 181 3.0E-21
sp|Q3Z2B6|MSRB_SHISS Peptide methionine sulfoxide reductase MsrB OS=Shigella sonnei (strain Ss046) GN=msrB PE=3 SV=1 61 181 4.0E-21
sp|B1LDV3|MSRB_ECOSM Peptide methionine sulfoxide reductase MsrB OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=msrB PE=3 SV=1 61 181 4.0E-21
sp|B6IBJ9|MSRB_ECOSE Peptide methionine sulfoxide reductase MsrB OS=Escherichia coli (strain SE11) GN=msrB PE=3 SV=1 61 181 4.0E-21
sp|B7N5B4|MSRB_ECOLU Peptide methionine sulfoxide reductase MsrB OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=msrB PE=3 SV=1 61 181 4.0E-21
sp|P0A746|MSRB_ECOLI Peptide methionine sulfoxide reductase MsrB OS=Escherichia coli (strain K12) GN=msrB PE=1 SV=1 61 181 4.0E-21
sp|P0A747|MSRB_ECOL6 Peptide methionine sulfoxide reductase MsrB OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=msrB PE=3 SV=1 61 181 4.0E-21
sp|Q0TH50|MSRB_ECOL5 Peptide methionine sulfoxide reductase MsrB OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=msrB PE=3 SV=1 61 181 4.0E-21
sp|B1XGN8|MSRB_ECODH Peptide methionine sulfoxide reductase MsrB OS=Escherichia coli (strain K12 / DH10B) GN=msrB PE=3 SV=1 61 181 4.0E-21
sp|C4ZZD4|MSRB_ECOBW Peptide methionine sulfoxide reductase MsrB OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=msrB PE=3 SV=1 61 181 4.0E-21
sp|B7NSZ8|MSRB_ECO7I Peptide methionine sulfoxide reductase MsrB OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=msrB PE=3 SV=1 61 181 4.0E-21
sp|B5YQ71|MSRB_ECO5E Peptide methionine sulfoxide reductase MsrB OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=msrB PE=3 SV=1 61 181 4.0E-21
sp|P0A748|MSRB_ECO57 Peptide methionine sulfoxide reductase MsrB OS=Escherichia coli O157:H7 GN=msrB PE=3 SV=1 61 181 4.0E-21
sp|B7L6Q3|MSRB_ECO55 Peptide methionine sulfoxide reductase MsrB OS=Escherichia coli (strain 55989 / EAEC) GN=msrB PE=3 SV=1 61 181 4.0E-21
sp|B7USF8|MSRB_ECO27 Peptide methionine sulfoxide reductase MsrB OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=msrB PE=3 SV=1 61 181 4.0E-21
sp|A7ZMP8|MSRB_ECO24 Peptide methionine sulfoxide reductase MsrB OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=msrB PE=3 SV=1 61 181 4.0E-21
sp|B3PK10|MSRB_CELJU Peptide methionine sulfoxide reductase MsrB OS=Cellvibrio japonicus (strain Ueda107) GN=msrB PE=3 SV=1 57 181 4.0E-21
sp|Q9C8M2|MSRB1_ARATH Peptide methionine sulfoxide reductase B1, chloroplastic OS=Arabidopsis thaliana GN=MSRB1 PE=1 SV=1 64 181 4.0E-21
sp|Q32GC7|MSRB_SHIDS Peptide methionine sulfoxide reductase MsrB OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=msrB PE=3 SV=1 61 181 5.0E-21
sp|Q78J03|MSRB2_MOUSE Methionine-R-sulfoxide reductase B2, mitochondrial OS=Mus musculus GN=Msrb2 PE=1 SV=1 64 182 5.0E-21
sp|A8GFD8|MSRB_SERP5 Peptide methionine sulfoxide reductase MsrB OS=Serratia proteamaculans (strain 568) GN=msrB PE=3 SV=1 55 181 7.0E-21
sp|Q9PF29|MSRB_XYLFA Peptide methionine sulfoxide reductase MsrB OS=Xylella fastidiosa (strain 9a5c) GN=msrB PE=3 SV=1 57 182 7.0E-21
sp|Q5R930|MSRB3_PONAB Methionine-R-sulfoxide reductase B3 OS=Pongo abelii GN=MSRB3 PE=2 SV=2 64 181 7.0E-21
sp|Q8DJK9|MSRB_THEEB Peptide methionine sulfoxide reductase MsrB OS=Thermosynechococcus elongatus (strain BP-1) GN=msrB PE=3 SV=1 63 181 1.0E-20
sp|Q8IXL7|MSRB3_HUMAN Methionine-R-sulfoxide reductase B3 OS=Homo sapiens GN=MSRB3 PE=1 SV=2 64 181 1.0E-20
sp|B8GMG5|MSRB_THISH Peptide methionine sulfoxide reductase MsrB OS=Thioalkalivibrio sulfidiphilus (strain HL-EbGR7) GN=msrB PE=3 SV=1 54 182 1.0E-20
sp|A0K833|MSRB_BURCH Peptide methionine sulfoxide reductase MsrB OS=Burkholderia cenocepacia (strain HI2424) GN=msrB PE=3 SV=1 51 181 2.0E-20
sp|Q1BH71|MSRB_BURCA Peptide methionine sulfoxide reductase MsrB OS=Burkholderia cenocepacia (strain AU 1054) GN=msrB PE=3 SV=1 51 181 2.0E-20
sp|Q0DC89|MSRB1_ORYSJ Peptide methionine sulfoxide reductase B1, chloroplastic OS=Oryza sativa subsp. japonica GN=MSRB1 PE=2 SV=2 56 181 2.0E-20
sp|C3LNU9|MSRB_VIBCM Peptide methionine sulfoxide reductase MsrB OS=Vibrio cholerae serotype O1 (strain M66-2) GN=msrB PE=3 SV=1 56 182 2.0E-20
sp|Q9KQK0|MSRB_VIBCH Peptide methionine sulfoxide reductase MsrB OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=msrB PE=3 SV=1 56 182 2.0E-20
sp|A5F6R2|MSRB_VIBC3 Peptide methionine sulfoxide reductase MsrB OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=msrB PE=3 SV=1 56 182 2.0E-20
sp|Q9Y3D2|MSRB2_HUMAN Methionine-R-sulfoxide reductase B2, mitochondrial OS=Homo sapiens GN=MSRB2 PE=1 SV=2 64 182 3.0E-20
sp|Q8BU85|MSRB3_MOUSE Methionine-R-sulfoxide reductase B3, mitochondrial OS=Mus musculus GN=Msrb3 PE=1 SV=2 64 181 3.0E-20
sp|A1JQG8|MSRB_YERE8 Peptide methionine sulfoxide reductase MsrB OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=msrB PE=3 SV=1 72 181 3.0E-20
sp|B2VJ36|MSRB_ERWT9 Peptide methionine sulfoxide reductase MsrB OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=msrB PE=3 SV=1 57 181 4.0E-20
sp|B1YRN6|MSRB_BURA4 Peptide methionine sulfoxide reductase MsrB OS=Burkholderia ambifaria (strain MC40-6) GN=msrB PE=3 SV=1 51 181 4.0E-20
sp|Q87AJ9|MSRB_XYLFT Peptide methionine sulfoxide reductase MsrB OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=msrB PE=3 SV=1 57 182 5.0E-20
sp|B2I8Y4|MSRB_XYLF2 Peptide methionine sulfoxide reductase MsrB OS=Xylella fastidiosa (strain M23) GN=msrB PE=3 SV=1 57 182 5.0E-20
sp|Q4FZX5|MSRB2_RAT Methionine-R-sulfoxide reductase B2, mitochondrial OS=Rattus norvegicus GN=Msrb2 PE=2 SV=1 64 182 6.0E-20
sp|A9AJS6|MSRB_BURM1 Peptide methionine sulfoxide reductase MsrB OS=Burkholderia multivorans (strain ATCC 17616 / 249) GN=msrB PE=3 SV=1 51 181 8.0E-20
sp|Q39FG2|MSRB_BURL3 Peptide methionine sulfoxide reductase MsrB OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=msrB PE=3 SV=1 51 181 8.0E-20
sp|B4EBK9|MSRB_BURCJ Peptide methionine sulfoxide reductase MsrB OS=Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610) GN=msrB PE=3 SV=1 51 181 1.0E-19
sp|B1JTT6|MSRB_BURCC Peptide methionine sulfoxide reductase MsrB OS=Burkholderia cenocepacia (strain MC0-3) GN=msrB PE=3 SV=1 51 181 1.0E-19
sp|Q63V23|MSRB_BURPS Peptide methionine sulfoxide reductase MsrB OS=Burkholderia pseudomallei (strain K96243) GN=msrB PE=3 SV=1 59 181 1.0E-19
sp|A1V4U8|MSRB_BURMS Peptide methionine sulfoxide reductase MsrB OS=Burkholderia mallei (strain SAVP1) GN=msrB PE=3 SV=1 59 181 1.0E-19
sp|Q62JM6|MSRB_BURMA Peptide methionine sulfoxide reductase MsrB OS=Burkholderia mallei (strain ATCC 23344) GN=msrB PE=3 SV=1 59 181 1.0E-19
sp|A2SBI6|MSRB_BURM9 Peptide methionine sulfoxide reductase MsrB OS=Burkholderia mallei (strain NCTC 10229) GN=msrB PE=3 SV=1 59 181 1.0E-19
sp|B0BYW4|MSRB_ACAM1 Peptide methionine sulfoxide reductase MsrB OS=Acaryochloris marina (strain MBIC 11017) GN=msrB PE=3 SV=1 62 181 3.0E-19
sp|Q9CMB1|MSRB_PASMU Peptide methionine sulfoxide reductase MsrB OS=Pasteurella multocida (strain Pm70) GN=msrB PE=3 SV=1 69 182 3.0E-19
sp|Q3JRF0|MSRB_BURP1 Peptide methionine sulfoxide reductase MsrB OS=Burkholderia pseudomallei (strain 1710b) GN=msrB PE=1 SV=1 59 181 4.0E-19
sp|A4XVB1|MSRB_PSEMY Peptide methionine sulfoxide reductase MsrB OS=Pseudomonas mendocina (strain ymp) GN=msrB PE=3 SV=1 63 182 5.0E-19
sp|Q2SWN9|MSRB_BURTA Peptide methionine sulfoxide reductase MsrB OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=msrB PE=3 SV=1 51 181 2.0E-18
sp|A6V3R3|MSRB_PSEA7 Peptide methionine sulfoxide reductase MsrB OS=Pseudomonas aeruginosa (strain PA7) GN=msrB PE=3 SV=1 66 181 4.0E-18
sp|P75129|MSRB_MYCPN Peptide methionine sulfoxide reductase MsrB OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=msrB PE=3 SV=1 57 181 7.0E-18
sp|Q7N400|MSRB_PHOLL Peptide methionine sulfoxide reductase MsrB OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=msrB PE=3 SV=1 72 181 2.0E-17
sp|Q9I016|MSRB_PSEAE Peptide methionine sulfoxide reductase MsrB OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=msrB PE=3 SV=1 66 181 3.0E-17
sp|Q02NZ0|MSRB_PSEAB Peptide methionine sulfoxide reductase MsrB OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=msrB PE=3 SV=1 66 181 3.0E-17
sp|B7UUZ9|MSRB_PSEA8 Peptide methionine sulfoxide reductase MsrB OS=Pseudomonas aeruginosa (strain LESB58) GN=msrB PE=3 SV=1 66 181 3.0E-17
sp|P47686|MSRB_MYCGE Peptide methionine sulfoxide reductase MsrB OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=msrB PE=3 SV=1 57 181 5.0E-17
sp|C6DGV8|MSRB_PECCP Peptide methionine sulfoxide reductase MsrB OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=msrB PE=3 SV=1 72 191 6.0E-16
sp|Q6D4P7|MSRB_PECAS Peptide methionine sulfoxide reductase MsrB OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=msrB PE=3 SV=1 72 191 5.0E-15
sp|Q9A6B1|MSRB_CAUCR Peptide methionine sulfoxide reductase MsrB OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=msrB PE=3 SV=1 51 182 6.0E-15
sp|B8GY23|MSRB_CAUCN Peptide methionine sulfoxide reductase MsrB OS=Caulobacter crescentus (strain NA1000 / CB15N) GN=msrB PE=3 SV=1 51 182 6.0E-15
sp|Q5WH73|MSRB_BACSK Peptide methionine sulfoxide reductase MsrB OS=Bacillus clausii (strain KSM-K16) GN=msrB PE=3 SV=1 57 181 7.0E-15
sp|Q9CJ17|MSRB_LACLA Peptide methionine sulfoxide reductase MsrB OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=msrB PE=3 SV=1 77 181 7.0E-15
sp|Q92Y46|MSRB2_RHIME Peptide methionine sulfoxide reductase MsrB 2 OS=Rhizobium meliloti (strain 1021) GN=msrB2 PE=3 SV=1 57 181 9.0E-15
sp|P65448|MSRB_BRUSU Peptide methionine sulfoxide reductase MsrB OS=Brucella suis biovar 1 (strain 1330) GN=msrB PE=3 SV=1 70 181 1.0E-14
sp|P65447|MSRB_BRUME Peptide methionine sulfoxide reductase MsrB OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=msrB PE=3 SV=1 70 181 1.0E-14
sp|B1HZH4|MSRB_LYSSC Peptide methionine sulfoxide reductase MsrB OS=Lysinibacillus sphaericus (strain C3-41) GN=msrB PE=3 SV=1 72 181 3.0E-14
sp|Q032Q9|MSRB_LACLS Peptide methionine sulfoxide reductase MsrB OS=Lactococcus lactis subsp. cremoris (strain SK11) GN=msrB PE=3 SV=1 77 181 3.0E-14
sp|Q1WVT3|MSRB_LACS1 Peptide methionine sulfoxide reductase MsrB OS=Lactobacillus salivarius (strain UCC118) GN=msrB PE=3 SV=1 62 181 3.0E-14
sp|Q88W33|MSRB_LACPL Peptide methionine sulfoxide reductase MsrB OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=msrB PE=3 SV=1 63 181 3.0E-14
sp|P65444|MSAB2_STRR6 Peptide methionine sulfoxide reductase MsrA/MsrB 2 OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=msrAB2 PE=3 SV=1 59 182 4.0E-14
sp|P65443|MSAB2_STRPN Peptide methionine sulfoxide reductase MsrA/MsrB 2 OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=msrAB2 PE=3 SV=1 59 182 4.0E-14
sp|Q9LAM9|MSRAB_STRGC Peptide methionine sulfoxide reductase MsrA/MsrB OS=Streptococcus gordonii (strain Challis / ATCC 35105 / CH1 / DL1 / V288) GN=msrAB PE=3 SV=1 61 181 8.0E-14
sp|Q93KF3|MSRAB_CAMFE Peptide methionine sulfoxide reductase MsrA/MsrB OS=Campylobacter fetus GN=msrAB PE=3 SV=1 64 180 2.0E-13
sp|A2RHS0|MSRB_LACLM Peptide methionine sulfoxide reductase MsrB OS=Lactococcus lactis subsp. cremoris (strain MG1363) GN=msrB PE=3 SV=1 77 181 2.0E-13
sp|P0DC41|MSRAB_STRPQ Peptide methionine sulfoxide reductase MsrA/MsrB OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=msrAB PE=3 SV=1 59 182 3.0E-13
sp|P0DC40|MSRAB_STRP3 Peptide methionine sulfoxide reductase MsrA/MsrB OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=msrAB PE=3 SV=1 59 182 3.0E-13
sp|Q72EK2|MSRB_DESVH Peptide methionine sulfoxide reductase MsrB OS=Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) GN=msrB PE=3 SV=1 62 181 3.0E-13
sp|Q9RUK6|MSRB_DEIRA Peptide methionine sulfoxide reductase MsrB OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=msrB PE=3 SV=1 62 181 4.0E-13
sp|Q49XN4|MSRB_STAS1 Peptide methionine sulfoxide reductase MsrB OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=msrB PE=3 SV=1 72 189 4.0E-13
sp|B9DNY9|MSRB_STACT Peptide methionine sulfoxide reductase MsrB OS=Staphylococcus carnosus (strain TM300) GN=msrB PE=3 SV=1 62 181 6.0E-13
sp|Q4L6D3|MSRB_STAHJ Peptide methionine sulfoxide reductase MsrB OS=Staphylococcus haemolyticus (strain JCSC1435) GN=msrB PE=3 SV=1 72 181 7.0E-13
sp|A0AJW4|MSRB_LISW6 Peptide methionine sulfoxide reductase MsrB OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=msrB PE=3 SV=1 61 181 9.0E-13
sp|Q5XAX5|MSRAB_STRP6 Peptide methionine sulfoxide reductase MsrA/MsrB OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=msrAB PE=3 SV=2 59 182 1.0E-12
sp|Q99YT1|MSRAB_STRP1 Peptide methionine sulfoxide reductase MsrA/MsrB OS=Streptococcus pyogenes serotype M1 GN=msrAB PE=3 SV=2 59 182 1.0E-12
sp|Q8P046|MSRAB_STRP8 Peptide methionine sulfoxide reductase MsrA/MsrB OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=msrAB PE=3 SV=2 59 182 1.0E-12
sp|P0DC43|MSRB_STRPQ Peptide methionine sulfoxide reductase MsrB OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=msrB PE=3 SV=1 63 181 2.0E-12
sp|P0DC42|MSRB_STRP3 Peptide methionine sulfoxide reductase MsrB OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=msrB PE=3 SV=1 63 181 2.0E-12
sp|P54155|MSRB_BACSU Peptide methionine sulfoxide reductase MsrB OS=Bacillus subtilis (strain 168) GN=msrB PE=1 SV=1 72 181 3.0E-12
sp|P0A3R0|MSAB1_STRR6 Peptide methionine sulfoxide reductase MsrA/MsrB 1 OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=msrAB1 PE=1 SV=1 61 181 3.0E-12
sp|P0A3Q9|MSAB1_STRPN Peptide methionine sulfoxide reductase MsrA/MsrB 1 OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=msrAB1 PE=1 SV=1 61 181 3.0E-12
sp|Q99ZV6|MSRB_STRP1 Peptide methionine sulfoxide reductase MsrB OS=Streptococcus pyogenes serotype M1 GN=msrB PE=3 SV=1 63 181 3.0E-12
sp|B8DDP3|MSRB_LISMH Peptide methionine sulfoxide reductase MsrB OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=msrB PE=3 SV=1 61 196 3.0E-12
sp|Q8P172|MSRB_STRP8 Peptide methionine sulfoxide reductase MsrB OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=msrB PE=3 SV=1 63 181 4.0E-12
sp|Q71YF7|MSRB_LISMF Peptide methionine sulfoxide reductase MsrB OS=Listeria monocytogenes serotype 4b (strain F2365) GN=msrB PE=3 SV=1 61 196 4.0E-12
sp|C1KWF8|MSRB_LISMC Peptide methionine sulfoxide reductase MsrB OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=msrB PE=3 SV=1 61 196 4.0E-12
sp|Q8Y641|MSRB_LISMO Peptide methionine sulfoxide reductase MsrB OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=msrB PE=3 SV=1 61 196 5.0E-12
sp|Q9AL99|MSRAB_AGGAC Peptide methionine sulfoxide reductase MsrA/MsrB OS=Aggregatibacter actinomycetemcomitans GN=msrAB PE=3 SV=1 59 181 8.0E-12
sp|Q8CSK6|MSRB_STAES Peptide methionine sulfoxide reductase MsrB OS=Staphylococcus epidermidis (strain ATCC 12228) GN=msrB PE=3 SV=1 62 181 9.0E-12
sp|Q5HPB4|MSRB_STAEQ Peptide methionine sulfoxide reductase MsrB OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=msrB PE=3 SV=1 62 181 9.0E-12
sp|Q9KCX2|MSRB_BACHD Peptide methionine sulfoxide reductase MsrB OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=msrB PE=3 SV=1 66 181 1.0E-11
sp|Q8E026|MSRB_STRA5 Peptide methionine sulfoxide reductase MsrB OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=msrB PE=3 SV=1 62 181 2.0E-11
sp|Q8E5Q9|MSRB_STRA3 Peptide methionine sulfoxide reductase MsrB OS=Streptococcus agalactiae serotype III (strain NEM316) GN=msrB PE=3 SV=1 62 181 2.0E-11
sp|Q3K1F5|MSRB_STRA1 Peptide methionine sulfoxide reductase MsrB OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=msrB PE=3 SV=1 62 181 2.0E-11
sp|E6ESW1|MSRB_ENTFT Peptide methionine sulfoxide reductase MsrB OS=Enterococcus faecalis (strain TX4000 / JH2-2) GN=msrB PE=1 SV=2 62 180 2.0E-11
sp|P0DM32|MSRB_ENTFA Peptide methionine sulfoxide reductase MsrB OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=msrB PE=3 SV=1 62 180 2.0E-11
sp|P14930|MSRAB_NEIGO Peptide methionine sulfoxide reductase MsrA/MsrB OS=Neisseria gonorrhoeae GN=msrAB PE=1 SV=2 62 180 2.0E-11
sp|Q9K1N8|MSRAB_NEIMB Peptide methionine sulfoxide reductase MsrA/MsrB OS=Neisseria meningitidis serogroup B (strain MC58) GN=msrAB PE=3 SV=1 62 180 3.0E-11
sp|Q9JWM8|MSRAB_NEIMA Peptide methionine sulfoxide reductase MsrA/MsrB OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=msrAB PE=1 SV=1 62 180 3.0E-11
sp|Q5XCD0|MSRB_STRP6 Peptide methionine sulfoxide reductase MsrB OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=msrB PE=3 SV=1 77 181 5.0E-11
sp|A8FEA3|MSRB_BACP2 Peptide methionine sulfoxide reductase MsrB OS=Bacillus pumilus (strain SAFR-032) GN=msrB PE=3 SV=1 72 181 7.0E-11
sp|Q9ZNJ9|MSRB_CLOHI Peptide methionine sulfoxide reductase MsrB OS=Clostridium histolyticum GN=msrB PE=3 SV=1 62 181 7.0E-11
sp|Q2YY44|MSRB_STAAB Peptide methionine sulfoxide reductase MsrB OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=msrB PE=3 SV=1 69 189 7.0E-11
sp|Q8XJZ6|MSRB_CLOPE Peptide methionine sulfoxide reductase MsrB OS=Clostridium perfringens (strain 13 / Type A) GN=msrB PE=3 SV=1 71 181 7.0E-11
sp|Q0TPZ6|MSRB_CLOP1 Peptide methionine sulfoxide reductase MsrB OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) GN=msrB PE=3 SV=1 71 181 7.0E-11
sp|P45213|MSRAB_HAEIN Peptide methionine sulfoxide reductase MsrA/MsrB OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=msrAB PE=1 SV=1 59 181 7.0E-11
sp|O83641|MSRAB_TREPA Peptide methionine sulfoxide reductase MsrB/MsrA OS=Treponema pallidum (strain Nichols) GN=msrAB PE=3 SV=1 72 181 7.0E-11
sp|A7Z5S1|MSRB_BACMF Peptide methionine sulfoxide reductase MsrB OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=msrB PE=3 SV=1 72 181 8.0E-11
[Show less]

GO

GO Term Description Terminal node
GO:0016747 acyltransferase activity, transferring groups other than amino-acyl groups Yes
GO:0033743 peptide-methionine (R)-S-oxide reductase activity Yes
GO:0016667 oxidoreductase activity, acting on a sulfur group of donors No
GO:0003674 molecular_function No
GO:0016671 oxidoreductase activity, acting on a sulfur group of donors, disulfide as acceptor No
GO:0016740 transferase activity No
GO:0003824 catalytic activity No
GO:0016491 oxidoreductase activity No
GO:0016746 acyltransferase activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 20 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|1743
MRFSPLFATGFSLLSRILYRPPTPLRLVEARLRPVTPLRSMSILGALFGTSASSSKMTYPDKRSEDEWRAVLSKE
QFRILREKGTEAPGSGTLNAHYPEHGVYSCAGCCKPLYKASHKFKSGCGWPAYFDSIPGAVTRHEDRTLGTTRTE
IVCSNCGGHLGHVFKGEGYSTPTDERHCVNTLERLSQIGGQLSANISGSGRQRLLEKRSDDVVVVACCRSAFTKG
GKGGFKDTQAADIMAGVLREVADRARIDKALVEDICVGTVLAPGGGATEMRAASFVAGYPETTAVRTLNRQCSSG
LQACVDVANQIKTGMIEVGIGAGVESMSLHYGPSAVTEFSESLENNPEAANCKVPMGVLSEDMAKDLNITRADQD
AFAASSYQKAVQAQRQGLFDEEIVPLKARYEDPKSGETKEITVAKDDGIRDGITPESLGKIRPAFAADGSIHAGN
ASQISDGAAAVLMMRRSTSERLGLSPIGKFVCAAVVGVKPLLMGQGPWKAIPRALELAGIAKDDVDIFEINEAFA
SQCLWCANQLGIPHEKINPKGGAIAFGHPLGCTGARQVSTLLYELRRTGKKVGNTSMCVGTGMGMSAVWVAE*
Coding >Ophun1|1743
ATGCGCTTCTCGCCACTGTTCGCCACGGGATTCTCCCTCCTCTCGCGCATCCTCTACCGGCCCCCGACGCCGCTC
CGTCTCGTCGAGGCCCGTCTCCGCCCCGTGACTCCCTTGCGATCCATGTCCATCCTGGGCGCCCTCTTCGGCACG
TCAGCATCCTCGTCCAAGATGACGTACCCCGACAAGCGATCCGAAGACGAATGGCGCGCCGTCCTCAGCAAAGAG
CAGTTCCGCATCCTCCGCGAAAAGGGCACCGAGGCCCCGGGCTCGGGCACCTTGAACGCCCACTACCCCGAGCAC
GGCGTCTACAGCTGCGCCGGCTGCTGCAAGCCACTGTACAAGGCCAGCCACAAGTTCAAGTCGGGCTGCGGTTGG
CCTGCCTACTTTGACAGCATCCCGGGGGCCGTGACGCGCCACGAGGACCGCACGCTCGGGACGACGCGCACGGAG
ATTGTCTGCTCCAACTGCGGCGGCCATCTGGGACACGTCTTCAAGGGAGAGGGCTATTCGACGCCGACGGATGAG
CGTCATTGTGTTAATACTCTTGAGAGACTCTCGCAGATCGGCGGACAGCTGTCAGCCAACATCTCCGGCAGCGGC
CGTCAACGACTCCTGGAGAAGCGGTCCGACGATGTCGTCGTCGTAGCCTGCTGCCGAAGCGCCTTCACCAAAGGC
GGAAAGGGCGGCTTCAAAGACACGCAGGCCGCCGACATCATGGCCGGTGTTCTACGAGAAGTGGCAGACCGGGCA
CGTATTGACAAGGCACTCGTCGAAGACATTTGCGTCGGCACCGTCCTGGCTCCCGGGGGGGGAGCGACGGAGATG
CGGGCTGCCAGTTTCGTAGCCGGCTATCCCGAGACGACGGCGGTGCGGACGCTGAACCGTCAGTGCTCTTCTGGT
CTTCAGGCTTGCGTCGATGTTGCGAATCAGATCAAGACGGGCATGATTGAGGTTGGTATCGGTGCTGGCGTCGAG
AGCATGTCTCTTCACTACGGACCCTCTGCCGTCACCGAGTTTTCGGAAAGCTTGGAAAACAACCCCGAGGCCGCC
AACTGCAAAGTCCCCATGGGCGTCCTCTCCGAAGACATGGCCAAGGACCTCAACATCACCCGAGCCGACCAAGAC
GCCTTCGCCGCATCCTCGTACCAAAAGGCCGTTCAGGCCCAACGCCAGGGTCTCTTCGACGAGGAAATCGTCCCG
CTCAAGGCCCGGTACGAGGACCCCAAGTCTGGCGAGACCAAGGAAATCACCGTGGCCAAGGACGACGGCATCCGC
GACGGCATCACCCCCGAGTCGCTGGGAAAGATCCGTCCGGCCTTTGCGGCAGATGGAAGCATTCACGCTGGCAAC
GCGAGTCAGATCTCTGATGGTGCCGCCGCTGTTCTCATGATGCGTCGCTCTACATCCGAACGACTCGGTCTGTCG
CCCATTGGCAAGTTCGTCTGCGCCGCCGTCGTTGGTGTCAAGCCGCTTCTCATGGGTCAGGGCCCTTGGAAGGCC
ATTCCGAGAGCCCTCGAGTTGGCTGGCATTGCTAAGGATGACGTGGACATTTTCGAGATCAACGAGGCTTTCGCG
AGCCAGTGTTTGTGGTGCGCCAACCAGCTTGGCATCCCCCATGAAAAGATCAATCCCAAGGGGGGCGCCATTGCG
TTCGGTCACCCTCTCGGCTGCACTGGAGCCCGTCAGGTCTCGACGCTCCTGTACGAGCTCAGGAGGACGGGCAAA
AAGGTGGGCAACACGTCCATGTGCGTGGGCACAGGTATGGGAATGAGTGCCGTGTGGGTAGCCGAATAA
Transcript >Ophun1|1743
ATGCGCTTCTCGCCACTGTTCGCCACGGGATTCTCCCTCCTCTCGCGCATCCTCTACCGGCCCCCGACGCCGCTC
CGTCTCGTCGAGGCCCGTCTCCGCCCCGTGACTCCCTTGCGATCCATGTCCATCCTGGGCGCCCTCTTCGGCACG
TCAGCATCCTCGTCCAAGATGACGTACCCCGACAAGCGATCCGAAGACGAATGGCGCGCCGTCCTCAGCAAAGAG
CAGTTCCGCATCCTCCGCGAAAAGGGCACCGAGGCCCCGGGCTCGGGCACCTTGAACGCCCACTACCCCGAGCAC
GGCGTCTACAGCTGCGCCGGCTGCTGCAAGCCACTGTACAAGGCCAGCCACAAGTTCAAGTCGGGCTGCGGTTGG
CCTGCCTACTTTGACAGCATCCCGGGGGCCGTGACGCGCCACGAGGACCGCACGCTCGGGACGACGCGCACGGAG
ATTGTCTGCTCCAACTGCGGCGGCCATCTGGGACACGTCTTCAAGGGAGAGGGCTATTCGACGCCGACGGATGAG
CGTCATTGTGTTAATACTCTTGAGAGACTCTCGCAGATCGGCGGACAGCTGTCAGCCAACATCTCCGGCAGCGGC
CGTCAACGACTCCTGGAGAAGCGGTCCGACGATGTCGTCGTCGTAGCCTGCTGCCGAAGCGCCTTCACCAAAGGC
GGAAAGGGCGGCTTCAAAGACACGCAGGCCGCCGACATCATGGCCGGTGTTCTACGAGAAGTGGCAGACCGGGCA
CGTATTGACAAGGCACTCGTCGAAGACATTTGCGTCGGCACCGTCCTGGCTCCCGGGGGGGGAGCGACGGAGATG
CGGGCTGCCAGTTTCGTAGCCGGCTATCCCGAGACGACGGCGGTGCGGACGCTGAACCGTCAGTGCTCTTCTGGT
CTTCAGGCTTGCGTCGATGTTGCGAATCAGATCAAGACGGGCATGATTGAGGTTGGTATCGGTGCTGGCGTCGAG
AGCATGTCTCTTCACTACGGACCCTCTGCCGTCACCGAGTTTTCGGAAAGCTTGGAAAACAACCCCGAGGCCGCC
AACTGCAAAGTCCCCATGGGCGTCCTCTCCGAAGACATGGCCAAGGACCTCAACATCACCCGAGCCGACCAAGAC
GCCTTCGCCGCATCCTCGTACCAAAAGGCCGTTCAGGCCCAACGCCAGGGTCTCTTCGACGAGGAAATCGTCCCG
CTCAAGGCCCGGTACGAGGACCCCAAGTCTGGCGAGACCAAGGAAATCACCGTGGCCAAGGACGACGGCATCCGC
GACGGCATCACCCCCGAGTCGCTGGGAAAGATCCGTCCGGCCTTTGCGGCAGATGGAAGCATTCACGCTGGCAAC
GCGAGTCAGATCTCTGATGGTGCCGCCGCTGTTCTCATGATGCGTCGCTCTACATCCGAACGACTCGGTCTGTCG
CCCATTGGCAAGTTCGTCTGCGCCGCCGTCGTTGGTGTCAAGCCGCTTCTCATGGGTCAGGGCCCTTGGAAGGCC
ATTCCGAGAGCCCTCGAGTTGGCTGGCATTGCTAAGGATGACGTGGACATTTTCGAGATCAACGAGGCTTTCGCG
AGCCAGTGTTTGTGGTGCGCCAACCAGCTTGGCATCCCCCATGAAAAGATCAATCCCAAGGGGGGCGCCATTGCG
TTCGGTCACCCTCTCGGCTGCACTGGAGCCCGTCAGGTCTCGACGCTCCTGTACGAGCTCAGGAGGACGGGCAAA
AAGGTGGGCAACACGTCCATGTGCGTGGGCACAGGTATGGGAATGAGTGCCGTGTGGGTAGCCGAATAA
Gene >Ophun1|1743
ATGCGCTTCTCGCCACTGTTCGCCACGGGATTCTCCCTCCTCTCGCGCATCCTCTACCGGCCCCCGACGCCGCTC
CGTCTCGTCGAGGCCCGTCTCCGCCCCGTGACTCCCTTGCGATCCATGTCCATCCTGGGCGCCCTCTTCGGCACG
TCAGCATCCTCGTCCAAGATGACGTACCCCGACAAGCGATCCGAAGACGAATGGCGCGCCGTCCTCAGCAAAGGT
TCTGCCCCTTGTTCCCACAATGTGGACATTGAGAGATGGGACACTCATCAGTCTCCTAACAGAGCAGTTCCGCAT
CCTCCGCGAAAAGGGCACCGAGGCCCCGGGCTCGGGCACCTTGAACGCCCACTACCCCGAGCACGGCGTCTACAG
CTGCGCCGGCTGCTGCAAGCCACTGTACAAGGCCAGCCACAAGTTCAAGTCGGGCTGCGGTTGGCCTGCCTACTT
TGACAGCATCCCGGGGGCCGTGACGCGCCACGAGGACCGCACGCTCGGGACGACGCGCACGGAGATTGTCTGCTC
CAACTGCGGCGGCCATCTGGGACACGTCTTCAAGGGAGAGGGCTATTCGACGCCGACGGATGAGCGTCATTGTGT
TAATAGTGTGAGCTTGACCTTTTCGCCTGAGGATGGGGACGCGGCTGGGGGCGGGAGCGGCAGCAAGGTGTAGAC
GGGGAAGAGAACCGGGCAGGTCTTTGTATCTAGGACCTGTACGAACTACTTGATCTTTTGAAAATTCACCACCCA
TCCATCCGTCTATATAATCTCCAGCTCGCTCCGTCATCGTCGGCCCGGACCCTCCGCTCAAATACCTCCCGCTCC
CCAGACAAAAGCCCCGTGGCATGTGACAGCCGCTAGCCGTTGGTGGGTCTCTTCCTCGGCCGAGAGTCTGTCTTG
TACCTCGCCAGCCAGCCAGCAGCGAAAGGGTACAAGCCCCATTTCTCGGCCGAGGCCCGGGGCCCGGGAGCTTGC
GGTCATGTTGGGCCTATAAACTGGCCTCGTCCCTCGGCAAGAAACGTCATCCTCTCTCCAAAGCTGCCAGTAACG
ATATCTCGGTTCAGAACGCGGAAATCAGTCACCATGGGCGGTATGGCTATCCCCTTTCCTGCTCTGGCTATGTCT
CCTTTACAGCATCCGTCTCTCTCTCTTCCAGCCACGCTGACCGGAGACGCAGCTCTTGAGAGACTCTCGCAGATC
GGCGGACAGCTGTCAGCCAACATCTCCGGCAGCGGCCGTCAACGACTCCTGGAGAAGCGGTCCGACGATGTACAT
TCATCCCCTCCCTAGGTACCCTACTTCACGATCCCCAGACTGACCCCCCCCATCCCAGGTCGTCGTCGTAGCCTG
CTGCCGAAGCGCCTTCACCAAAGGCGGAAAGGGCGGCTTCAAAGACACGCAGGCCGCCGACATCATGGCCGGTGT
TCTACGAGAAGTGGCAGACCGGGCACGTATTGACAAGGCACTCGTCGAAGACATTTGCGTCGGCACCGTCCTGGC
TCCCGGGGGGGGAGCGACGGAGATGCGGGCTGCCAGTTTCGTAGCCGGCTATCCCGAGACGACGGCGGTGCGGAC
GCTGAACCGTCAGTGCTCTTCTGGTCTTCAGGCTTGCGTCGATGTTGCGAATCAGATCAAGACGGGCATGATTGA
GGTTGGTATCGGTGCTGGCGTCGAGAGCATGTCTCTTCACTACGGGTACGTTGGGATCCTCAACACCTCGACCAA
GTGATACTGATACACCCCAGACCCTCTGCCGTCACCGAGTTTTCGGAAAGCTTGGAAAACAACCCCGAGGCCGCC
AACTGCAAAGTCCCCATGGGCGTCCTCTCCGAAGACATGGCCAAGGACCTCAACATCACCCGAGCCGACCAAGAC
GCCTTCGCCGCATCCTCGTACCAAAAGGCCGTTCAGGCCCAACGCCAGGGTCTCTTCGACGAGGAAATCGTCCCG
CTCAAGGCCCGGTACGAGGACCCCAAGTCTGGCGAGACCAAGGAAATCACCGTGGCCAAGGACGACGGCATCCGC
GACGGCATCACCCCCGAGTCGCTGGGAAAGATCCGTCCGGCCTTTGCGGCAGATGGAAGCATTCACGCTGGCAAC
GCGAGTCAGATCTCTGATGGTGCCGCCGCTGTTCTCATGATGCGTCGCTCTACATCCGAACGACTCGGTCTGTCG
CCCATTGGCAAGTTCGTCTGCGCCGCCGTCGTTGGTGTCAAGCCGCTTCTCATGGGTCAGGGCCCTTGGAAGGCC
ATTCCGAGAGCCCTCGAGTTGGCTGGCATTGCTAAGGATGACGTGGACATTTTCGAGATCAACGAGGCTTTCGCG
AGCCAGTGTTTGTGGTGCGCCAACCAGCTTGGCATCCCCCATGAAAAGATCAATCCCAAGGGGGGCGCCATTGCG
TTCGGTCACCCTCTCGGCTGCACTGGAGCCCGTCAGGTCTCGACGCTCCTGTACGAGCTCAGGAGGACGGGCAAA
AAGGTGGGCAACACGTCCATGTGCGTGGGCACAGGTATGGGAATGAGTGCCGTGTGGGTAGCCGAATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail