Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|1738
Gene name
LocationContig_176:9494..14357
Strand-
Gene length (bp)4863
Transcript length (bp)4653
Coding sequence length (bp)4653
Protein length (aa) 1551

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08696 Dna2 DNA replication factor Dna2 1.1E-67 476 677
PF13087 AAA_12 AAA domain 6.8E-49 1213 1441
PF13086 AAA_11 AAA domain 1.3E-13 1037 1124
PF13086 AAA_11 AAA domain 5.0E-15 1142 1204
PF13604 AAA_30 AAA domain 3.2E-16 1036 1242
PF13245 AAA_19 AAA domain 6.6E-12 1041 1203
PF01930 Cas_Cas4 Domain of unknown function DUF83 6.0E-08 685 788

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9URU2|DNA2_SCHPO DNA replication ATP-dependent helicase/nuclease dna2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dna2 PE=1 SV=2 357 1490 0.0E+00
sp|P38859|DNA2_YEAST DNA replication ATP-dependent helicase/nuclease DNA2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DNA2 PE=1 SV=1 475 1511 0.0E+00
sp|Q8QHA5|DNA2_XENLA DNA replication ATP-dependent helicase/nuclease DNA2 OS=Xenopus laevis GN=dna2 PE=1 SV=1 428 1474 7.0E-179
sp|E1BMP7|DNA2_BOVIN DNA replication ATP-dependent helicase/nuclease DNA2 OS=Bos taurus GN=DNA2 PE=3 SV=3 421 1480 4.0E-168
sp|Q5ZKG3|DNA2_CHICK DNA replication ATP-dependent helicase/nuclease DNA2 OS=Gallus gallus GN=DNA2 PE=2 SV=2 446 1475 5.0E-167
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9URU2|DNA2_SCHPO DNA replication ATP-dependent helicase/nuclease dna2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dna2 PE=1 SV=2 357 1490 0.0E+00
sp|P38859|DNA2_YEAST DNA replication ATP-dependent helicase/nuclease DNA2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DNA2 PE=1 SV=1 475 1511 0.0E+00
sp|Q8QHA5|DNA2_XENLA DNA replication ATP-dependent helicase/nuclease DNA2 OS=Xenopus laevis GN=dna2 PE=1 SV=1 428 1474 7.0E-179
sp|E1BMP7|DNA2_BOVIN DNA replication ATP-dependent helicase/nuclease DNA2 OS=Bos taurus GN=DNA2 PE=3 SV=3 421 1480 4.0E-168
sp|Q5ZKG3|DNA2_CHICK DNA replication ATP-dependent helicase/nuclease DNA2 OS=Gallus gallus GN=DNA2 PE=2 SV=2 446 1475 5.0E-167
sp|D3ZG52|DNA2_RAT DNA replication ATP-dependent helicase/nuclease DNA2 OS=Rattus norvegicus GN=Dna2 PE=3 SV=1 443 1480 3.0E-166
sp|Q6ZQJ5|DNA2_MOUSE DNA replication ATP-dependent helicase/nuclease DNA2 OS=Mus musculus GN=Dna2 PE=1 SV=2 485 1480 7.0E-166
sp|P51530|DNA2_HUMAN DNA replication ATP-dependent helicase/nuclease DNA2 OS=Homo sapiens GN=DNA2 PE=1 SV=3 427 1480 3.0E-165
sp|F6QXW0|DNA2_XENTR DNA replication ATP-dependent helicase/nuclease DNA2 OS=Xenopus tropicalis GN=dna2 PE=3 SV=1 428 1474 6.0E-111
sp|Q9FJR0|RENT1_ARATH Regulator of nonsense transcripts 1 homolog OS=Arabidopsis thaliana GN=UPF1 PE=1 SV=2 1037 1455 3.0E-39
sp|Q9VYS3|RENT1_DROME Regulator of nonsense transcripts 1 homolog OS=Drosophila melanogaster GN=Upf1 PE=1 SV=2 1037 1455 2.0E-38
sp|P38935|SMBP2_HUMAN DNA-binding protein SMUBP-2 OS=Homo sapiens GN=IGHMBP2 PE=1 SV=3 1037 1507 5.0E-38
sp|O94247|HCS1_SCHPO DNA polymerase alpha-associated DNA helicase A OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=hcs1 PE=3 SV=1 1037 1474 8.0E-38
sp|Q9EPU0|RENT1_MOUSE Regulator of nonsense transcripts 1 OS=Mus musculus GN=Upf1 PE=1 SV=2 1032 1444 1.0E-37
sp|Q92900|RENT1_HUMAN Regulator of nonsense transcripts 1 OS=Homo sapiens GN=UPF1 PE=1 SV=2 1032 1444 2.0E-37
sp|P40694|SMBP2_MOUSE DNA-binding protein SMUBP-2 OS=Mus musculus GN=Ighmbp2 PE=1 SV=1 822 1444 3.0E-37
sp|Q9HEH1|RENT1_NEUCR Regulator of nonsense transcripts 1 homolog OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=2E4.130 PE=3 SV=1 1037 1444 8.0E-37
sp|Q9EQN5|SMBP2_RAT DNA-binding protein SMUBP-2 OS=Rattus norvegicus GN=Ighmbp2 PE=1 SV=1 1036 1528 3.0E-35
sp|Q60560|SMBP2_MESAU DNA-binding protein SMUBP-2 OS=Mesocricetus auratus GN=IGHMBP2 PE=1 SV=1 822 1444 3.0E-35
sp|P30771|NAM7_YEAST ATP-dependent helicase NAM7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NAM7 PE=1 SV=1 1028 1455 2.0E-34
sp|O76512|RENT1_CAEEL Regulator of nonsense transcripts 1 OS=Caenorhabditis elegans GN=smg-2 PE=1 SV=1 1030 1474 1.0E-32
sp|P34243|HCS1_YEAST DNA polymerase alpha-associated DNA helicase A OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HCS1 PE=1 SV=1 1036 1452 1.0E-32
sp|Q54I89|RENT1_DICDI Regulator of nonsense transcripts 1 OS=Dictyostelium discoideum GN=upf1 PE=3 SV=1 1019 1455 2.0E-32
sp|Q98TR3|RENT1_TAKRU Putative regulator of nonsense transcripts 1 OS=Takifugu rubripes GN=rent1 PE=3 SV=1 1037 1455 3.0E-31
sp|Q09820|RENT1_SCHPO ATP-dependent helicase upf1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=upf1 PE=3 SV=2 998 1467 4.0E-30
sp|Q57568|Y104_METJA Uncharacterized ATP-dependent helicase MJ0104 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ0104 PE=3 SV=1 1164 1446 3.0E-28
sp|Q0VGT4|ZGRF1_MOUSE Protein ZGRF1 OS=Mus musculus GN=Zgrf1 PE=1 SV=2 1006 1463 1.0E-25
sp|B6SFA4|MAA3_ARATH Probable helicase MAGATAMA 3 OS=Arabidopsis thaliana GN=MAA3 PE=2 SV=1 1083 1445 8.0E-25
sp|Q86YA3|ZGRF1_HUMAN Protein ZGRF1 OS=Homo sapiens GN=ZGRF1 PE=2 SV=3 1044 1463 1.0E-23
sp|O94387|YGSA_SCHPO Uncharacterized ATP-dependent helicase C29A10.10c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC29A10.10c PE=3 SV=1 1146 1448 1.0E-23
sp|Q92355|SEN1_SCHPO Helicase sen1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sen1 PE=1 SV=1 1146 1448 6.0E-23
sp|Q00416|SEN1_YEAST Helicase SEN1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SEN1 PE=1 SV=2 1146 1447 2.0E-20
sp|Q8GYD9|SDE3_ARATH Probable RNA helicase SDE3 OS=Arabidopsis thaliana GN=SDE3 PE=1 SV=1 1037 1440 1.0E-18
sp|Q9BXT6|M10L1_HUMAN Putative helicase Mov10l1 OS=Homo sapiens GN=MOV10L1 PE=2 SV=1 1005 1444 1.0E-17
sp|A2AKX3|SETX_MOUSE Probable helicase senataxin OS=Mus musculus GN=Setx PE=1 SV=1 1164 1472 1.0E-17
sp|Q7Z333|SETX_HUMAN Probable helicase senataxin OS=Homo sapiens GN=SETX PE=1 SV=4 1164 1446 4.0E-17
sp|Q99MV5|M10L1_MOUSE Putative helicase Mov10l1 OS=Mus musculus GN=Mov10l1 PE=1 SV=1 1036 1444 1.0E-16
sp|Q6J5K9|ARMI_DROME Probable RNA helicase armi OS=Drosophila melanogaster GN=armi PE=1 SV=4 1034 1440 3.0E-16
sp|Q86AS0|Y4399_DICDI Probable helicase DDB_G0274399 OS=Dictyostelium discoideum GN=DDB_G0274399 PE=3 SV=1 1146 1444 2.0E-14
sp|P32644|ECM32_YEAST Putative ATP-dependent RNA helicase ECM32 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ECM32 PE=1 SV=1 1168 1470 2.0E-14
sp|Q9P2E3|ZNFX1_HUMAN NFX1-type zinc finger-containing protein 1 OS=Homo sapiens GN=ZNFX1 PE=2 SV=2 1168 1444 3.0E-13
sp|Q09449|YQ12_CAEEL Uncharacterized ATP-dependent helicase C05C10.2 OS=Caenorhabditis elegans GN=C05C10.2 PE=3 SV=1 1165 1448 5.0E-13
sp|Q9BYK8|HELZ2_HUMAN Helicase with zinc finger domain 2 OS=Homo sapiens GN=HELZ2 PE=1 SV=6 980 1445 1.0E-12
sp|Q8R151|ZNFX1_MOUSE NFX1-type zinc finger-containing protein 1 OS=Mus musculus GN=Znfx1 PE=1 SV=3 1168 1444 6.0E-12
sp|Q1LXK5|M10B2_DANRE Putative helicase mov-10-B.2 OS=Danio rerio GN=mov10b.2 PE=3 SV=1 1056 1474 1.0E-11
sp|Q6DFV5|HELZ_MOUSE Probable helicase with zinc finger domain OS=Mus musculus GN=Helz PE=1 SV=2 1056 1255 4.0E-10
sp|Q6NYU2|HELZ_DANRE Probable helicase with zinc finger domain OS=Danio rerio GN=helz PE=2 SV=1 1037 1444 6.0E-10
sp|P42694|HELZ_HUMAN Probable helicase with zinc finger domain OS=Homo sapiens GN=HELZ PE=1 SV=2 1056 1255 7.0E-10
sp|O74465|HRR1_SCHPO Helicase required for RNAi-mediated heterochromatin assembly 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=hrr1 PE=1 SV=2 1143 1448 7.0E-09
[Show less]

GO

GO Term Description Terminal node
GO:0004386 helicase activity Yes
GO:0140657 ATP-dependent activity No
GO:0003674 molecular_function No
GO:0140640 catalytic activity, acting on a nucleic acid No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 30 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|1738
MPLHKAHSERLGQRKSRQPWQRSNSHPVDLQTPKSKPSLPVSEVTKDKLSRFQYHPREVDSTGQDAGRTSSSTAN
DDSSTGRTRLNWRDLMDPGIVAEDDTDTSPSDKVLWNNKQDSLYVSALSPMLARKRKRARSSSPVSSPLADKPEP
PTVDVGMLREALKLGHADPTMELWDRYSYSLNGPENAKSSPGVVKPALEQLMISSSPKPRGDGSAPKTDFGLRRA
LTCGLNWPKRRKNSKTERVRVREEHKESESLTKPSLVTELLDTVDQELEDASVQPVQDESPSLNKRRLPPNHHSS
PCRAVAGGGVVADLPSSDYGDDDFDDDTLTELEASLIAGDGTKAPSNTNQGMTEASTANDDDIELVDHGSLKPDQ
QATRCSDAPITPPGRPQNKDAQKSPGDEFEDDFDADIDFDAVELAATQTVQQRRVVPPATKTEPKAKVIQRYLVT
SVVEGDYIDELGHTRPEKILIIQADGSKAARTVHLRGAWFDTPAHTESYVHVIGKFSARGQCFVDDAKNLLILHP
DQLLSATVVADSFGCMRRAVLQDRVKATSEATPPLVYGTMLHEIFQEALLANRWDLAFLSGIIDRKVEEHVEDLY
RIKIGIAAATEHLLSKMTELSYWAKTFVSAAPKTDAVVEDRNGKTAAMAVRKLLDVEEHVWSPMYGLKGNIDATV
EVVMADGKEKRTLTVPFELKTGRQANSSHMAQTALYTLLLADRYDIDIACGILYYMETSKTMRIPAVRHELRHMI
MQRNQLACYIRERSVKLPPMLKNKHVCGRCYAKTSCFIYHRLADEGDAESSGMKDKFDELVRHLTPAHRDFFVRW
ENLLTKEEKDSQKTKRELWTMTSSEREKKSRCFADVIIEEGSASETAASGRINRFHYSFVKRLPQPKFSFLESEL
STGEPVVVSDEEGHFALAIGYVTSVRKQRISVAVDRRLHNARIRQPGFDEKDNQVFASIMEVQPEARKAPVQSQP
MRYRLDKDEFSNGMATVRNNLVQMMANDVPAAVKMRRLVVDLEAPRFKETSTQYSVAQGETLNVDQERAIDKVMR
AQDYALVLGMPGTGKTTTIAHIIRALTSQGKSVLLTSHTHTAVDNILLKLKADDIPVLRLGAPAKIHAEVQGFAR
LAATTRKTFDDIRDAWHGTPVVATTCLGINHALFLERSFDYCIVDEASQITLPICAGPIRMASAFVLVGDHNQLP
PVVRNSEAREGGLDVSLFKLLSDAHPESVVNLEHQYRMCEDIMTLSNTLIYDGRLRCGYEALRRRKLDVPALKAL
RNFHHDPASLLKRPTPRSFCTGPTPSRCWLYDVIEGEARVRFVNTDTIRPPVHEEAQGKRIVNRTEVRIVGQLVE
ALLATGVPADEVGVMTHYRAQLGLLHHRLRRHSAVEMHTTDRFQGRDKDVMVVSLVRCNEARNIGDLLRDWRRIN
VAFTRARAKLLVIGSKSTLQQADNGMLARFVALMESRDWVYDLPADAVEAHVFDDETWSESSPCSPQPVGGEVET
GKKPSSGVADKENRRRGSPKKARVGARALLRGKPVMRDILADMMNGAEMR*
Coding >Ophun1|1738
ATGCCGCTACATAAAGCCCACTCTGAACGTCTTGGGCAGCGGAAAAGCCGACAGCCATGGCAACGGTCCAACAGT
CACCCCGTCGATTTGCAGACTCCAAAATCGAAGCCTTCTCTGCCCGTGTCGGAGGTGACCAAGGACAAGCTCAGC
AGGTTTCAGTACCACCCCCGAGAAGTCGACTCGACGGGCCAAGATGCCGGACGAACCTCGTCTTCGACGGCCAAC
GATGACTCTTCCACGGGGAGGACCAGACTGAACTGGCGGGACCTCATGGATCCTGGTATTGTGGCCGAGGACGAC
ACCGACACGTCGCCCAGTGACAAAGTCCTATGGAACAACAAGCAAGACTCGCTCTACGTCTCAGCACTGTCTCCC
ATGCTGGCTCGGAAGAGGAAGCGAGCCAGGAGCTCGTCGCCCGTTTCGTCTCCGCTGGCAGACAAGCCCGAGCCG
CCGACCGTCGACGTCGGCATGTTGCGAGAGGCTCTGAAGCTGGGACACGCCGATCCGACGATGGAGCTGTGGGAT
CGCTACTCTTACTCGCTCAACGGGCCCGAGAACGCGAAGTCGTCCCCGGGTGTCGTGAAGCCGGCTCTCGAGCAG
TTGATGATATCGTCCTCTCCGAAGCCGCGTGGTGATGGTTCGGCGCCCAAGACCGACTTTGGCTTGCGACGCGCC
TTGACGTGTGGTCTGAATTGGCCAAAGAGGCGGAAGAACTCCAAAACGGAGCGAGTTCGGGTGAGGGAAGAACAT
AAAGAGTCGGAGTCTTTGACCAAGCCGTCGCTCGTCACAGAACTGCTCGACACGGTGGATCAGGAACTTGAAGAT
GCCAGTGTCCAGCCCGTGCAGGACGAGTCTCCGTCGCTCAACAAGCGAAGGCTGCCTCCGAATCATCACAGCTCT
CCGTGTCGGGCGGTTGCCGGTGGCGGCGTCGTTGCGGATCTGCCTTCTTCGGACTACGGCGATGACGACTTCGAC
GACGATACGCTTACGGAACTCGAGGCGAGTCTCATTGCCGGAGACGGGACGAAAGCGCCGTCGAATACGAATCAG
GGGATGACAGAGGCGTCGACAGCAAACGATGATGACATTGAGCTCGTTGACCATGGCAGCCTGAAGCCAGACCAG
CAGGCCACACGCTGTTCAGATGCCCCTATAACGCCTCCTGGGCGACCTCAAAACAAGGATGCCCAGAAGAGCCCT
GGAGATGAGTTCGAAGACGATTTCGACGCGGACATTGACTTTGATGCCGTTGAGCTAGCAGCGACTCAAACAGTG
CAACAGCGGCGCGTTGTGCCCCCAGCGACCAAAACGGAACCAAAAGCCAAGGTCATCCAGCGATACTTAGTAACG
AGTGTGGTAGAGGGCGACTACATCGATGAGCTGGGTCACACCCGGCCCGAGAAGATCCTCATCATCCAGGCCGAC
GGCTCGAAGGCAGCTCGGACGGTGCATCTGAGAGGCGCTTGGTTCGACACGCCGGCTCACACCGAGTCGTACGTT
CACGTCATCGGCAAATTCTCCGCCAGGGGACAGTGCTTTGTGGATGACGCGAAGAATCTGTTGATCTTGCACCCC
GATCAGCTCCTGTCTGCCACCGTCGTCGCCGACTCCTTTGGCTGCATGCGCCGCGCTGTTCTCCAGGATCGGGTC
AAGGCTACGAGCGAAGCAACGCCGCCTCTCGTCTACGGGACCATGCTTCACGAGATTTTTCAAGAAGCACTGCTC
GCCAACAGGTGGGATCTGGCTTTTCTCTCAGGGATTATCGACAGGAAAGTGGAGGAGCACGTCGAGGATCTGTAT
CGCATCAAGATTGGCATCGCGGCCGCCACTGAGCATCTGCTTTCCAAGATGACTGAGTTGAGCTACTGGGCAAAG
ACGTTTGTCTCCGCGGCGCCCAAGACCGATGCGGTGGTTGAGGACCGAAACGGCAAGACGGCTGCCATGGCTGTC
AGGAAGCTACTCGATGTCGAGGAGCACGTCTGGTCTCCGATGTATGGACTGAAAGGGAACATTGACGCCACTGTC
GAGGTCGTCATGGCAGACGGAAAGGAGAAACGGACCCTCACGGTTCCGTTCGAGTTGAAGACGGGGAGACAAGCG
AACAGCAGCCATATGGCGCAGACGGCGCTCTACACCCTGCTGCTGGCGGATCGGTACGACATCGACATCGCCTGC
GGCATCCTCTACTACATGGAGACCTCCAAGACGATGCGGATCCCGGCCGTACGGCATGAGCTGAGGCACATGATT
ATGCAGCGAAACCAACTGGCCTGCTATATCCGAGAGCGAAGCGTCAAGCTACCTCCCATGCTCAAGAACAAGCAC
GTGTGCGGGAGATGCTATGCCAAGACGTCTTGCTTCATATATCATCGACTGGCAGACGAGGGCGACGCTGAGTCG
AGCGGCATGAAGGACAAGTTTGACGAGCTCGTCCGGCACCTGACGCCTGCCCATCGTGACTTTTTCGTCCGTTGG
GAGAATCTCTTGACCAAGGAGGAAAAGGACAGCCAGAAGACCAAGAGGGAGCTGTGGACCATGACGAGCTCCGAG
CGGGAGAAGAAGTCTCGGTGCTTTGCCGACGTCATCATCGAAGAAGGGTCCGCCTCGGAGACGGCAGCCAGCGGA
CGGATCAACCGGTTCCACTACAGCTTTGTCAAGCGGCTTCCCCAGCCCAAGTTTTCGTTTCTCGAGTCGGAGCTG
TCGACGGGCGAGCCTGTCGTGGTATCGGACGAGGAGGGCCACTTTGCCTTGGCCATTGGCTATGTGACGTCGGTC
CGCAAGCAGAGGATCAGCGTCGCCGTCGACAGGCGTCTTCACAACGCCCGAATCAGGCAGCCCGGGTTTGACGAA
AAGGACAACCAGGTGTTTGCCAGCATCATGGAGGTACAGCCGGAAGCGAGGAAGGCTCCGGTCCAAAGTCAGCCG
ATGCGGTATCGACTGGACAAGGACGAGTTTAGCAACGGCATGGCGACGGTCAGGAACAACCTGGTGCAGATGATG
GCCAACGACGTGCCGGCGGCCGTCAAGATGAGGAGGCTGGTCGTCGACCTGGAGGCGCCTCGCTTCAAGGAGACG
TCGACTCAGTACAGCGTGGCCCAGGGCGAGACGCTCAACGTGGATCAGGAGAGGGCCATCGACAAGGTCATGAGG
GCGCAGGACTACGCTCTGGTGCTGGGCATGCCTGGGACGGGCAAGACGACGACGATTGCGCACATTATCCGGGCC
TTGACGTCGCAGGGCAAGAGTGTGCTGCTGACGTCCCACACGCACACGGCCGTGGACAACATCCTTCTGAAGCTC
AAGGCCGACGACATCCCCGTGCTCCGACTGGGGGCTCCGGCCAAGATCCACGCCGAAGTCCAGGGCTTTGCCCGT
CTGGCGGCCACGACGAGGAAGACGTTTGACGACATCAGGGACGCCTGGCACGGGACGCCCGTGGTGGCGACGACG
TGTCTGGGCATCAACCACGCCCTGTTCCTGGAGCGGTCCTTTGACTACTGCATCGTCGACGAGGCGTCACAGATT
ACGCTGCCCATCTGCGCCGGGCCCATCCGCATGGCGAGCGCCTTTGTCCTGGTCGGAGACCATAACCAGCTGCCC
CCCGTGGTGCGGAACTCGGAGGCTCGCGAGGGGGGGCTGGACGTGAGCCTGTTCAAGCTGCTGTCCGACGCTCAT
CCCGAGTCTGTCGTCAACCTGGAGCATCAGTACCGCATGTGTGAGGACATCATGACGCTGAGCAACACGCTCATC
TACGACGGGAGGCTTCGCTGCGGTTACGAGGCCCTCCGCAGACGGAAGCTCGACGTTCCGGCCCTGAAGGCGCTG
CGGAACTTCCATCACGACCCGGCCTCTCTCCTGAAGCGGCCCACGCCACGGTCCTTTTGCACGGGGCCGACGCCA
TCGCGGTGCTGGCTGTACGATGTCATCGAGGGCGAGGCTCGCGTCCGCTTCGTCAACACGGACACGATTCGTCCG
CCCGTCCACGAGGAGGCCCAGGGCAAGCGCATCGTCAACCGCACAGAGGTGCGCATCGTCGGCCAGCTCGTCGAG
GCCCTACTGGCAACGGGCGTGCCAGCCGACGAGGTAGGCGTCATGACGCATTACCGCGCCCAGCTCGGCCTCCTC
CACCACCGTCTCCGTCGCCACTCGGCCGTCGAGATGCACACGACGGACCGCTTCCAGGGCCGCGACAAGGACGTC
ATGGTCGTCAGCCTGGTGCGCTGCAACGAGGCCCGCAACATTGGCGACCTGCTGCGCGACTGGCGTCGTATAAAC
GTGGCCTTTACCCGCGCTCGTGCCAAGCTCCTCGTCATCGGCAGCAAGAGCACGCTCCAGCAGGCTGACAACGGC
ATGCTCGCCCGCTTCGTCGCCCTGATGGAGAGTCGCGATTGGGTGTACGACTTGCCGGCCGATGCGGTGGAAGCT
CACGTCTTTGACGACGAGACGTGGTCCGAATCGTCGCCTTGTTCGCCTCAGCCTGTTGGTGGTGAGGTGGAGACG
GGCAAGAAGCCATCGTCCGGGGTGGCGGATAAGGAGAATCGCAGGAGGGGGTCTCCTAAGAAGGCGAGGGTTGGG
GCTCGGGCTCTTCTGAGGGGGAAGCCTGTGATGAGGGATATACTTGCTGATATGATGAATGGGGCTGAGATGCGG
TGA
Transcript >Ophun1|1738
ATGCCGCTACATAAAGCCCACTCTGAACGTCTTGGGCAGCGGAAAAGCCGACAGCCATGGCAACGGTCCAACAGT
CACCCCGTCGATTTGCAGACTCCAAAATCGAAGCCTTCTCTGCCCGTGTCGGAGGTGACCAAGGACAAGCTCAGC
AGGTTTCAGTACCACCCCCGAGAAGTCGACTCGACGGGCCAAGATGCCGGACGAACCTCGTCTTCGACGGCCAAC
GATGACTCTTCCACGGGGAGGACCAGACTGAACTGGCGGGACCTCATGGATCCTGGTATTGTGGCCGAGGACGAC
ACCGACACGTCGCCCAGTGACAAAGTCCTATGGAACAACAAGCAAGACTCGCTCTACGTCTCAGCACTGTCTCCC
ATGCTGGCTCGGAAGAGGAAGCGAGCCAGGAGCTCGTCGCCCGTTTCGTCTCCGCTGGCAGACAAGCCCGAGCCG
CCGACCGTCGACGTCGGCATGTTGCGAGAGGCTCTGAAGCTGGGACACGCCGATCCGACGATGGAGCTGTGGGAT
CGCTACTCTTACTCGCTCAACGGGCCCGAGAACGCGAAGTCGTCCCCGGGTGTCGTGAAGCCGGCTCTCGAGCAG
TTGATGATATCGTCCTCTCCGAAGCCGCGTGGTGATGGTTCGGCGCCCAAGACCGACTTTGGCTTGCGACGCGCC
TTGACGTGTGGTCTGAATTGGCCAAAGAGGCGGAAGAACTCCAAAACGGAGCGAGTTCGGGTGAGGGAAGAACAT
AAAGAGTCGGAGTCTTTGACCAAGCCGTCGCTCGTCACAGAACTGCTCGACACGGTGGATCAGGAACTTGAAGAT
GCCAGTGTCCAGCCCGTGCAGGACGAGTCTCCGTCGCTCAACAAGCGAAGGCTGCCTCCGAATCATCACAGCTCT
CCGTGTCGGGCGGTTGCCGGTGGCGGCGTCGTTGCGGATCTGCCTTCTTCGGACTACGGCGATGACGACTTCGAC
GACGATACGCTTACGGAACTCGAGGCGAGTCTCATTGCCGGAGACGGGACGAAAGCGCCGTCGAATACGAATCAG
GGGATGACAGAGGCGTCGACAGCAAACGATGATGACATTGAGCTCGTTGACCATGGCAGCCTGAAGCCAGACCAG
CAGGCCACACGCTGTTCAGATGCCCCTATAACGCCTCCTGGGCGACCTCAAAACAAGGATGCCCAGAAGAGCCCT
GGAGATGAGTTCGAAGACGATTTCGACGCGGACATTGACTTTGATGCCGTTGAGCTAGCAGCGACTCAAACAGTG
CAACAGCGGCGCGTTGTGCCCCCAGCGACCAAAACGGAACCAAAAGCCAAGGTCATCCAGCGATACTTAGTAACG
AGTGTGGTAGAGGGCGACTACATCGATGAGCTGGGTCACACCCGGCCCGAGAAGATCCTCATCATCCAGGCCGAC
GGCTCGAAGGCAGCTCGGACGGTGCATCTGAGAGGCGCTTGGTTCGACACGCCGGCTCACACCGAGTCGTACGTT
CACGTCATCGGCAAATTCTCCGCCAGGGGACAGTGCTTTGTGGATGACGCGAAGAATCTGTTGATCTTGCACCCC
GATCAGCTCCTGTCTGCCACCGTCGTCGCCGACTCCTTTGGCTGCATGCGCCGCGCTGTTCTCCAGGATCGGGTC
AAGGCTACGAGCGAAGCAACGCCGCCTCTCGTCTACGGGACCATGCTTCACGAGATTTTTCAAGAAGCACTGCTC
GCCAACAGGTGGGATCTGGCTTTTCTCTCAGGGATTATCGACAGGAAAGTGGAGGAGCACGTCGAGGATCTGTAT
CGCATCAAGATTGGCATCGCGGCCGCCACTGAGCATCTGCTTTCCAAGATGACTGAGTTGAGCTACTGGGCAAAG
ACGTTTGTCTCCGCGGCGCCCAAGACCGATGCGGTGGTTGAGGACCGAAACGGCAAGACGGCTGCCATGGCTGTC
AGGAAGCTACTCGATGTCGAGGAGCACGTCTGGTCTCCGATGTATGGACTGAAAGGGAACATTGACGCCACTGTC
GAGGTCGTCATGGCAGACGGAAAGGAGAAACGGACCCTCACGGTTCCGTTCGAGTTGAAGACGGGGAGACAAGCG
AACAGCAGCCATATGGCGCAGACGGCGCTCTACACCCTGCTGCTGGCGGATCGGTACGACATCGACATCGCCTGC
GGCATCCTCTACTACATGGAGACCTCCAAGACGATGCGGATCCCGGCCGTACGGCATGAGCTGAGGCACATGATT
ATGCAGCGAAACCAACTGGCCTGCTATATCCGAGAGCGAAGCGTCAAGCTACCTCCCATGCTCAAGAACAAGCAC
GTGTGCGGGAGATGCTATGCCAAGACGTCTTGCTTCATATATCATCGACTGGCAGACGAGGGCGACGCTGAGTCG
AGCGGCATGAAGGACAAGTTTGACGAGCTCGTCCGGCACCTGACGCCTGCCCATCGTGACTTTTTCGTCCGTTGG
GAGAATCTCTTGACCAAGGAGGAAAAGGACAGCCAGAAGACCAAGAGGGAGCTGTGGACCATGACGAGCTCCGAG
CGGGAGAAGAAGTCTCGGTGCTTTGCCGACGTCATCATCGAAGAAGGGTCCGCCTCGGAGACGGCAGCCAGCGGA
CGGATCAACCGGTTCCACTACAGCTTTGTCAAGCGGCTTCCCCAGCCCAAGTTTTCGTTTCTCGAGTCGGAGCTG
TCGACGGGCGAGCCTGTCGTGGTATCGGACGAGGAGGGCCACTTTGCCTTGGCCATTGGCTATGTGACGTCGGTC
CGCAAGCAGAGGATCAGCGTCGCCGTCGACAGGCGTCTTCACAACGCCCGAATCAGGCAGCCCGGGTTTGACGAA
AAGGACAACCAGGTGTTTGCCAGCATCATGGAGGTACAGCCGGAAGCGAGGAAGGCTCCGGTCCAAAGTCAGCCG
ATGCGGTATCGACTGGACAAGGACGAGTTTAGCAACGGCATGGCGACGGTCAGGAACAACCTGGTGCAGATGATG
GCCAACGACGTGCCGGCGGCCGTCAAGATGAGGAGGCTGGTCGTCGACCTGGAGGCGCCTCGCTTCAAGGAGACG
TCGACTCAGTACAGCGTGGCCCAGGGCGAGACGCTCAACGTGGATCAGGAGAGGGCCATCGACAAGGTCATGAGG
GCGCAGGACTACGCTCTGGTGCTGGGCATGCCTGGGACGGGCAAGACGACGACGATTGCGCACATTATCCGGGCC
TTGACGTCGCAGGGCAAGAGTGTGCTGCTGACGTCCCACACGCACACGGCCGTGGACAACATCCTTCTGAAGCTC
AAGGCCGACGACATCCCCGTGCTCCGACTGGGGGCTCCGGCCAAGATCCACGCCGAAGTCCAGGGCTTTGCCCGT
CTGGCGGCCACGACGAGGAAGACGTTTGACGACATCAGGGACGCCTGGCACGGGACGCCCGTGGTGGCGACGACG
TGTCTGGGCATCAACCACGCCCTGTTCCTGGAGCGGTCCTTTGACTACTGCATCGTCGACGAGGCGTCACAGATT
ACGCTGCCCATCTGCGCCGGGCCCATCCGCATGGCGAGCGCCTTTGTCCTGGTCGGAGACCATAACCAGCTGCCC
CCCGTGGTGCGGAACTCGGAGGCTCGCGAGGGGGGGCTGGACGTGAGCCTGTTCAAGCTGCTGTCCGACGCTCAT
CCCGAGTCTGTCGTCAACCTGGAGCATCAGTACCGCATGTGTGAGGACATCATGACGCTGAGCAACACGCTCATC
TACGACGGGAGGCTTCGCTGCGGTTACGAGGCCCTCCGCAGACGGAAGCTCGACGTTCCGGCCCTGAAGGCGCTG
CGGAACTTCCATCACGACCCGGCCTCTCTCCTGAAGCGGCCCACGCCACGGTCCTTTTGCACGGGGCCGACGCCA
TCGCGGTGCTGGCTGTACGATGTCATCGAGGGCGAGGCTCGCGTCCGCTTCGTCAACACGGACACGATTCGTCCG
CCCGTCCACGAGGAGGCCCAGGGCAAGCGCATCGTCAACCGCACAGAGGTGCGCATCGTCGGCCAGCTCGTCGAG
GCCCTACTGGCAACGGGCGTGCCAGCCGACGAGGTAGGCGTCATGACGCATTACCGCGCCCAGCTCGGCCTCCTC
CACCACCGTCTCCGTCGCCACTCGGCCGTCGAGATGCACACGACGGACCGCTTCCAGGGCCGCGACAAGGACGTC
ATGGTCGTCAGCCTGGTGCGCTGCAACGAGGCCCGCAACATTGGCGACCTGCTGCGCGACTGGCGTCGTATAAAC
GTGGCCTTTACCCGCGCTCGTGCCAAGCTCCTCGTCATCGGCAGCAAGAGCACGCTCCAGCAGGCTGACAACGGC
ATGCTCGCCCGCTTCGTCGCCCTGATGGAGAGTCGCGATTGGGTGTACGACTTGCCGGCCGATGCGGTGGAAGCT
CACGTCTTTGACGACGAGACGTGGTCCGAATCGTCGCCTTGTTCGCCTCAGCCTGTTGGTGGTGAGGTGGAGACG
GGCAAGAAGCCATCGTCCGGGGTGGCGGATAAGGAGAATCGCAGGAGGGGGTCTCCTAAGAAGGCGAGGGTTGGG
GCTCGGGCTCTTCTGAGGGGGAAGCCTGTGATGAGGGATATACTTGCTGATATGATGAATGGGGCTGAGATGCGG
TGA
Gene >Ophun1|1738
ATGCCGCTACATAAAGCCCACTCTGAACGTCTTGGGCAGCGGAAAGTGAGTGAGGATAAGCTCAGCGGCGACTAG
ACGTTGCTAAGCCTCTGCGGATAGAGCCGACAGCCATGGCAACGGTCCAACAGTCACCCCGTCGATTTGCAGACT
CCAAAATCGAAGCCTTCTCTGCCCGTGTCGGAGGTGACCAAGGACAAGCTCAGCAGGTTTCAGTACCACCCCCGA
GAAGTCGACTCGACGGGCCAAGATGCCGGACGAACCTCGTCTTCGACGGCCAACGATGACTCTTCCACGGGGAGG
ACCAGACTGAACTGGCGGGACCTCATGGATCCTGGTATTGTGGCCGAGGACGACACCGACACGTCGCCCAGTGAC
AAAGTCCTATGGAACAACAAGCAAGACTCGCTCTACGTCTCAGCACTGTCTCCCATGCTGGCTCGGAAGAGGAAG
CGAGCCAGGAGCTCGTCGCCCGTTTCGTCTCCGCTGGCAGACAAGCCCGAGCCGCCGACCGTCGACGTCGGCATG
TTGCGAGAGGCTCTGAAGCTGGGACACGCCGATCCGACGATGGAGCTGTGGGATCGCTACTCTTACTCGCTCAAC
GGGCCCGAGAACGCGAAGTCGTCCCCGGGTGTCGTGAAGCCGGCTCTCGAGCAGTTGATGATATCGTCCTCTCCG
AAGCCGCGTGGTGATGGTTCGGCGCCCAAGACCGACTTTGGCTTGCGACGCGCCTTGACGTGTGGTCTGAATTGG
CCAAAGAGGCGGAAGAACTCCAAAACGGAGCGAGTTCGGGTGAGGGAAGAACATAAAGAGTCGGAGTCTTTGACC
AAGCCGTCGCTCGTCACAGAACTGCTCGACACGGTGGATCAGGAACTTGAAGATGCCAGTGTCCAGCCCGTGCAG
GACGAGTCTCCGTCGCTCAACAAGCGAAGGCTGCCTCCGAATCATCACAGCTCTCCGTGTCGGGCGGTTGCCGGT
GGCGGCGTCGTTGCGGATCTGCCTTCTTCGGACTACGGCGATGACGACTTCGACGACGATACGCTTACGGAACTC
GAGGCGAGTCTCATTGCCGGAGACGGGACGAAAGCGCCGTCGAATACGAATCAGGGGATGACAGAGGCGTCGACA
GCAAACGATGATGACATTGAGCTCGTTGACCATGGCAGCCTGAAGCCAGACCAGCAGGCCACACGCTGTTCAGAT
GCCCCTATAACGCCTCCTGGGCGACCTCAAAACAAGGATGCCCAGAAGAGCCCTGGAGATGAGTTCGAAGACGAT
TTCGACGCGGACATTGACTTTGATGCCGTTGAGCTAGCAGCGACTCAAACAGTGCAACAGCGGCGCGTTGTGCCC
CCAGCGACCAAAGTACGTCCGATTTAGCATGAGCGAGGCCTTTCCATGGATCATTTACTAAGTCAAGGTAGACGG
AACCAAAAGCCAAGGTCATCCAGCGATACTTAGTAACGAGTGTGGTAGAGGGCGACTACATCGATGAGCTGGGTC
ACACCCGGCCCGAGAAGGTAAGGCGGCCAAGTCGCCGGAAGCTCTTGGAGTTGGCTAACGGAGATAAGATCCTCA
TCATCCAGGCCGACGGCTCGAAGGCAGCTCGGACGGTGCATCTGAGAGGCGCTTGGTTCGACACGCCGGCTCACA
CCGAGTCGTACGTTCACGTCATCGGCAAATTCTCCGCCAGGGGACAGTGCTTTGTGGATGACGCGAAGAATCTGT
TGATCTTGCACCCCGATCAGCTCCTGTCTGCCACCGTCGTCGCCGACTCCTTTGGCTGCATGCGCCGCGCTGTTC
TCCAGGATCGGGTCAAGGCTACGAGCGAAGCAACGCCGCCTCTCGTCTACGGGACCATGCTTCACGAGATTTTTC
AAGAAGCACTGCTCGCCAACAGGTGGGATCTGGCTTTTCTCTCAGGGATTATCGACAGGAAAGTGGAGGAGCACG
TCGAGGATCTGTATCGCATCAAGATTGGCATCGCGGCCGCCACTGAGCATCTGCTTTCCAAGATGACTGAGTTGA
GCTACTGGGCAAAGACGTTTGTCTCCGCGGCGCCCAAGGTAAGGCCAATGGCTGTGTGAGTCGAGCGTGGCTGAC
GGTGGGCAGACCGATGCGGTGGTTGAGGACCGAAACGGCAAGACGGCTGCCATGGCTGTCAGGAAGCTACTCGAT
GTCGAGGAGCACGTCTGGTCTCCGATGTATGGACTGAAAGGGAACATTGACGCCACTGTCGAGGTCGTCATGGCA
GACGGAAAGGAGAAACGGACCCTCACGGTTCCGTTCGAGTTGAAGACGGGGAGACAAGCGAACAGCAGCCATATG
GCGCAGACGGCGCTCTACACCCTGCTGCTGGCGGATCGGTACGACATCGACATCGCCTGCGGCATCCTCTACTAC
ATGGAGACCTCCAAGACGATGCGGATCCCGGCCGTACGGCATGAGCTGAGGCACATGATTATGCAGCGAAACCAA
CTGGCCTGCTATATCCGAGAGCGAAGCGTCAAGCTACCTCCCATGCTCAAGAACAAGCACGTGTGCGGGAGATGC
TATGCCAAGACGTCTTGCTTCATATATCATCGACTGGCAGACGAGGGCGACGCTGAGTCGAGCGGCATGAAGGAC
AAGTTTGACGAGCTCGTCCGGCACCTGACGCCTGCCCATCGTGACTTTTTCGTCCGTTGGGAGAATCTCTTGACC
AAGGAGGAAAAGGACAGCCAGAAGACCAAGAGGGAGCTGTGGACCATGACGAGCTCCGAGCGGGAGAAGAAGTCT
CGGTGCTTTGCCGACGTCATCATCGAAGAAGGGTCCGCCTCGGAGACGGCAGCCAGCGGACGGATCAACCGGTTC
CACTACAGCTTTGTCAAGCGGCTTCCCCAGCCCAAGTTTTCGTTTCTCGAGTCGGAGCTGTCGACGGGCGAGCCT
GTCGTGGTATCGGACGAGGAGGGCCACTTTGCCTTGGCCATTGGCTATGTGACGTCGGTCCGCAAGCAGAGGATC
AGCGTCGCCGTCGACAGGCGTCTTCACAACGCCCGAATCAGGCAGCCCGGGTTTGACGAAAAGGACAACCAGGTG
TTTGCCAGCATCATGGAGGTACAGCCGGAAGCGAGGAAGGCTCCGGTCCAAAGTCAGCCGATGCGGTATCGACTG
GACAAGGACGAGTTTAGCAACGGCATGGCGACGGTCAGGAACAACCTGGTGCAGATGATGGCCAACGACGTGCCG
GCGGCCGTCAAGATGAGGAGGCTGGTCGTCGACCTGGAGGCGCCTCGCTTCAAGGAGACGTCGACTCAGTACAGC
GTGGCCCAGGGCGAGACGCTCAACGTGGATCAGGAGAGGGCCATCGACAAGGTCATGAGGGCGCAGGACTACGCT
CTGGTGCTGGGCATGCCTGGGACGGGCAAGACGACGACGATTGCGCACATTATCCGGGCCTTGACGTCGCAGGGC
AAGAGTGTGCTGCTGACGTCCCACACGCACACGGCCGTGGACAACATCCTTCTGAAGCTCAAGGCCGACGACATC
CCCGTGCTCCGACTGGGGGCTCCGGCCAAGATCCACGCCGAAGTCCAGGGCTTTGCCCGTCTGGCGGCCACGACG
AGGAAGACGTTTGACGACATCAGGGACGCCTGGCACGGGACGCCCGTGGTGGCGACGACGTGTCTGGGCATCAAC
CACGCCCTGTTCCTGGAGCGGTCCTTTGACTACTGCATCGTCGACGAGGCGTCACAGATTACGCTGCCCATCTGC
GCCGGGCCCATCCGCATGGCGAGCGCCTTTGTCCTGGTCGGAGACCATAACCAGCTGCCCCCCGTGGTGCGGAAC
TCGGAGGCTCGCGAGGGGGGGCTGGACGTGAGCCTGTTCAAGCTGCTGTCCGACGCTCATCCCGAGTCTGTCGTC
AACCTGGAGCATCAGTACCGCATGTGTGAGGACATCATGACGCTGAGCAACACGCTCATCTACGACGGGAGGCTT
CGCTGCGGTTACGAGGCCCTCCGCAGACGGAAGCTCGACGTTCCGGCCCTGAAGGCGCTGCGGAACTTCCATCAC
GACCCGGCCTCTCTCCTGAAGCGGCCCACGCCACGGTCCTTTTGCACGGGGCCGACGCCATCGCGGTGCTGGCTG
TACGATGTCATCGAGGGCGAGGCTCGCGTCCGCTTCGTCAACACGGACACGATTCGTCCGCCCGTCCACGAGGAG
GCCCAGGGCAAGCGCATCGTCAACCGCACAGAGGTGCGCATCGTCGGCCAGCTCGTCGAGGCCCTACTGGCAACG
GGCGTGCCAGCCGACGAGGTAGGCGTCATGACGCATTACCGCGCCCAGCTCGGCCTCCTCCACCACCGTCTCCGT
CGCCACTCGGCCGTCGAGATGCACACGACGGACCGCTTCCAGGGCCGCGACAAGGACGTCATGGTCGTCAGCCTG
GTGCGCTGCAACGAGGCCCGCAACATTGGCGACCTGCTGCGCGACTGGCGTCGTATAAACGTGGCCTTTACCCGC
GCTCGTGCCAAGCTCCTCGTCATCGGCAGCAAGAGCACGCTCCAGCAGGCTGACAACGGCATGCTCGCCCGCTTC
GTCGCCCTGATGGAGAGTCGCGATTGGGTGTACGACTTGCCGGCCGATGCGGTGGAAGCTCACGTCTTTGACGAC
GAGACGTGGTCCGAATCGTCGCCTTGTTCGCCTCAGCCTGTTGGTGGTGAGGTGGAGACGGGCAAGAAGCCATCG
TCCGGGGTGGCGGATAAGGAGAATCGCAGGAGGGGGTCTCCTAAGAAGGCGAGGGTTGGGGCTCGGGCTCTTCTG
AGGGGGAAGCCTGTGATGAGGGATATACTTGCTGATATGATGAATGGGGCTGAGATGCGGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail