Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|1737
Gene name
LocationContig_176:5638..9178
Strand+
Gene length (bp)3540
Transcript length (bp)3144
Coding sequence length (bp)3144
Protein length (aa) 1048

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13515 FUSC_2 Fusaric acid resistance protein-like 2.0E-07 688 806
PF10337 ArAE_2_N Putative ER transporter, 6TM, N-terminal 5.5E-06 155 228

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q07660|BRE4_YEAST Protein BRE4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BRE4 PE=1 SV=1 30 979 4.0E-83
sp|Q75E41|BRE4_ASHGO Protein BRE4 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=BRE4 PE=3 SV=2 55 1040 1.0E-64
sp|P53120|YGO0_YEAST Uncharacterized membrane protein YGL140C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YGL140C PE=1 SV=1 156 980 2.0E-23
sp|Q10495|YDG8_SCHPO Uncharacterized protein C26F1.08c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC26F1.08c PE=4 SV=1 644 992 3.0E-09

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 22 0.45

Transmembrane Domains

Domain # Start End Length
1 154 176 22
2 206 228 22
3 258 280 22
4 295 314 19
5 714 736 22
6 741 758 17
7 765 782 17
8 792 814 22
9 826 848 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|1737
MRDSWRRTLTASNRHHDSLDATPNMSDQPPDVLRRRQQPLRLRSVPAPDVFLEPVSPTPISRPSSTHSLVQLDHM
VSDKIDTETYGVSELRDGFFDAMFLRPSHVFAADLLQDSADTLPAGFDKASPLALRRYFPRKRHAFVSVVKRVTT
TRDGIRLLKSFSAFFVAYVLCLVPVIRNWLGRYHYIMAVSVIVNHPARSLGSQLDGATLTIVGAACGLAWGVLGL
LLSESSVAARAGYAGVLAVWMALFMTSISLTRAFFIRFYQAILSAGLAVIFATLAETGSRKAEWTKLRDYGFSWL
FGQAIALLINCIIFPDAGARDLATTFHTAFDVMLEALDASSCRDRRLRRRLSRAFVDLSQVCRDMKIDITVTRIR
PNDVGDLRNLMQAVIRALLTLKADTYLFKDSPSEQDVSITVDEPGLSILEAAVTAASSPGHSRRAIEELGDRTKN
MLSCMSQCVRICDAILMDLSGHRRSIGPAPDVPSDLQPAIRKLGQAKAAYDAVEASLIESEERLSESSIQDGDVV
QLFVFARHVREASSTIDHLVDKVREVQQTSSGWPRPHLPSYPFWKALHRTNAQTRHDRGGVTAGSYHVTFEEIGR
LLDKMKTNDHEPIPRTDSLCLETVASHVTPDTTASPAKTAKTSRARYKVWRVLKRLQGFESRYAFKVCLVTTVLA
IPAYLVRDRGWWEDYECWWAVSISWLAMHPRVGGNVQDLFIRGFMAVLGAAWSAAAYAVGNGNPYVMAAFATVYM
VPMLLRFTQSSHPRSGLIGCLSFTVISLRLMVESNDTSPTLLAVYSGVAFLVGATVPVIVNWVLWPFVARHELRQ
ALSSMMFFMSVIYRSVVARYVYFYEGKEPTPEDVQRSEMLEGRLREGFVRIRQLLVLTQKEIRLRAPFDPLPYSA
LADSCERFFDYLVAVRQSALFYNPDYIRDNPQAAEQLLSHRRDAVAAILGNLYILAGALRSKRKVPRYLPNAAAA
RRRLLMINAQVDDQTSRLSPSSSADAACHRRWSDIYRYSYNESLVGCVAQLDELEKLTKLIVGEQRSGEFKV*
Coding >Ophun1|1737
ATGCGCGACTCATGGCGTCGAACCTTGACAGCATCCAACAGACATCACGACAGCCTCGATGCCACGCCCAACATG
TCCGACCAGCCTCCAGACGTGCTTCGACGGCGGCAGCAACCGCTTAGGCTGCGGTCGGTACCCGCTCCCGATGTC
TTTCTGGAGCCCGTCTCCCCTACGCCGATAAGCCGGCCGAGTTCGACTCACAGCCTGGTCCAGCTCGACCACATG
GTCTCGGACAAGATAGACACGGAGACGTACGGCGTGTCGGAGCTTCGAGATGGCTTCTTCGATGCCATGTTTCTC
AGACCGTCACACGTGTTTGCTGCCGACCTCTTGCAGGATTCTGCCGATACGCTTCCTGCCGGCTTCGACAAGGCA
TCGCCCCTGGCTTTGCGACGTTACTTTCCCCGGAAGCGACACGCCTTTGTGTCTGTCGTGAAGCGCGTAACGACG
ACCCGCGATGGCATCCGACTCCTCAAGTCTTTCTCGGCCTTTTTCGTCGCCTATGTCCTTTGCCTCGTCCCCGTC
ATCCGCAACTGGCTCGGCCGCTATCACTACATCATGGCCGTCTCCGTCATCGTCAACCATCCGGCTAGATCATTG
GGATCCCAGCTGGATGGCGCGACTCTCACCATAGTGGGTGCTGCCTGTGGACTGGCCTGGGGCGTGCTTGGCCTG
CTGCTGTCCGAGTCTTCGGTGGCTGCGCGTGCTGGTTACGCGGGTGTTCTGGCTGTTTGGATGGCTCTGTTTATG
ACGTCGATTTCCCTCACTCGAGCCTTTTTCATACGATTCTACCAGGCTATACTGTCGGCCGGTCTCGCCGTCATC
TTTGCCACGCTGGCAGAGACGGGCAGCCGCAAGGCTGAATGGACCAAGCTGCGCGACTACGGCTTTTCCTGGTTG
TTCGGACAGGCCATTGCCTTGCTGATAAACTGCATCATCTTCCCGGATGCCGGTGCGAGAGATCTGGCGACGACG
TTTCACACCGCTTTCGATGTGATGCTGGAGGCTCTCGATGCCTCGTCTTGTCGAGACCGTCGACTTCGCCGGCGC
CTGTCGCGAGCCTTTGTCGACTTATCACAAGTATGTCGCGATATGAAGATCGATATCACCGTCACGCGTATCCGA
CCCAACGACGTCGGGGACCTCCGTAACCTGATGCAGGCCGTCATCCGCGCTCTCCTCACCCTCAAGGCCGACACT
TATCTGTTCAAGGACTCGCCATCCGAACAAGACGTCAGCATTACCGTCGATGAGCCTGGTCTGAGCATCCTGGAA
GCGGCCGTGACGGCGGCTTCGTCCCCGGGCCACAGCCGCCGAGCCATCGAGGAGCTGGGCGATCGGACAAAGAAC
ATGCTCTCCTGCATGTCCCAATGCGTGCGGATCTGCGATGCCATCCTGATGGACCTGAGCGGACACCGTCGAAGC
ATAGGTCCCGCGCCGGACGTGCCGTCTGATCTGCAACCCGCGATCCGGAAGCTCGGACAAGCAAAGGCTGCCTAC
GATGCCGTCGAGGCCAGCCTCATCGAATCGGAAGAGCGTCTGTCGGAATCTTCTATTCAGGATGGTGATGTTGTA
CAGCTCTTTGTCTTTGCACGTCACGTCCGAGAGGCCTCGTCCACCATTGATCATCTGGTAGACAAAGTCCGGGAA
GTGCAGCAGACGTCTTCTGGCTGGCCACGTCCTCATCTACCGTCGTACCCCTTTTGGAAAGCCCTTCATAGGACC
AACGCCCAAACACGTCATGATCGTGGGGGCGTTACGGCCGGTTCATACCACGTCACTTTCGAGGAGATAGGTCGC
TTACTCGATAAGATGAAGACGAATGACCACGAGCCGATTCCACGAACAGACAGTCTCTGCCTGGAAACCGTGGCC
TCACACGTCACGCCAGATACCACCGCCAGTCCGGCCAAGACGGCCAAGACGAGCCGCGCACGATACAAGGTCTGG
CGCGTCCTCAAACGCCTCCAGGGCTTCGAGAGCAGATACGCCTTCAAGGTCTGTCTCGTAACCACCGTGCTGGCC
ATCCCCGCCTATCTGGTCCGGGACCGCGGCTGGTGGGAAGACTATGAATGCTGGTGGGCCGTCTCCATCAGCTGG
CTGGCCATGCACCCCCGAGTCGGAGGCAACGTCCAGGACCTCTTCATCAGGGGCTTCATGGCTGTCCTGGGCGCT
GCCTGGAGTGCGGCGGCGTATGCGGTCGGCAATGGCAACCCCTACGTCATGGCAGCCTTTGCCACGGTCTACATG
GTGCCCATGCTGCTTCGCTTCACGCAGAGTTCGCACCCGCGGTCCGGCCTCATCGGCTGTCTCTCCTTCACCGTC
ATCTCGCTCCGCCTAATGGTGGAAAGCAACGACACGTCTCCTACGCTGCTGGCCGTATACAGCGGCGTGGCCTTT
CTAGTGGGTGCCACGGTGCCCGTCATCGTCAACTGGGTGCTGTGGCCGTTTGTCGCCAGACACGAGTTGAGACAG
GCTCTCTCATCCATGATGTTCTTCATGAGCGTCATCTACCGAAGCGTGGTGGCGAGATACGTCTACTTCTACGAA
GGCAAAGAACCAACACCAGAAGACGTCCAGAGATCCGAGATGCTGGAAGGCCGCCTTAGAGAAGGCTTCGTCCGC
ATAAGACAACTCCTAGTCCTCACCCAGAAAGAAATCCGCCTCCGCGCCCCCTTCGATCCCCTCCCCTACTCCGCC
CTCGCCGACTCGTGCGAACGCTTCTTCGATTACCTCGTCGCCGTCCGCCAGTCAGCCCTCTTCTACAACCCAGAT
TACATCCGCGACAACCCGCAAGCTGCAGAACAGCTCCTCAGCCACCGCCGCGACGCCGTAGCCGCCATCCTAGGA
AACCTGTACATCCTCGCCGGCGCCCTCCGCTCCAAGCGCAAGGTCCCCCGTTATCTCCCCAACGCAGCCGCCGCC
AGGAGAAGGCTCCTCATGATCAACGCCCAAGTCGACGACCAGACCTCCCGTCTCTCCCCCTCGTCGTCCGCCGAC
GCAGCGTGCCACAGACGCTGGAGCGACATCTACCGCTACTCGTACAATGAGAGTCTGGTGGGCTGCGTCGCGCAA
CTGGATGAGCTGGAGAAGCTGACCAAGCTGATTGTGGGCGAGCAGCGATCTGGTGAGTTCAAGGTCTAG
Transcript >Ophun1|1737
ATGCGCGACTCATGGCGTCGAACCTTGACAGCATCCAACAGACATCACGACAGCCTCGATGCCACGCCCAACATG
TCCGACCAGCCTCCAGACGTGCTTCGACGGCGGCAGCAACCGCTTAGGCTGCGGTCGGTACCCGCTCCCGATGTC
TTTCTGGAGCCCGTCTCCCCTACGCCGATAAGCCGGCCGAGTTCGACTCACAGCCTGGTCCAGCTCGACCACATG
GTCTCGGACAAGATAGACACGGAGACGTACGGCGTGTCGGAGCTTCGAGATGGCTTCTTCGATGCCATGTTTCTC
AGACCGTCACACGTGTTTGCTGCCGACCTCTTGCAGGATTCTGCCGATACGCTTCCTGCCGGCTTCGACAAGGCA
TCGCCCCTGGCTTTGCGACGTTACTTTCCCCGGAAGCGACACGCCTTTGTGTCTGTCGTGAAGCGCGTAACGACG
ACCCGCGATGGCATCCGACTCCTCAAGTCTTTCTCGGCCTTTTTCGTCGCCTATGTCCTTTGCCTCGTCCCCGTC
ATCCGCAACTGGCTCGGCCGCTATCACTACATCATGGCCGTCTCCGTCATCGTCAACCATCCGGCTAGATCATTG
GGATCCCAGCTGGATGGCGCGACTCTCACCATAGTGGGTGCTGCCTGTGGACTGGCCTGGGGCGTGCTTGGCCTG
CTGCTGTCCGAGTCTTCGGTGGCTGCGCGTGCTGGTTACGCGGGTGTTCTGGCTGTTTGGATGGCTCTGTTTATG
ACGTCGATTTCCCTCACTCGAGCCTTTTTCATACGATTCTACCAGGCTATACTGTCGGCCGGTCTCGCCGTCATC
TTTGCCACGCTGGCAGAGACGGGCAGCCGCAAGGCTGAATGGACCAAGCTGCGCGACTACGGCTTTTCCTGGTTG
TTCGGACAGGCCATTGCCTTGCTGATAAACTGCATCATCTTCCCGGATGCCGGTGCGAGAGATCTGGCGACGACG
TTTCACACCGCTTTCGATGTGATGCTGGAGGCTCTCGATGCCTCGTCTTGTCGAGACCGTCGACTTCGCCGGCGC
CTGTCGCGAGCCTTTGTCGACTTATCACAAGTATGTCGCGATATGAAGATCGATATCACCGTCACGCGTATCCGA
CCCAACGACGTCGGGGACCTCCGTAACCTGATGCAGGCCGTCATCCGCGCTCTCCTCACCCTCAAGGCCGACACT
TATCTGTTCAAGGACTCGCCATCCGAACAAGACGTCAGCATTACCGTCGATGAGCCTGGTCTGAGCATCCTGGAA
GCGGCCGTGACGGCGGCTTCGTCCCCGGGCCACAGCCGCCGAGCCATCGAGGAGCTGGGCGATCGGACAAAGAAC
ATGCTCTCCTGCATGTCCCAATGCGTGCGGATCTGCGATGCCATCCTGATGGACCTGAGCGGACACCGTCGAAGC
ATAGGTCCCGCGCCGGACGTGCCGTCTGATCTGCAACCCGCGATCCGGAAGCTCGGACAAGCAAAGGCTGCCTAC
GATGCCGTCGAGGCCAGCCTCATCGAATCGGAAGAGCGTCTGTCGGAATCTTCTATTCAGGATGGTGATGTTGTA
CAGCTCTTTGTCTTTGCACGTCACGTCCGAGAGGCCTCGTCCACCATTGATCATCTGGTAGACAAAGTCCGGGAA
GTGCAGCAGACGTCTTCTGGCTGGCCACGTCCTCATCTACCGTCGTACCCCTTTTGGAAAGCCCTTCATAGGACC
AACGCCCAAACACGTCATGATCGTGGGGGCGTTACGGCCGGTTCATACCACGTCACTTTCGAGGAGATAGGTCGC
TTACTCGATAAGATGAAGACGAATGACCACGAGCCGATTCCACGAACAGACAGTCTCTGCCTGGAAACCGTGGCC
TCACACGTCACGCCAGATACCACCGCCAGTCCGGCCAAGACGGCCAAGACGAGCCGCGCACGATACAAGGTCTGG
CGCGTCCTCAAACGCCTCCAGGGCTTCGAGAGCAGATACGCCTTCAAGGTCTGTCTCGTAACCACCGTGCTGGCC
ATCCCCGCCTATCTGGTCCGGGACCGCGGCTGGTGGGAAGACTATGAATGCTGGTGGGCCGTCTCCATCAGCTGG
CTGGCCATGCACCCCCGAGTCGGAGGCAACGTCCAGGACCTCTTCATCAGGGGCTTCATGGCTGTCCTGGGCGCT
GCCTGGAGTGCGGCGGCGTATGCGGTCGGCAATGGCAACCCCTACGTCATGGCAGCCTTTGCCACGGTCTACATG
GTGCCCATGCTGCTTCGCTTCACGCAGAGTTCGCACCCGCGGTCCGGCCTCATCGGCTGTCTCTCCTTCACCGTC
ATCTCGCTCCGCCTAATGGTGGAAAGCAACGACACGTCTCCTACGCTGCTGGCCGTATACAGCGGCGTGGCCTTT
CTAGTGGGTGCCACGGTGCCCGTCATCGTCAACTGGGTGCTGTGGCCGTTTGTCGCCAGACACGAGTTGAGACAG
GCTCTCTCATCCATGATGTTCTTCATGAGCGTCATCTACCGAAGCGTGGTGGCGAGATACGTCTACTTCTACGAA
GGCAAAGAACCAACACCAGAAGACGTCCAGAGATCCGAGATGCTGGAAGGCCGCCTTAGAGAAGGCTTCGTCCGC
ATAAGACAACTCCTAGTCCTCACCCAGAAAGAAATCCGCCTCCGCGCCCCCTTCGATCCCCTCCCCTACTCCGCC
CTCGCCGACTCGTGCGAACGCTTCTTCGATTACCTCGTCGCCGTCCGCCAGTCAGCCCTCTTCTACAACCCAGAT
TACATCCGCGACAACCCGCAAGCTGCAGAACAGCTCCTCAGCCACCGCCGCGACGCCGTAGCCGCCATCCTAGGA
AACCTGTACATCCTCGCCGGCGCCCTCCGCTCCAAGCGCAAGGTCCCCCGTTATCTCCCCAACGCAGCCGCCGCC
AGGAGAAGGCTCCTCATGATCAACGCCCAAGTCGACGACCAGACCTCCCGTCTCTCCCCCTCGTCGTCCGCCGAC
GCAGCGTGCCACAGACGCTGGAGCGACATCTACCGCTACTCGTACAATGAGAGTCTGGTGGGCTGCGTCGCGCAA
CTGGATGAGCTGGAGAAGCTGACCAAGCTGATTGTGGGCGAGCAGCGATCTGGTGAGTTCAAGGTCTAG
Gene >Ophun1|1737
ATGCGCGACTCATGGCGTCGAACCTTGACAGCATCCAACAGACATCACGACAGCCTCGATGCCACGCCCAACATG
TCCGACCAGCCTCCAGACGTGCTTCGACGGCGGCAGCAACCGCTTAGGCTGCGGTCGGTACCCGCTCCCGATGTC
TTTCTGGAGCCCGTCTCCCCTACGCCGATAAGCCGGCCGAGTTCGACTCACAGCCTGGTCCAGCTCGACCACATG
GTCTCGGACAAGATAGACACGGAGACGTACGGCGTGTCGGAGCTTCGAGATGGCTTCTTCGATGCCATGTTTCTC
AGACCGTCACACGTGTTTGCTGCCGACCTCTTGCAGGATTCTGCCGATACGCTTCCTGCCGGCTTCGACAAGGCA
TCGCCCCTGGCTTTGCGACGTTACTTTCCCCGGAAGCGACACGCCTTTGTGTCTGTCGTGAAGCGCGTAACGACG
ACCCGCGATGGCATCCGACTCCTCAAGTCTTTCTCGGCCTTTTTCGTCGCCTATGTCCTTTGCCTCGTCCCCGTC
ATCCGCAACTGGCTCGGCCGCTATCACTACATCATGGCCGTCTCCGTCATCGTCAACCATCCGGCTAGATCATTG
GGATCCCAGCTGGATGGCGCGACTCTCACCATAGTGGGTGCTGCCTGTGGACTGGCCTGGGGCGTGCTTGGCCTG
CTGCTGTCCGAGTCTTCGGTGGCTGCGCGTGCTGGTTACGCGGGTGTTCTGGCTGTTTGGATGGCTCTGTTTATG
ACGTCGATTTCCCTCACTCGAGCCTTTTTCATACGATTCTACCAGGCTATACTGTCGGCCGGTCTCGCCGTCATC
TTTGCCACGCTGGCAGAGACGGGCAGCCGCAAGGCTGAATGGACCAAGCTGCGCGACTACGGCTTTTCCTGGTTG
TTCGGACAGGCCATTGCCTTGCTGATAAACTGCATCATCTTCCCGGATGCCGGTGCGAGAGATCTGGCGACGACG
TTTCACACCGCTTTCGATGTGATGCTGGTACGTTTTCCCTCACCATCAACCGCAACACGGCTGATGTGTCGCAGG
AGGCTCTCGATGCCTCGTCTTGTCGAGACCGTCGACTTCGCCGGCGCCTGTCGCGAGCCTTTGTCGACTTATCAC
AAGTATGTCGCGATATGAAGATCGATATCACCGTCACGCGTATCCGACCCAACGACGTCGGGGACCTCCGTAACC
TGATGCAGGCCGTCATCCGCGCTCTCCTCACCCTCAAGGCCGACACTTATCTGTTCAAGGACTCGCCATCCGAAC
AAGACGTCAGCATTACCGTCGATGAGCCTGGTCTGAGCATCCTGGAAGCGGCCGTGACGGCGGCTTCGTCCCCGG
GCCACAGCCGCCGAGCCATCGAGGAGCTGGGCGATCGGACAAAGAACATGCTCTCCTGCATGTCCCAATGCGTGC
GGATCTGCGATGCCATCCTGATGGACCTGAGCGGACACCGTCGAAGCATAGGTCCCGCGCCGGACGTGCCGTCTG
ATCTGCAACCCGCGATCCGGAAGCTCGGACAAGCAAAGGCTGCCTACGATGCCGTCGAGGCCAGCCTCATCGAAT
CGGAAGAGCGTCTGTCGGAATCTTCTATTCAGGATGGTGATGTTGTACAGCTCTTTGTCTTTGCACGTCACGTCC
GAGAGGCCTCGTCCACCATTGATCATCTGGTAGACAAAGTCCGGGAAGTGCAGCAGACGTCTTCTGGCTGGCCAC
GTCCTCATCTACCGTCGTACCCCTTTTGGAAAGCCCTTCATAGGACCAACGCCCAAACACGTCATGATCGTGGGG
GCGTTACGGCCGGTTCATACCACGTCACTTTCGAGGAGATAGGTCGCTTACTCGATAAGATGAAGACGAATGACC
ACGAGCCGATTCCACGAACAGACAGTCTCTGCCTGGAAACCGTGGCCTCACACGTCACGCCAGATACCACCGCCA
GTCCGGCCAAGACGGCCAAGACGAGCCGCGCACGATACAAGGTCTGGCGCGTCCTCAAACGCCTCCAGGGCTTCG
AGAGCAGATACGCCTTCAAGGTCTGTCTCGTAACCACCGTGCTGGCCATCCCCGCCTATCTGGTCCGGGACCGCG
GCTGGTGGGAAGACTATGAATGCTGGTGGGCCGTCTCCATCAGCTGGCTGGCCATGCACCCCCGAGTCGGAGGCA
ACGTCCAGGACCTCTTCATCAGGGGCTTCATGGCTGTCCTGGGCGCTGCCTGGAGTGCGGCGGCGTATGCGGTCG
GCAATGGCAACCCCTACGTCATGGCAGCCTTTGCCACGGTCTACATGGTGCCCATGCTGCTTCGCTTCACGCAGA
GTTCGCACCCGGTGAGTTGCGAGCCCGGCCTTTGTCACTATAGCCCACCAGCTGACGTTTCTTTCTTATAATAAG
CGGTCCGGCCTCATCGGCTGTCTCTCCTTCACCGTCATCTCGCTCCGCCTAATGGTGGAAAGCAACGACACGTCT
CCTACGCTGCTGGCCGTATACAGCGGCGTGGCCTTTCTAGTGGGTGCCACGGTGCCCGTCATCGTCAACTGGGTG
CTGTGGCCGTTTGTCGCCAGACACGAGTTGAGACAGGCTCTCTCATCCATGATGTTCTTCATGAGCGTCATCTAC
CGAAGTGGGTACTCCCTCTGATCTACTTGCTCTCAGGGTGCTGACCCCTTAACTCAGGCGTGGTGGCGAGATACG
TCTACTTCTACGAAGGCAAAGAACCAACACCAGAAGACGTCCAGAGATCCGAGATGCTGGAAGGCCGCCTTAGAG
AAGGCTTCGTCCGCATAAGACAACTCCTAGTAAGCCCACTTCCCCCTATCATAACCCCCTCACTCAACCCCCCTT
TCCCCCCTTCCAGGTCCTCACCCAGAAAGAAATCCGCCTCCGCGCCCCCTTCGATCCCCTCCCCTACTCCGCCCT
CGCCGACTCGTGCGAACGCTTCTTCGATTACCTCGTCGCCGTCCGCCAGTCAGCCCTCTTCTACAACCCAGATTA
CATCCGCGACAACCCGCAAGCTGCAGAACAGCTCCTCAGCCACCGCCGCGACGCCGTAGCCGCCATCCTAGGAAA
CCTGTACATCCTCGCCGGCGCCCTCCGCTCCAAGCGCAAGGTCCCCGTCCGTTCCCCCCCCTCCCCTTCCCCCTT
TTCTCTATCATTGTCCATTTTTGGCGCTGACGACGCCCGTCCGTGCCGCCAGCGTTATCTCCCCAACGCAGCCGC
CGCCAGGAGAAGGCTCCTCATGATCAACGCCCAAGTCGACGACCAGACCTCCCGTCTCTCCCCCTCGTCGTCCGC
CGACGCAGCGTGCCACAGACGCTGGAGCGACATCTACCGCTACTCGTACAATGAGAGTCTGGTGGGCTGCGTCGC
GCAACTGGATGAGCTGGAGAAGCTGACCAAGCTGATTGTGGGCGAGCAGCGGTCAGTTTTTTTTTTTTTGTCCCC
TTTTTCTTCTTGATTGTCATCTTTGAAGTCTTTGTTCTGTTCGGTATGGTTCGCTGATGGTGGAGTAGATCTGGT
GAGTTCAAGGTCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail