Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|1734
Gene name
LocationContig_176:249..2648
Strand-
Gene length (bp)2399
Transcript length (bp)2250
Coding sequence length (bp)2250
Protein length (aa) 750

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00069 Pkinase Protein kinase domain 4.1E-15 79 346
PF07714 PK_Tyr_Ser-Thr Protein tyrosine and serine/threonine kinase 3.4E-06 78 276

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P7X5|PPK32_SCHPO Protein kinase domain-containing protein ppk32 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppk32 PE=1 SV=1 1 674 1.0E-92
sp|P53009|SCY1_YEAST Protein kinase-like protein SCY1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SCY1 PE=1 SV=1 10 662 1.0E-81
sp|Q8CFE4|SCYL2_MOUSE SCY1-like protein 2 OS=Mus musculus GN=Scyl2 PE=1 SV=1 31 662 6.0E-76
sp|Q6P3W7|SCYL2_HUMAN SCY1-like protein 2 OS=Homo sapiens GN=SCYL2 PE=1 SV=1 31 662 3.0E-75
sp|Q55BQ3|SCY2_DICDI Probable inactive serine/threonine-protein kinase scy2 OS=Dictyostelium discoideum GN=scy2 PE=3 SV=1 31 660 3.0E-51
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P7X5|PPK32_SCHPO Protein kinase domain-containing protein ppk32 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppk32 PE=1 SV=1 1 674 1.0E-92
sp|P53009|SCY1_YEAST Protein kinase-like protein SCY1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SCY1 PE=1 SV=1 10 662 1.0E-81
sp|Q8CFE4|SCYL2_MOUSE SCY1-like protein 2 OS=Mus musculus GN=Scyl2 PE=1 SV=1 31 662 6.0E-76
sp|Q6P3W7|SCYL2_HUMAN SCY1-like protein 2 OS=Homo sapiens GN=SCYL2 PE=1 SV=1 31 662 3.0E-75
sp|Q55BQ3|SCY2_DICDI Probable inactive serine/threonine-protein kinase scy2 OS=Dictyostelium discoideum GN=scy2 PE=3 SV=1 31 660 3.0E-51
sp|Q96KG9|NTKL_HUMAN N-terminal kinase-like protein OS=Homo sapiens GN=SCYL1 PE=1 SV=1 27 438 1.0E-22
sp|Q9EQC5|NTKL_MOUSE N-terminal kinase-like protein OS=Mus musculus GN=Scyl1 PE=1 SV=1 31 545 4.0E-22
sp|Q28FH2|NTKL_XENTR N-terminal kinase-like protein OS=Xenopus tropicalis GN=scyl1 PE=2 SV=1 18 536 6.0E-22
sp|Q561M0|NTKL_XENLA N-terminal kinase-like protein OS=Xenopus laevis GN=scyl1 PE=2 SV=1 18 649 6.0E-22
sp|A6QLH6|NTKL_BOVIN N-terminal kinase-like protein OS=Bos taurus GN=SCYL1 PE=2 SV=1 31 545 8.0E-22
sp|Q5M9F8|NTKL_RAT N-terminal kinase-like protein OS=Rattus norvegicus GN=Scyl1 PE=2 SV=1 31 438 3.0E-21
sp|Q55GS2|SCY1_DICDI Probable inactive serine/threonine-protein kinase scy1 OS=Dictyostelium discoideum GN=scy1 PE=3 SV=1 31 484 1.0E-13
sp|Q9DBQ7|PACE1_MOUSE Protein-associating with the carboxyl-terminal domain of ezrin OS=Mus musculus GN=Scyl3 PE=1 SV=3 3 533 5.0E-09
sp|Q8IZE3|PACE1_HUMAN Protein-associating with the carboxyl-terminal domain of ezrin OS=Homo sapiens GN=SCYL3 PE=1 SV=3 3 535 3.0E-08
[Show less]

GO

GO Term Description Terminal node
GO:0005524 ATP binding Yes
GO:0004672 protein kinase activity Yes
GO:0006468 protein phosphorylation Yes
GO:0008152 metabolic process No
GO:0019538 protein metabolic process No
GO:0030554 adenyl nucleotide binding No
GO:0043170 macromolecule metabolic process No
GO:0140096 catalytic activity, acting on a protein No
GO:0032559 adenyl ribonucleotide binding No
GO:0016740 transferase activity No
GO:0016301 kinase activity No
GO:0006796 phosphate-containing compound metabolic process No
GO:0097159 organic cyclic compound binding No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:0009987 cellular process No
GO:0097367 carbohydrate derivative binding No
GO:0003824 catalytic activity No
GO:0036094 small molecule binding No
GO:1901363 heterocyclic compound binding No
GO:0032555 purine ribonucleotide binding No
GO:0044237 cellular metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0000166 nucleotide binding No
GO:0071704 organic substance metabolic process No
GO:0044238 primary metabolic process No
GO:0005488 binding No
GO:0008150 biological_process No
GO:0043168 anion binding No
GO:1901265 nucleoside phosphate binding No
GO:0016773 phosphotransferase activity, alcohol group as acceptor No
GO:0003674 molecular_function No
GO:0032553 ribonucleotide binding No
GO:0006793 phosphorus metabolic process No
GO:0016310 phosphorylation No
GO:0036211 protein modification process No
GO:0043167 ion binding No
GO:0043412 macromolecule modification No
GO:0017076 purine nucleotide binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 22 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|1734
MFSSALKSISATNITGNYSIASSPVSVAGPWKIYDAKKKSTGKAYSVFVFDRRSLDSHGNSLGRSSASSFRRAVD
EVVERLKKEASSLAKLRHPSILELVEPVEETRGGGLQFVTEAVTASLASVLSEKDEQESSGGRASRYVTEDNDGV
RRRRELEIDELEIQKGLLQLSKALEFLHENAGLVHGNLTPDAIVINAKSDWKMTGLSFCSPAENSTKPTSIQGIN
LHEVFNMDPRLPRTVQLNLDFTSPDFVLDNSLTPSADMFSLGLLCVALYNSPHRSPLESHGSLSSYRRLFSSSTS
TPSSSNGFLSSRPLPKDMSNHVLPRLITRRPAQRMTAREFQQSEYFDNVLVSTIRFLDSFPEKTPNEKSQFMRGL
NKVLPSFPKSVMEKKILPALLEELKNRDLLSLILQNVFKIIELLPSARRAFGDKVRPALKDIFVVNAKQGQEKDP
ARDAGLMVFLENLSVAAEHSSGKEFKDDILPVILAAIECPTHAIIDAAMKTLPAVLPVLDFTTIKNELFPVVAAV
FSRTNSLAIKVRGLQAFVVLCGGSADGATDDGLNGLATEKKTSSSSALDKYTMQERIVPLIKGIRTKEPAVMVAA
LNVLRIVGQVADAEFVAMEILPLLWGMSLGPLLDLKQFQAFMELIKTLSRRVEEEQTRKLQETSLASNGPATSPN
DDFISFGGLTGTALDSSNGTDENDFEALVKGRTFGASPGNGAHASDAVVRLVDQLGEQASDEPAREDRLRHRDA*
Coding >Ophun1|1734
ATGTTCTCGTCGGCTCTCAAGTCCATCTCGGCCACCAACATCACCGGCAACTACTCCATCGCGTCGAGCCCCGTA
TCCGTCGCCGGACCGTGGAAGATCTACGACGCCAAGAAGAAGTCGACGGGCAAGGCTTACAGCGTCTTCGTCTTC
GACAGGCGCTCGCTCGACAGCCATGGAAACTCGCTGGGCCGCTCGAGCGCTTCGTCCTTTCGACGCGCTGTTGAC
GAAGTCGTTGAGCGTCTGAAGAAGGAGGCTTCTAGCCTTGCCAAGCTGCGACACCCCAGCATCCTTGAGCTTGTC
GAGCCGGTCGAGGAGACGCGGGGCGGTGGCTTGCAGTTTGTCACCGAGGCTGTTACTGCTTCGCTGGCCAGCGTT
CTTAGCGAGAAGGACGAGCAGGAGAGCTCTGGAGGTCGGGCCAGTCGCTACGTTACAGAAGACAACGACGGTGTT
CGTCGGCGGCGAGAACTCGAGATTGACGAGCTTGAGATTCAAAAGGGTTTACTCCAGCTCAGCAAGGCCCTCGAG
TTTCTGCACGAGAATGCGGGTCTCGTTCACGGCAATCTGACGCCCGACGCCATCGTCATTAACGCCAAGTCCGAC
TGGAAGATGACTGGTCTCTCTTTCTGCAGTCCTGCCGAAAACTCGACCAAGCCGACGTCGATTCAGGGTATCAAT
CTACATGAAGTATTCAACATGGACCCGAGGCTTCCTCGCACCGTCCAACTCAACCTCGACTTCACCTCTCCCGAC
TTTGTCTTGGATAATAGTTTAACGCCTTCGGCAGACATGTTCTCGCTCGGCCTCTTGTGCGTCGCGCTCTACAAC
TCGCCTCACCGCTCGCCTCTGGAGAGCCACGGCAGCCTCTCGTCCTACAGGCGATTGTTTTCATCATCGACCTCG
ACCCCCTCGTCGTCCAACGGCTTCCTCTCCTCTCGACCGCTACCCAAGGACATGTCCAACCACGTCCTGCCGCGG
CTCATCACCCGACGACCAGCTCAGCGGATGACGGCTCGCGAGTTCCAGCAGAGCGAGTACTTTGACAATGTCCTC
GTCTCCACCATCCGATTCCTCGATTCTTTTCCAGAAAAGACGCCCAACGAAAAGTCGCAATTCATGCGAGGTCTC
AATAAGGTCTTGCCCTCGTTTCCCAAGTCGGTCATGGAGAAGAAGATCTTGCCAGCGCTGTTGGAAGAGCTCAAG
AACAGAGACCTGCTGTCCTTGATACTGCAAAACGTCTTTAAGATTATCGAGCTATTGCCATCCGCGCGTCGGGCT
TTCGGCGACAAGGTCCGGCCGGCTCTCAAGGACATATTCGTTGTCAACGCAAAGCAGGGACAGGAAAAGGACCCA
GCCAGAGACGCCGGCTTGATGGTCTTTCTCGAGAACCTCTCCGTGGCGGCGGAACATAGCTCCGGCAAGGAGTTT
AAGGACGACATACTGCCCGTCATCCTGGCAGCGATCGAGTGTCCCACTCACGCCATCATAGACGCCGCCATGAAG
ACATTACCCGCCGTGTTACCCGTCCTCGACTTCACCACCATTAAGAACGAGCTCTTCCCCGTCGTCGCGGCCGTC
TTCAGCAGGACCAACAGCCTGGCCATCAAGGTCCGCGGCCTGCAAGCTTTCGTCGTCCTCTGCGGCGGCTCGGCG
GATGGCGCGACGGACGACGGGCTGAACGGCCTCGCGACAGAGAAGAAGACATCTTCATCCAGCGCGTTGGACAAG
TACACGATGCAGGAGAGAATCGTACCCCTAATCAAGGGCATCAGAACCAAAGAGCCGGCCGTCATGGTTGCCGCT
CTCAACGTGCTGAGGATCGTCGGACAGGTAGCCGATGCCGAATTCGTGGCCATGGAAATTCTCCCGCTGCTCTGG
GGCATGAGTCTAGGTCCGCTGCTGGACTTGAAGCAGTTCCAGGCCTTTATGGAGCTCATCAAGACGCTGTCAAGG
CGTGTCGAGGAAGAGCAGACTAGGAAGCTCCAAGAGACGTCTCTGGCCTCTAACGGACCGGCAACCAGCCCCAAC
GACGACTTCATCTCGTTCGGCGGCCTGACGGGAACCGCCCTGGACTCGAGCAACGGCACCGACGAGAACGACTTC
GAGGCCCTCGTCAAGGGCCGCACCTTTGGCGCTTCACCGGGCAACGGCGCTCACGCCTCAGACGCCGTCGTTCGC
CTGGTCGACCAGCTCGGCGAGCAGGCCTCAGACGAACCAGCCCGCGAGGACCGGCTCCGGCACCGTGACGCCTGA
Transcript >Ophun1|1734
ATGTTCTCGTCGGCTCTCAAGTCCATCTCGGCCACCAACATCACCGGCAACTACTCCATCGCGTCGAGCCCCGTA
TCCGTCGCCGGACCGTGGAAGATCTACGACGCCAAGAAGAAGTCGACGGGCAAGGCTTACAGCGTCTTCGTCTTC
GACAGGCGCTCGCTCGACAGCCATGGAAACTCGCTGGGCCGCTCGAGCGCTTCGTCCTTTCGACGCGCTGTTGAC
GAAGTCGTTGAGCGTCTGAAGAAGGAGGCTTCTAGCCTTGCCAAGCTGCGACACCCCAGCATCCTTGAGCTTGTC
GAGCCGGTCGAGGAGACGCGGGGCGGTGGCTTGCAGTTTGTCACCGAGGCTGTTACTGCTTCGCTGGCCAGCGTT
CTTAGCGAGAAGGACGAGCAGGAGAGCTCTGGAGGTCGGGCCAGTCGCTACGTTACAGAAGACAACGACGGTGTT
CGTCGGCGGCGAGAACTCGAGATTGACGAGCTTGAGATTCAAAAGGGTTTACTCCAGCTCAGCAAGGCCCTCGAG
TTTCTGCACGAGAATGCGGGTCTCGTTCACGGCAATCTGACGCCCGACGCCATCGTCATTAACGCCAAGTCCGAC
TGGAAGATGACTGGTCTCTCTTTCTGCAGTCCTGCCGAAAACTCGACCAAGCCGACGTCGATTCAGGGTATCAAT
CTACATGAAGTATTCAACATGGACCCGAGGCTTCCTCGCACCGTCCAACTCAACCTCGACTTCACCTCTCCCGAC
TTTGTCTTGGATAATAGTTTAACGCCTTCGGCAGACATGTTCTCGCTCGGCCTCTTGTGCGTCGCGCTCTACAAC
TCGCCTCACCGCTCGCCTCTGGAGAGCCACGGCAGCCTCTCGTCCTACAGGCGATTGTTTTCATCATCGACCTCG
ACCCCCTCGTCGTCCAACGGCTTCCTCTCCTCTCGACCGCTACCCAAGGACATGTCCAACCACGTCCTGCCGCGG
CTCATCACCCGACGACCAGCTCAGCGGATGACGGCTCGCGAGTTCCAGCAGAGCGAGTACTTTGACAATGTCCTC
GTCTCCACCATCCGATTCCTCGATTCTTTTCCAGAAAAGACGCCCAACGAAAAGTCGCAATTCATGCGAGGTCTC
AATAAGGTCTTGCCCTCGTTTCCCAAGTCGGTCATGGAGAAGAAGATCTTGCCAGCGCTGTTGGAAGAGCTCAAG
AACAGAGACCTGCTGTCCTTGATACTGCAAAACGTCTTTAAGATTATCGAGCTATTGCCATCCGCGCGTCGGGCT
TTCGGCGACAAGGTCCGGCCGGCTCTCAAGGACATATTCGTTGTCAACGCAAAGCAGGGACAGGAAAAGGACCCA
GCCAGAGACGCCGGCTTGATGGTCTTTCTCGAGAACCTCTCCGTGGCGGCGGAACATAGCTCCGGCAAGGAGTTT
AAGGACGACATACTGCCCGTCATCCTGGCAGCGATCGAGTGTCCCACTCACGCCATCATAGACGCCGCCATGAAG
ACATTACCCGCCGTGTTACCCGTCCTCGACTTCACCACCATTAAGAACGAGCTCTTCCCCGTCGTCGCGGCCGTC
TTCAGCAGGACCAACAGCCTGGCCATCAAGGTCCGCGGCCTGCAAGCTTTCGTCGTCCTCTGCGGCGGCTCGGCG
GATGGCGCGACGGACGACGGGCTGAACGGCCTCGCGACAGAGAAGAAGACATCTTCATCCAGCGCGTTGGACAAG
TACACGATGCAGGAGAGAATCGTACCCCTAATCAAGGGCATCAGAACCAAAGAGCCGGCCGTCATGGTTGCCGCT
CTCAACGTGCTGAGGATCGTCGGACAGGTAGCCGATGCCGAATTCGTGGCCATGGAAATTCTCCCGCTGCTCTGG
GGCATGAGTCTAGGTCCGCTGCTGGACTTGAAGCAGTTCCAGGCCTTTATGGAGCTCATCAAGACGCTGTCAAGG
CGTGTCGAGGAAGAGCAGACTAGGAAGCTCCAAGAGACGTCTCTGGCCTCTAACGGACCGGCAACCAGCCCCAAC
GACGACTTCATCTCGTTCGGCGGCCTGACGGGAACCGCCCTGGACTCGAGCAACGGCACCGACGAGAACGACTTC
GAGGCCCTCGTCAAGGGCCGCACCTTTGGCGCTTCACCGGGCAACGGCGCTCACGCCTCAGACGCCGTCGTTCGC
CTGGTCGACCAGCTCGGCGAGCAGGCCTCAGACGAACCAGCCCGCGAGGACCGGCTCCGGCACCGTGACGCCTGA
Gene >Ophun1|1734
ATGTTCTCGTCGGCTCTCAAGTCCATCTCGGCCACCAACATCACCGGCAACTACTCCATCGCGTCGAGCCCCGTA
TCCGTCGCCGGACCGTGGAAGATCTACGACGCCAAGAAGAAGTCGACGGGCAAGGCTTACAGCGTCTTCGTCTTC
GACAGGCGCTCGCTCGACAGCCATGGAAACTCGCTGGGCCGCTCGAGCGCTTCGTCCTTTCGACGCGCTGTTGAC
GAAGTCGTTGAGCGTCTGAAGAAGGAGGCTTCTAGCCTTGCCAAGCTGCGACACCCCAGCATCCTTGAGCTTGTC
GAGCCGGTCGAGGAGACGCGGGGCGGTGGCTTGCAGTTTGTCACCGAGGCTGTTACTGCTTCGCTGGCCAGCGTT
CTTAGCGAGAAGGACGAGCAGGAGAGCTCTGGAGGTCGGGCCAGTCGCTACGTTACAGAAGACAACGACGGTGTT
CGTCGGCGGCGAGAACTCGAGATTGACGAGCTTGAGATTCAAAAGGGTTTACTCCAGCTCAGCAAGGCCCTCGAG
TTTCTGCACGAGAATGCGGGTCTCGTTCACGGCAATCTGACGCCCGACGCCATCGTCATTAACGCCAAGGTAAGG
TGCCATTGCGCTCTTGTAAGGCATCAACTGACGACATCGTCAGTCCGACTGGAAGATGACTGGTCTCTCTTTCTG
CAGTCCTGCCGAAAACTCGACCAAGCCGACGTCGATTCAGGGTATCAATCTACATGAAGTATTCAACATGGACCC
GAGGCTTCCTCGCACCGTCCAACTCAACCTCGACTTCACCTCTCCCGACTTTGTCTTGGATAATAGTTTAACGCC
TTCGGCAGACATGTTCTCGCTCGGCCTCTTGTGCGTCGCGCTCTACAACTCGCCTCACCGCTCGCCTCTGGAGAG
CCACGGCAGCCTCTCGTCCTACAGGCGATTGTTTTCATCATCGACCTCGACCCCCTCGTCGTCCAACGGCTTCCT
CTCCTCTCGACCGCTACCCAAGGACATGTCCAACCACGTCCTGCCGCGGCTCATCACCCGACGACCAGCTCAGCG
GATGACGGCTCGCGAGTTCCAGCAGAGCGAGTACTTTGACAATGTCCTCGTCTCCACCATCCGATTCCTCGATTC
TTTTCCAGAAAAGACGCCCAACGAAAAGTCGCAATTCATGCGAGGTCTCAATAAGGTCTTGCCCTCGTTTCCCAA
GTCGGTCATGGAGAAGAAGATCTTGCCAGCGCTGTTGGAAGAGCTCAAGAACAGAGACCTGCTGTCCTTGATACT
GCAAAACGTCTTTAAGATTATCGAGCTATTGCCATCCGCGCGTCGGGCTTTCGGCGACAAGGTCCGGCCGGCTCT
CAAGGACATATTCGTTGTCAACGCAAAGCAGGGACAGGAAAAGGACCCAGCCAGAGACGCCGGCTTGATGGTCTT
TCTCGAGAACCTCTCCGTGGCGGCGGAACATAGCTCCGGCAAGGAGTTTAAGGACGGTAAGCAGACGCCCCATGA
TGATGTGGACGAGTTGGGTGCTGACTGCCAACAGACATACTGCCCGTCATCCTGGCAGCGATCGAGTGTCCCACT
CACGCCATCATAGACGCCGCCATGAAGACATTACCCGCCGTGTTACCCGTCCTCGACTTCACCACCATTAAGAAC
GAGCTCTTCCCCGTCGTCGCGGCCGTCTTCAGCAGGACCAACAGCCTGGCCATCAAGGTCCGCGGCCTGCAAGCT
TTCGTCGTCCTCTGCGGCGGCTCGGCGGATGGCGCGACGGACGACGGGCTGAACGGCCTCGCGACAGAGAAGAAG
ACATCTTCATCCAGCGCGTTGGACAAGTACACGATGCAGGAGAGAATCGTACCCCTAATCAAGGGCATCAGAACC
AAAGAGCCGGCCGTCATGGTTGCCGCTCTCAACGTGCTGAGGATCGTCGGACAGGTAGCCGATGCCGAATTCGTG
GCCATGGAAATTCTCCCGCTGCTCTGGGGCATGAGTCTAGGTCCGCTGCTGGACTTGAAGCAGTTCCAGGCCTTT
ATGGAGCTCATCAAGACGCTGTCAAGGCGTGTCGAGGAAGAGCAGACTAGGAAGCTCCAAGAGACGTCTCTGGCC
TCTAACGGACCGGCAACCAGCCCCAACGACGACTTCATCTCGTTCGGCGGCCTGACGGGAACCGCCCTGGACTCG
AGCAACGGCACCGACGAGAACGACTTCGAGGCCCTCGTCAAGGGCCGCACCTTTGGCGCTTCACCGGGCAACGGC
GCTGTCAGCTGGGACGAGGCCATGCCTACAGCCAGCAAGCCGTCAACCAGCACGCCTCAGACGCCGTCGTTCGCC
TGGTCGACCAGCTCGGCGAGCAGGCCTCAGACGAACCAGCCCGCGAGGACCGGCTCCGGCACCGTGACGCCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail