Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|1727
Gene name
LocationContig_175:24873..26423
Strand+
Gene length (bp)1550
Transcript length (bp)1440
Coding sequence length (bp)1440
Protein length (aa) 480

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00206 Lyase_1 Lyase 1.3E-110 21 354
PF10415 FumaraseC_C Fumarase C C-terminus 9.8E-21 420 472

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P55250|FUMH_RHIOR Fumarate hydratase, mitochondrial OS=Rhizopus oryzae GN=FUMR PE=3 SV=1 6 475 0.0E+00
sp|O17214|FUMH_CAEEL Probable fumarate hydratase, mitochondrial OS=Caenorhabditis elegans GN=fum-1 PE=3 SV=1 11 475 0.0E+00
sp|P08417|FUMH_YEAST Fumarate hydratase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FUM1 PE=1 SV=2 10 475 0.0E+00
sp|Q9FI53|FUM2_ARATH Fumarate hydratase 2, chloroplastic OS=Arabidopsis thaliana GN=FUM2 PE=2 SV=1 8 474 0.0E+00
sp|Q60HF9|FUMH_MACFA Fumarate hydratase, mitochondrial OS=Macaca fascicularis GN=FH PE=2 SV=1 2 475 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P55250|FUMH_RHIOR Fumarate hydratase, mitochondrial OS=Rhizopus oryzae GN=FUMR PE=3 SV=1 6 475 0.0E+00
sp|O17214|FUMH_CAEEL Probable fumarate hydratase, mitochondrial OS=Caenorhabditis elegans GN=fum-1 PE=3 SV=1 11 475 0.0E+00
sp|P08417|FUMH_YEAST Fumarate hydratase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FUM1 PE=1 SV=2 10 475 0.0E+00
sp|Q9FI53|FUM2_ARATH Fumarate hydratase 2, chloroplastic OS=Arabidopsis thaliana GN=FUM2 PE=2 SV=1 8 474 0.0E+00
sp|Q60HF9|FUMH_MACFA Fumarate hydratase, mitochondrial OS=Macaca fascicularis GN=FH PE=2 SV=1 2 475 0.0E+00
sp|P14408|FUMH_RAT Fumarate hydratase, mitochondrial OS=Rattus norvegicus GN=Fh PE=1 SV=1 8 475 0.0E+00
sp|P93033|FUM1_ARATH Fumarate hydratase 1, mitochondrial OS=Arabidopsis thaliana GN=FUM1 PE=2 SV=2 2 474 0.0E+00
sp|P07954|FUMH_HUMAN Fumarate hydratase, mitochondrial OS=Homo sapiens GN=FH PE=1 SV=3 2 475 0.0E+00
sp|P97807|FUMH_MOUSE Fumarate hydratase, mitochondrial OS=Mus musculus GN=Fh PE=1 SV=3 8 475 0.0E+00
sp|Q7SX99|FUMH_DANRE Fumarate hydratase, mitochondrial OS=Danio rerio GN=fh PE=2 SV=1 4 475 0.0E+00
sp|P10173|FUMH_PIG Fumarate hydratase, mitochondrial OS=Sus scrofa GN=FH PE=1 SV=1 8 475 0.0E+00
sp|O94552|FUMH_SCHPO Fumarate hydratase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fum1 PE=3 SV=3 12 476 0.0E+00
sp|Q92PB6|FUMC_RHIME Fumarate hydratase class II OS=Rhizobium meliloti (strain 1021) GN=fumC PE=1 SV=2 11 474 0.0E+00
sp|Q983U5|FUMC_RHILO Fumarate hydratase class II OS=Rhizobium loti (strain MAFF303099) GN=fumC PE=3 SV=1 11 474 0.0E+00
sp|Q54VA2|FUMH_DICDI Fumarate hydratase, mitochondrial OS=Dictyostelium discoideum GN=fumH PE=3 SV=1 14 473 0.0E+00
sp|P28894|FUMC1_BRADU Fumarate hydratase class II 1 OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=fumC1 PE=3 SV=3 13 474 0.0E+00
sp|Q8UEY7|FUMC_AGRFC Fumarate hydratase class II OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=fumC PE=3 SV=2 13 475 0.0E+00
sp|Q8FX90|FUMC_BRUSU Fumarate hydratase class II OS=Brucella suis biovar 1 (strain 1330) GN=fumC PE=3 SV=1 13 475 0.0E+00
sp|Q8YB50|FUMC_BRUME Fumarate hydratase class II OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=fumC PE=3 SV=2 13 475 0.0E+00
sp|Q8KTE1|FUMC_METEA Fumarate hydratase class II OS=Methylobacterium extorquens (strain ATCC 14718 / DSM 1338 / AM1) GN=fumC PE=3 SV=1 10 474 0.0E+00
sp|Q7N4H8|FUMC_PHOLL Fumarate hydratase class II OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=fumC PE=3 SV=1 13 473 0.0E+00
sp|Q8F9L0|FUMC_LEPIN Fumarate hydratase class II OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=fumC PE=3 SV=1 12 474 0.0E+00
sp|Q72VY3|FUMC_LEPIC Fumarate hydratase class II OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) GN=fumC PE=3 SV=1 12 474 0.0E+00
sp|Q4UMT4|FUMC_RICFE Fumarate hydratase class II OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=fumC PE=3 SV=1 14 473 0.0E+00
sp|Q92GW0|FUMC_RICCN Fumarate hydratase class II OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=fumC PE=3 SV=1 14 472 0.0E+00
sp|Q8ZEB6|FUMC_YERPE Fumarate hydratase class II OS=Yersinia pestis GN=fumC PE=3 SV=1 13 473 0.0E+00
sp|Q8ZPL7|FUMC_SALTY Fumarate hydratase class II OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=fumC PE=3 SV=1 13 473 0.0E+00
sp|Q8XQE8|FUMC_RALSO Fumarate hydratase class II OS=Ralstonia solanacearum (strain GMI1000) GN=fumC PE=3 SV=1 13 473 0.0E+00
sp|Q8Z6R6|FUMC_SALTI Fumarate hydratase class II OS=Salmonella typhi GN=fumC PE=3 SV=1 13 473 0.0E+00
sp|Q9A6I5|FUMC_CAUCR Fumarate hydratase class II OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=fumC PE=3 SV=1 13 474 0.0E+00
sp|Q1RHL6|FUMC_RICBR Fumarate hydratase class II OS=Rickettsia bellii (strain RML369-C) GN=fumC PE=3 SV=1 14 472 0.0E+00
sp|Q9ZCQ4|FUMC_RICPR Fumarate hydratase class II OS=Rickettsia prowazekii (strain Madrid E) GN=fumC PE=1 SV=1 14 472 0.0E+00
sp|Q68W74|FUMC_RICTY Fumarate hydratase class II OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=fumC PE=3 SV=1 14 472 0.0E+00
sp|Q7W4N9|FUMC_BORPA Fumarate hydratase class II OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=fumC PE=3 SV=1 12 476 0.0E+00
sp|Q7WG65|FUMC_BORBR Fumarate hydratase class II OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=fumC PE=3 SV=1 12 476 0.0E+00
sp|Q7W0A2|FUMC_BORPE Fumarate hydratase class II OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=fumC PE=3 SV=1 12 476 0.0E+00
sp|Q8X769|FUMC_ECO57 Fumarate hydratase class II OS=Escherichia coli O157:H7 GN=fumC PE=3 SV=1 13 473 0.0E+00
sp|P05042|FUMC_ECOLI Fumarate hydratase class II OS=Escherichia coli (strain K12) GN=fumC PE=1 SV=1 13 473 0.0E+00
sp|Q8FHA7|FUMC_ECOL6 Fumarate hydratase class II OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=fumC PE=3 SV=1 13 473 0.0E+00
sp|Q55674|FUMC_SYNY3 Fumarate hydratase class II OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=fumC PE=3 SV=1 14 474 0.0E+00
sp|Q82SM5|FUMC_NITEU Fumarate hydratase class II OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=fumC PE=3 SV=1 12 471 0.0E+00
sp|Q83ML8|FUMC_SHIFL Fumarate hydratase class II OS=Shigella flexneri GN=fumC PE=3 SV=1 13 473 0.0E+00
sp|P95331|FUMC_MYXXD Fumarate hydratase class II OS=Myxococcus xanthus (strain DK 1622) GN=fumC PE=3 SV=2 9 475 0.0E+00
sp|Q9ZJQ9|FUMC_HELPJ Fumarate hydratase class II OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=fumC PE=3 SV=1 14 475 0.0E+00
sp|O25883|FUMC_HELPY Fumarate hydratase class II OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=fumC PE=3 SV=1 14 475 0.0E+00
sp|Q83CL8|FUMC_COXBU Fumarate hydratase class II OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=fumC PE=3 SV=2 14 472 0.0E+00
sp|O69294|FUMC_CAMJE Fumarate hydratase class II OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=fumC PE=3 SV=1 12 475 0.0E+00
sp|P07343|FUMC_BACSU Fumarate hydratase class II OS=Bacillus subtilis (strain 168) GN=fumC PE=3 SV=2 12 475 0.0E+00
sp|Q8DIP7|FUMC_THEEB Fumarate hydratase class II OS=Thermosynechococcus elongatus (strain BP-1) GN=fumC PE=3 SV=1 10 475 0.0E+00
sp|Q9CMK1|FUMC_PASMU Fumarate hydratase class II OS=Pasteurella multocida (strain Pm70) GN=fumC PE=3 SV=1 14 473 0.0E+00
sp|P71384|FUMC_HAEIN Fumarate hydratase class II OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=fumC PE=3 SV=1 14 473 2.0E-175
sp|Q7VKC9|FUMC_HAEDU Fumarate hydratase class II OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=fumC PE=3 SV=1 12 473 4.0E-175
sp|Q81F85|FUMC_BACCR Fumarate hydratase class II OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=fumC PE=3 SV=1 12 476 4.0E-175
sp|Q81SA0|FUMC_BACAN Fumarate hydratase class II OS=Bacillus anthracis GN=fumC PE=3 SV=1 12 476 1.0E-173
sp|Q822D5|FUMC_CHLCV Fumarate hydratase class II OS=Chlamydophila caviae (strain GPIC) GN=fumC PE=3 SV=1 14 473 4.0E-171
sp|Q9JTR0|FUMC_NEIMA Fumarate hydratase class II OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=fumC PE=3 SV=1 13 475 8.0E-171
sp|Q8D2L3|FUMC_WIGBR Fumarate hydratase class II OS=Wigglesworthia glossinidia brevipalpis GN=fumC PE=3 SV=1 14 475 6.0E-170
sp|Q885V0|FUMC_PSESM Fumarate hydratase class II OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=fumC PE=3 SV=1 13 472 1.0E-169
sp|Q9Z6P6|FUMC_CHLPN Fumarate hydratase class II OS=Chlamydia pneumoniae GN=fumC PE=3 SV=1 14 473 2.0E-169
sp|Q9RR70|FUMC_DEIRA Fumarate hydratase class II OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=fumC PE=3 SV=1 11 468 2.0E-169
sp|Q8CNR1|FUMC_STAES Fumarate hydratase class II OS=Staphylococcus epidermidis (strain ATCC 12228) GN=fumC PE=3 SV=1 14 474 3.0E-169
sp|Q5HN85|FUMC_STAEQ Fumarate hydratase class II OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=fumC PE=3 SV=1 14 474 3.0E-169
sp|Q5HES4|FUMC_STAAC Fumarate hydratase class II OS=Staphylococcus aureus (strain COL) GN=fumC PE=3 SV=1 13 474 3.0E-169
sp|Q6GFK5|FUMC_STAAR Fumarate hydratase class II OS=Staphylococcus aureus (strain MRSA252) GN=fumC PE=3 SV=1 13 474 7.0E-169
sp|Q7NZ02|FUMC_CHRVO Fumarate hydratase class II OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=fumC PE=3 SV=1 13 472 3.0E-168
sp|Q8NVV1|FUMC_STAAW Fumarate hydratase class II OS=Staphylococcus aureus (strain MW2) GN=fumC PE=3 SV=1 13 474 8.0E-168
sp|Q6G884|FUMC_STAAS Fumarate hydratase class II OS=Staphylococcus aureus (strain MSSA476) GN=fumC PE=3 SV=1 13 474 8.0E-168
sp|P64173|FUMC_STAAN Fumarate hydratase class II OS=Staphylococcus aureus (strain N315) GN=fumC PE=1 SV=1 13 474 1.0E-167
sp|P64172|FUMC_STAAM Fumarate hydratase class II OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=fumC PE=3 SV=1 13 474 1.0E-167
sp|Q9I587|FUMC2_PSEAE Fumarate hydratase class II 2 OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=fumC2 PE=3 SV=1 13 477 8.0E-166
sp|O66271|FUMC_THET2 Fumarate hydratase class II OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=fumC PE=3 SV=2 12 474 8.0E-166
sp|Q8CUH5|FUMC_OCEIH Fumarate hydratase class II OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=fumC PE=3 SV=1 12 475 2.0E-165
sp|O84863|FUMC_CHLTR Fumarate hydratase class II OS=Chlamydia trachomatis (strain D/UW-3/Cx) GN=fumC PE=3 SV=1 14 477 2.0E-165
sp|Q4L7F5|FUMC_STAHJ Fumarate hydratase class II OS=Staphylococcus haemolyticus (strain JCSC1435) GN=fumC PE=3 SV=1 13 474 4.0E-165
sp|Q60022|FUMC_THEAQ Fumarate hydratase class II OS=Thermus aquaticus GN=fumC PE=3 SV=1 12 474 7.0E-164
sp|Q49YP8|FUMC_STAS1 Fumarate hydratase class II OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=fumC PE=3 SV=1 14 475 9.0E-164
sp|Q8TS07|FUMC_METAC Fumarate hydratase class II OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=fumC PE=3 SV=2 14 477 2.0E-163
sp|Q88M20|FUMC_PSEPK Fumarate hydratase class II OS=Pseudomonas putida (strain KT2440) GN=fumC PE=3 SV=1 13 474 2.0E-162
sp|Q9PL64|FUMC_CHLMU Fumarate hydratase class II OS=Chlamydia muridarum (strain MoPn / Nigg) GN=fumC PE=3 SV=1 14 476 3.0E-160
sp|Q89XM2|FUMC2_BRADU Fumarate hydratase class II 2 OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=fumC2 PE=3 SV=2 11 474 9.0E-160
sp|Q9KCX4|FUMC_BACHD Fumarate hydratase class II OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=fumC PE=3 SV=1 13 475 1.0E-156
sp|Q7V5R2|FUMC_PROMM Fumarate hydratase class II OS=Prochlorococcus marinus (strain MIT 9313) GN=fumC PE=3 SV=1 14 471 3.0E-152
sp|Q929E8|FUMC_LISIN Fumarate hydratase class II OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=fumC PE=3 SV=1 14 468 1.0E-151
sp|Q8Y551|FUMC_LISMO Fumarate hydratase class II OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=fumC PE=3 SV=1 14 468 1.0E-150
sp|Q7VR50|FUMC_BLOFL Fumarate hydratase class II OS=Blochmannia floridanus GN=fumC PE=3 SV=1 27 474 2.0E-150
sp|Q71XE0|FUMC_LISMF Fumarate hydratase class II OS=Listeria monocytogenes serotype 4b (strain F2365) GN=fumC PE=3 SV=1 14 468 8.0E-150
sp|Q7U8I1|FUMC_SYNPX Fumarate hydratase class II OS=Synechococcus sp. (strain WH8102) GN=fumC PE=3 SV=2 14 476 3.0E-149
sp|Q9HQ29|FUMC_HALSA Fumarate hydratase class II OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=fumC PE=3 SV=1 10 471 7.0E-148
sp|Q7VA47|FUMC_PROMA Fumarate hydratase class II OS=Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) GN=fumC PE=3 SV=1 14 473 2.0E-141
sp|Q8NRN8|FUMC_CORGL Fumarate hydratase class II OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=fumC PE=3 SV=1 9 464 2.0E-133
sp|Q9FBN6|FUMC_STRCO Fumarate hydratase class II OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=fumC PE=3 SV=1 11 453 8.0E-133
sp|Q7V024|FUMC_PROMP Fumarate hydratase class II OS=Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4) GN=fumC PE=3 SV=1 14 472 1.0E-130
sp|Q87DC2|FUMC_XYLFT Fumarate hydratase class II OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=fumC PE=3 SV=1 5 468 7.0E-128
sp|Q9PD25|FUMC_XYLFA Fumarate hydratase class II OS=Xylella fastidiosa (strain 9a5c) GN=fumC PE=3 SV=1 5 468 7.0E-127
sp|P9WN93|FUMC_MYCTU Fumarate hydratase class II OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=fumC PE=1 SV=1 8 453 3.0E-125
sp|P9WN92|FUMC_MYCTO Fumarate hydratase class II OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=fumC PE=3 SV=1 8 453 3.0E-125
sp|Q7U0N6|FUMC_MYCBO Fumarate hydratase class II OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=fumC PE=3 SV=1 8 453 3.0E-125
sp|Q8FQP8|FUMC_COREF Fumarate hydratase class II OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) GN=fumC PE=3 SV=2 9 464 1.0E-124
sp|Q82ID7|FUMC_STRAW Fumarate hydratase class II OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=fumC PE=3 SV=1 14 453 1.0E-121
sp|Q51404|FUMC1_PSEAE Fumarate hydratase class II 1 OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=fumC1 PE=3 SV=1 11 469 4.0E-116
sp|Q9ZLI5|ASPA_HELPJ Aspartate ammonia-lyase OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=aspA PE=3 SV=1 14 477 1.0E-109
sp|P56149|ASPA_HELPY Aspartate ammonia-lyase OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=aspA PE=3 SV=1 14 477 1.0E-109
sp|P26899|ASPA_BACSU Aspartate ammonia-lyase OS=Bacillus subtilis (strain 168) GN=ansB PE=3 SV=2 12 474 1.0E-101
sp|Q9HTD7|ASPA_PSEAE Aspartate ammonia-lyase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=aspA PE=3 SV=1 8 475 5.0E-98
sp|P07346|ASPA_PSEFL Aspartate ammonia-lyase OS=Pseudomonas fluorescens GN=aspA PE=3 SV=1 8 475 4.0E-97
sp|Q59200|ASPA_CORGL Aspartate ammonia-lyase OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=aspA PE=3 SV=2 14 474 6.0E-90
sp|P0AC40|ASPA_SHIFL Aspartate ammonia-lyase OS=Shigella flexneri GN=aspA PE=3 SV=1 10 474 6.0E-90
sp|P0AC38|ASPA_ECOLI Aspartate ammonia-lyase OS=Escherichia coli (strain K12) GN=aspA PE=1 SV=1 10 474 6.0E-90
sp|P0AC39|ASPA_ECOL6 Aspartate ammonia-lyase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=aspA PE=3 SV=1 10 474 6.0E-90
sp|Q8XDS0|ASPA_ECO57 Aspartate ammonia-lyase OS=Escherichia coli O157:H7 GN=aspA PE=3 SV=2 10 474 6.0E-90
sp|P33109|ASPA_SERMA Aspartate ammonia-lyase OS=Serratia marcescens GN=aspA PE=3 SV=1 10 474 1.0E-88
sp|P44324|ASPA_HAEIN Aspartate ammonia-lyase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=aspA PE=3 SV=1 11 474 2.0E-88
sp|P39461|FUMC_SULSO Fumarate hydratase class II OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=fumC PE=1 SV=1 50 474 6.0E-87
sp|O58582|PUR8_PYRHO Adenylosuccinate lyase OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=purB PE=3 SV=1 143 478 2.0E-11
sp|O27580|PUR8_METTH Adenylosuccinate lyase OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=purB PE=3 SV=1 142 478 2.0E-10
sp|B1YJ36|ARLY_EXIS2 Argininosuccinate lyase OS=Exiguobacterium sibiricum (strain DSM 17290 / JCM 13490 / 255-15) GN=argH PE=3 SV=1 137 355 2.0E-09
sp|B4S7P9|ARLY_PROA2 Argininosuccinate lyase OS=Prosthecochloris aestuarii (strain DSM 271 / SK 413) GN=argH PE=3 SV=1 79 476 2.0E-09
sp|Q1MQL6|ARLY_LAWIP Argininosuccinate lyase OS=Lawsonia intracellularis (strain PHE/MN1-00) GN=argH PE=3 SV=1 183 450 1.0E-08
sp|C6BTR8|ARLY_DESAD Argininosuccinate lyase OS=Desulfovibrio salexigens (strain ATCC 14822 / DSM 2638 / NCIB 8403 / VKM B-1763) GN=argH PE=3 SV=1 120 364 2.0E-08
sp|Q58339|PUR8_METJA Adenylosuccinate lyase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=purB PE=3 SV=1 142 473 3.0E-08
sp|A3DBU0|ARLY_CLOTH Argininosuccinate lyase OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=argH PE=3 SV=1 79 358 4.0E-08
sp|A1VEQ1|ARLY_DESVV Argininosuccinate lyase OS=Desulfovibrio vulgaris subsp. vulgaris (strain DP4) GN=argH PE=3 SV=1 197 479 7.0E-08
sp|Q72D36|ARLY_DESVH Argininosuccinate lyase OS=Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) GN=argH PE=3 SV=1 197 479 7.0E-08
sp|A9BIA3|ARLY_PETMO Argininosuccinate lyase OS=Petrotoga mobilis (strain DSM 10674 / SJ95) GN=argH PE=3 SV=1 169 364 1.0E-07
sp|A5GHM4|ARLY_SYNPW Argininosuccinate lyase OS=Synechococcus sp. (strain WH7803) GN=argH PE=3 SV=1 120 364 1.0E-07
sp|Q0W7A4|ARLY_METAR Argininosuccinate lyase OS=Methanocella arvoryzae (strain DSM 22066 / NBRC 105507 / MRE50) GN=argH PE=3 SV=1 129 379 2.0E-07
sp|B3GY67|ARLY_ACTP7 Argininosuccinate lyase OS=Actinobacillus pleuropneumoniae serotype 7 (strain AP76) GN=argH PE=3 SV=1 189 364 2.0E-07
sp|A3N1I1|ARLY_ACTP2 Argininosuccinate lyase OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=argH PE=3 SV=1 189 364 2.0E-07
sp|B0BQC2|ARLY_ACTPJ Argininosuccinate lyase OS=Actinobacillus pleuropneumoniae serotype 3 (strain JL03) GN=argH PE=3 SV=1 189 364 2.0E-07
sp|O28041|PUR8_ARCFU Adenylosuccinate lyase OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=purB PE=3 SV=1 144 343 3.0E-07
sp|P57909|ARLY_PASMU Argininosuccinate lyase OS=Pasteurella multocida (strain Pm70) GN=argH PE=3 SV=1 163 354 3.0E-07
sp|Q3B0Z0|ARLY_SYNS9 Argininosuccinate lyase OS=Synechococcus sp. (strain CC9902) GN=argH PE=3 SV=2 112 476 4.0E-07
sp|C1CXS0|ARLY_DEIDV Argininosuccinate lyase OS=Deinococcus deserti (strain VCD115 / DSM 17065 / LMG 22923) GN=argH PE=3 SV=1 169 355 4.0E-07
sp|A5UHW3|ARLY_HAEIG Argininosuccinate lyase OS=Haemophilus influenzae (strain PittGG) GN=argH PE=3 SV=1 197 355 4.0E-07
sp|A5UDR3|ARLY_HAEIE Argininosuccinate lyase OS=Haemophilus influenzae (strain PittEE) GN=argH PE=3 SV=1 197 355 4.0E-07
sp|A2RHL0|ARLY_LACLM Argininosuccinate lyase OS=Lactococcus lactis subsp. cremoris (strain MG1363) GN=argH PE=3 SV=1 27 364 7.0E-07
sp|C4L7S8|ARLY_TOLAT Argininosuccinate lyase OS=Tolumonas auensis (strain DSM 9187 / TA4) GN=argH PE=3 SV=1 197 354 1.0E-06
sp|Q1IWM5|ARLY_DEIGD Argininosuccinate lyase OS=Deinococcus geothermalis (strain DSM 11300) GN=argH PE=3 SV=1 169 355 1.0E-06
sp|Q8KDJ5|ARLY_CHLTE Argininosuccinate lyase OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=argH PE=3 SV=1 83 476 1.0E-06
sp|Q30YB9|ARLY_DESAG Argininosuccinate lyase OS=Desulfovibrio alaskensis (strain G20) GN=argH PE=3 SV=1 79 364 1.0E-06
sp|Q9RWJ0|ARLY_DEIRA Argininosuccinate lyase OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=argH PE=3 SV=2 169 358 1.0E-06
sp|B2G6Y7|ARLY_LACRJ Argininosuccinate lyase OS=Lactobacillus reuteri (strain JCM 1112) GN=argH PE=3 SV=1 25 364 1.0E-06
sp|A5VJH2|ARLY_LACRD Argininosuccinate lyase OS=Lactobacillus reuteri (strain DSM 20016) GN=argH PE=3 SV=1 25 364 1.0E-06
sp|Q0I2U1|ARLY_HAES1 Argininosuccinate lyase OS=Haemophilus somnus (strain 129Pt) GN=argH PE=3 SV=1 179 354 2.0E-06
sp|B0UTI4|ARLY_HISS2 Argininosuccinate lyase OS=Histophilus somni (strain 2336) GN=argH PE=3 SV=1 179 354 2.0E-06
sp|Q8KA59|ARLY_BUCAP Argininosuccinate lyase OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=argH PE=3 SV=1 192 450 2.0E-06
sp|P44314|ARLY_HAEIN Argininosuccinate lyase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=argH PE=3 SV=1 197 355 2.0E-06
sp|Q4QM89|ARLY_HAEI8 Argininosuccinate lyase OS=Haemophilus influenzae (strain 86-028NP) GN=argH PE=3 SV=1 197 355 2.0E-06
sp|A9VKE0|ARLY_BACWK Argininosuccinate lyase OS=Bacillus weihenstephanensis (strain KBAB4) GN=argH PE=3 SV=1 143 355 2.0E-06
sp|Q4L4X6|ARLY_STAHJ Argininosuccinate lyase OS=Staphylococcus haemolyticus (strain JCSC1435) GN=argH PE=3 SV=1 149 469 2.0E-06
sp|Q9RSE6|PUR8_DEIRA Adenylosuccinate lyase OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=purB PE=3 SV=1 196 346 2.0E-06
sp|O42889|YBN5_SCHPO Uncharacterized protein C8E4.05c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC8E4.05c PE=3 SV=1 175 473 2.0E-06
sp|P57159|ARLY_BUCAI Argininosuccinate lyase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=argH PE=3 SV=1 192 361 3.0E-06
sp|Q81KV8|ARLY_BACAN Argininosuccinate lyase OS=Bacillus anthracis GN=argH-2 PE=3 SV=1 143 468 4.0E-06
sp|C3L913|ARLY_BACAC Argininosuccinate lyase OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=argH PE=3 SV=1 143 468 4.0E-06
sp|C3PB96|ARLY_BACAA Argininosuccinate lyase OS=Bacillus anthracis (strain A0248) GN=argH PE=3 SV=1 143 468 4.0E-06
sp|Q5SLL0|ARLY_THET8 Argininosuccinate lyase OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=argH PE=1 SV=1 197 450 4.0E-06
sp|A7ML84|ARLY_CROS8 Argininosuccinate lyase OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=argH PE=3 SV=1 137 354 4.0E-06
sp|A4SIM6|ARLY_AERS4 Argininosuccinate lyase OS=Aeromonas salmonicida (strain A449) GN=argH PE=3 SV=1 143 354 5.0E-06
sp|A8AKW2|ARLY_CITK8 Argininosuccinate lyase OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=argH PE=3 SV=1 130 354 5.0E-06
sp|Q72GZ4|ARLY_THET2 Argininosuccinate lyase OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=argH PE=3 SV=1 197 450 6.0E-06
sp|Q6HCP8|ARLY_BACHK Argininosuccinate lyase OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=argH PE=3 SV=1 143 468 6.0E-06
sp|Q6DAQ9|ARLY_PECAS Argininosuccinate lyase OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=argH PE=3 SV=1 143 354 6.0E-06
sp|P32427|PCAB_PSEPU 3-carboxy-cis,cis-muconate cycloisomerase (Fragment) OS=Pseudomonas putida GN=pcaB PE=1 SV=3 115 369 7.0E-06
sp|Q3B426|ARLY_CHLL7 Argininosuccinate lyase OS=Chlorobium luteolum (strain DSM 273 / 2530) GN=argH PE=3 SV=1 78 358 9.0E-06
sp|B6I5H6|ARLY_ECOSE Argininosuccinate lyase OS=Escherichia coli (strain SE11) GN=argH PE=3 SV=1 130 354 9.0E-06
sp|B7M714|ARLY_ECO8A Argininosuccinate lyase OS=Escherichia coli O8 (strain IAI1) GN=argH PE=3 SV=1 130 354 9.0E-06
sp|B7LA60|ARLY_ECO55 Argininosuccinate lyase OS=Escherichia coli (strain 55989 / EAEC) GN=argH PE=3 SV=1 130 354 9.0E-06
sp|A7ZUH8|ARLY_ECO24 Argininosuccinate lyase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=argH PE=3 SV=1 130 354 9.0E-06
sp|Q8X730|ARLY_ECO57 Argininosuccinate lyase OS=Escherichia coli O157:H7 GN=argH PE=3 SV=1 130 354 9.0E-06
sp|Q65W16|ARLY_MANSM Argininosuccinate lyase OS=Mannheimia succiniciproducens (strain MBEL55E) GN=argH PE=3 SV=1 179 364 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0006099 tricarboxylic acid cycle Yes
GO:0016829 lyase activity Yes
GO:0003674 molecular_function No
GO:0008152 metabolic process No
GO:0003824 catalytic activity No
GO:0008150 biological_process No
GO:0044238 primary metabolic process No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup4079
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1370
Ophiocordyceps australis map64 (Brazil) OphauB2|5732
Ophiocordyceps camponoti-floridani Ophcf2|03450
Ophiocordyceps camponoti-rufipedis Ophun1|1727 (this protein)
Ophiocordyceps kimflemingae Ophio5|4328
Ophiocordyceps subramaniannii Hirsu2|8229

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|1727
MATTMASSSSSETRTESDAFGNIDVPADRYWGAQTERSLENFRINQPQDRMPAPVIRAFGILKGAAATVNMRFGL
DAAIGRAIQQAAKEVADGKLLDHFPLVVWQTGSGTQSNMNANEVIANRAIELLGGRMGSKTPVHPNDHVNRSASS
NDTFPTVMHIAAVLELEGDLLPALGSLRKALQAKVDDFAARNIIKIGRTHLQDATPLTLAQEFSGYVAQLDFGVS
RVESALPHLRLLAQGGTAVGTGINTFEGFAEAVADEVSRMTGTEFRTAPNKFEALAAHDAIVQAHGCLNTLAGSL
TKIAQDVRYLGSGPRCGLGELSLPENEPGSSIMPGKVNPTQCEALTMVCAQVMGNNVATTIGGMNGQFELNVYKP
LMIRNLLHSSRLLADGMRSFEKNLMAGLRANEDRIGSIMHESLMLVTCLNPKIGYDMASKVAKNAHKKGLTLKQS
ALELEALTEAEFDELVKPELMIGPKRHVS*
Coding >Ophun1|1727
ATGGCGACGACGATGGCCTCGAGCTCGAGCTCCGAGACACGCACCGAGAGCGATGCCTTTGGCAACATCGACGTG
CCGGCCGATCGCTACTGGGGGGCGCAGACGGAGCGGTCGCTGGAGAACTTCCGCATCAATCAGCCGCAGGATCGG
ATGCCGGCTCCGGTGATTCGCGCGTTTGGGATCCTGAAAGGGGCTGCTGCGACGGTGAATATGCGCTTCGGGCTG
GACGCCGCCATCGGACGCGCCATCCAGCAGGCTGCCAAAGAAGTCGCCGACGGAAAGCTGCTCGATCACTTCCCC
CTCGTCGTCTGGCAGACGGGCTCAGGCACGCAGTCCAACATGAACGCCAACGAAGTCATCGCCAACCGCGCCATC
GAGCTGCTGGGCGGACGAATGGGCAGCAAGACGCCTGTTCATCCCAACGATCACGTCAACCGCAGCGCCTCGTCC
AACGATACCTTCCCGACCGTCATGCACATCGCCGCCGTTCTCGAGCTCGAGGGTGACCTGCTGCCGGCACTCGGT
AGCCTACGAAAGGCGCTGCAGGCCAAGGTGGACGACTTTGCCGCCCGCAACATCATCAAGATCGGCCGCACCCAT
CTCCAGGACGCGACGCCCTTGACTCTCGCCCAGGAGTTCTCGGGCTACGTCGCTCAGCTCGACTTTGGCGTCTCC
CGCGTCGAGAGCGCGCTGCCGCATCTGCGTCTGCTGGCCCAGGGAGGCACCGCCGTCGGGACCGGCATCAATACC
TTTGAGGGCTTCGCCGAGGCCGTCGCCGACGAGGTCAGCCGCATGACGGGCACCGAGTTCCGCACCGCGCCCAAC
AAGTTTGAGGCTCTGGCCGCGCACGACGCCATCGTCCAGGCTCACGGCTGCCTCAACACGCTGGCCGGGTCGCTC
ACCAAGATTGCGCAGGACGTTCGGTACCTCGGCAGCGGTCCGCGGTGCGGCCTCGGCGAGCTGTCACTTCCGGAG
AACGAGCCCGGGAGCAGCATCATGCCGGGAAAGGTCAACCCTACGCAGTGCGAGGCGCTGACCATGGTGTGCGCT
CAGGTCATGGGCAACAACGTGGCGACGACGATTGGCGGCATGAACGGCCAGTTTGAGCTCAACGTTTACAAACCG
CTGATGATTCGCAATCTCTTGCACAGCTCGCGGCTGCTGGCGGATGGGATGCGATCGTTTGAGAAGAATCTGATG
GCCGGACTGCGGGCCAACGAGGACAGGATTGGGAGCATCATGCACGAGTCGCTGATGCTGGTGACTTGCCTCAAC
CCCAAGATCGGCTACGACATGGCCAGCAAGGTGGCCAAGAACGCGCACAAGAAAGGGCTGACGCTGAAGCAGAGC
GCGCTCGAGCTCGAGGCGCTGACGGAAGCCGAGTTTGACGAGCTGGTCAAGCCGGAGCTGATGATTGGGCCCAAG
CGCCATGTCTCGTAA
Transcript >Ophun1|1727
ATGGCGACGACGATGGCCTCGAGCTCGAGCTCCGAGACACGCACCGAGAGCGATGCCTTTGGCAACATCGACGTG
CCGGCCGATCGCTACTGGGGGGCGCAGACGGAGCGGTCGCTGGAGAACTTCCGCATCAATCAGCCGCAGGATCGG
ATGCCGGCTCCGGTGATTCGCGCGTTTGGGATCCTGAAAGGGGCTGCTGCGACGGTGAATATGCGCTTCGGGCTG
GACGCCGCCATCGGACGCGCCATCCAGCAGGCTGCCAAAGAAGTCGCCGACGGAAAGCTGCTCGATCACTTCCCC
CTCGTCGTCTGGCAGACGGGCTCAGGCACGCAGTCCAACATGAACGCCAACGAAGTCATCGCCAACCGCGCCATC
GAGCTGCTGGGCGGACGAATGGGCAGCAAGACGCCTGTTCATCCCAACGATCACGTCAACCGCAGCGCCTCGTCC
AACGATACCTTCCCGACCGTCATGCACATCGCCGCCGTTCTCGAGCTCGAGGGTGACCTGCTGCCGGCACTCGGT
AGCCTACGAAAGGCGCTGCAGGCCAAGGTGGACGACTTTGCCGCCCGCAACATCATCAAGATCGGCCGCACCCAT
CTCCAGGACGCGACGCCCTTGACTCTCGCCCAGGAGTTCTCGGGCTACGTCGCTCAGCTCGACTTTGGCGTCTCC
CGCGTCGAGAGCGCGCTGCCGCATCTGCGTCTGCTGGCCCAGGGAGGCACCGCCGTCGGGACCGGCATCAATACC
TTTGAGGGCTTCGCCGAGGCCGTCGCCGACGAGGTCAGCCGCATGACGGGCACCGAGTTCCGCACCGCGCCCAAC
AAGTTTGAGGCTCTGGCCGCGCACGACGCCATCGTCCAGGCTCACGGCTGCCTCAACACGCTGGCCGGGTCGCTC
ACCAAGATTGCGCAGGACGTTCGGTACCTCGGCAGCGGTCCGCGGTGCGGCCTCGGCGAGCTGTCACTTCCGGAG
AACGAGCCCGGGAGCAGCATCATGCCGGGAAAGGTCAACCCTACGCAGTGCGAGGCGCTGACCATGGTGTGCGCT
CAGGTCATGGGCAACAACGTGGCGACGACGATTGGCGGCATGAACGGCCAGTTTGAGCTCAACGTTTACAAACCG
CTGATGATTCGCAATCTCTTGCACAGCTCGCGGCTGCTGGCGGATGGGATGCGATCGTTTGAGAAGAATCTGATG
GCCGGACTGCGGGCCAACGAGGACAGGATTGGGAGCATCATGCACGAGTCGCTGATGCTGGTGACTTGCCTCAAC
CCCAAGATCGGCTACGACATGGCCAGCAAGGTGGCCAAGAACGCGCACAAGAAAGGGCTGACGCTGAAGCAGAGC
GCGCTCGAGCTCGAGGCGCTGACGGAAGCCGAGTTTGACGAGCTGGTCAAGCCGGAGCTGATGATTGGGCCCAAG
CGCCATGTCTCGTAA
Gene >Ophun1|1727
ATGGCGACGACGATGGCCTCGAGCTCGAGCTCCGAGACACGCACCGAGAGCGATGCCTTTGGCAACATCGACGTG
CCGGCCGATCGCTACTGGGGGGCGCAGACGGAGCGGTCGCTGGAGAACTTCCGCATCAATCAGCCGCAGGATCGG
ATGCCGGCTCCGGTGATTCGCGCGTTTGGGATCCTGAAAGGGGCTGCTGCGACGGTGAATATGCGCTTCGGGCTG
GGTGAGTGGATGTGCATGGTGTTGATGTTTGCTGACAACCAAGATGCGCAGACGCCGCCATCGGACGCGCCATCC
AGCAGGCTGCCAAAGAAGTCGCCGACGGAAAGCTGCTCGATCACTTCCCCCTCGTCGTCTGGCAGACGGGCTCAG
GCACGCAGTCCAACATGAACGCCAACGAAGTCATCGCCAACCGCGCCATCGAGCTGCTGGGCGGACGAATGGGCA
GCAAGACGCCTGTTCATCCCAACGATCACGTCAACCGCAGCGCCTCGTCCAACGATACCTTCCCGACCGTCATGC
ACATCGCCGCCGTTCTCGAGCTCGAGGGTGACCTGCTGCCGGCACTCGGTAGCCTACGAAAGGCGCTGCAGGCCA
AGGTGGACGACTTTGCCGCCCGCAACATCATCAAGATCGGCCGCACCCATCTCCAGGACGCGACGCCCTTGACTC
TCGCCCAGGAGTTCTCGGGCTACGTCGCTCAGCTCGACTTTGGCGTCTCCCGCGTCGAGAGCGCGCTGCCGCATC
TGCGTCTGCTGGCCCAGGGAGGCACCGCCGTCGGGACCGGCATCAATACCTTTGAGGGCTTCGCCGAGGCCGTCG
CCGACGAGGTCAGCCGCATGACGGGCACCGAGTTCCGCACCGCGCCCAACAAGTTTGAGGCTCTGGCCGCGCACG
ACGCCATCGTCCAGGCTCACGGCTGCCTCAACACGCTGGCCGGGTCGCTCACCAAGATTGCGCAGGACGTTCGGT
ACCTCGGCAGCGGTCCGCGGTGCGGCCTCGGCGAGCTGTCACTTCCGGAGAACGAGCCCGGGAGCAGCATCATGC
CGGGAAAGGTCAACCCTACGCAGTGCGAGGCGCTGACCATGGTGTGCGCTCAGGTCATGGGCAACAACGTGGCGA
CGACGATTGGCGGCATGAACGGCCAGTTTGAGCTCAACGTTTACAAACCGCTGATGATTCGCAATCTCTTGCACA
GCTCGCGGCTGCTGGCGGATGGGATGCGATCGTTTGAGAAGAATCTGATGGCCGGACTGCGGGCCAACGAGGACA
GGATTGGGAGCATCATGCACGAGTCGTGAGTGATTTCCGTCCCGATTGCTACCTACGAGAGAATATGGCTGACGA
CAAGACCCAGGCTGATGCTGGTGACTTGCCTCAACCCCAAGATCGGCTACGACATGGCCAGCAAGGTGGCCAAGA
ACGCGCACAAGAAAGGGCTGACGCTGAAGCAGAGCGCGCTCGAGCTCGAGGCGCTGACGGAAGCCGAGTTTGACG
AGCTGGTCAAGCCGGAGCTGATGATTGGGCCCAAGCGCCATGTCTCGTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail