Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|1725
Gene name
LocationContig_175:15097..18640
Strand-
Gene length (bp)3543
Transcript length (bp)3309
Coding sequence length (bp)3309
Protein length (aa) 1103

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02463 SMC_N RecF/RecN/SMC N terminal domain 6.4E-25 60 1055
PF13476 AAA_23 AAA domain 2.8E-13 62 277

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O13710|SMC5_SCHPO Structural maintenance of chromosomes protein 5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=smc5 PE=1 SV=3 51 1081 8.0E-151
sp|Q5ZJY5|SMC5_CHICK Structural maintenance of chromosomes protein 5 OS=Gallus gallus GN=SMC5 PE=2 SV=1 58 1079 2.0E-124
sp|Q8IY18|SMC5_HUMAN Structural maintenance of chromosomes protein 5 OS=Homo sapiens GN=SMC5 PE=1 SV=2 55 1079 6.0E-124
sp|Q8CG46|SMC5_MOUSE Structural maintenance of chromosomes protein 5 OS=Mus musculus GN=Smc5 PE=1 SV=1 49 1079 1.0E-121
sp|Q802R9|SMC5_TAKRU Structural maintenance of chromosomes protein 5 OS=Takifugu rubripes GN=smc5 PE=2 SV=1 27 1095 3.0E-115
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O13710|SMC5_SCHPO Structural maintenance of chromosomes protein 5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=smc5 PE=1 SV=3 51 1081 8.0E-151
sp|Q5ZJY5|SMC5_CHICK Structural maintenance of chromosomes protein 5 OS=Gallus gallus GN=SMC5 PE=2 SV=1 58 1079 2.0E-124
sp|Q8IY18|SMC5_HUMAN Structural maintenance of chromosomes protein 5 OS=Homo sapiens GN=SMC5 PE=1 SV=2 55 1079 6.0E-124
sp|Q8CG46|SMC5_MOUSE Structural maintenance of chromosomes protein 5 OS=Mus musculus GN=Smc5 PE=1 SV=1 49 1079 1.0E-121
sp|Q802R9|SMC5_TAKRU Structural maintenance of chromosomes protein 5 OS=Takifugu rubripes GN=smc5 PE=2 SV=1 27 1095 3.0E-115
sp|Q805A1|SMC5_XENLA Structural maintenance of chromosomes protein 5 OS=Xenopus laevis GN=smc5 PE=2 SV=1 58 1079 3.0E-115
sp|Q08204|SMC5_YEAST Structural maintenance of chromosomes protein 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SMC5 PE=1 SV=1 15 1089 1.0E-112
sp|Q9LFS8|SMC5_ARATH Structural maintenance of chromosomes protein 5 OS=Arabidopsis thaliana GN=SMC5 PE=2 SV=1 53 1079 3.0E-108
sp|Q9FII7|SMC6B_ARATH Structural maintenance of chromosomes protein 6B OS=Arabidopsis thaliana GN=SMC6B PE=2 SV=1 58 369 4.0E-14
sp|Q6P9I7|SMC6_XENLA Structural maintenance of chromosomes protein 6 OS=Xenopus laevis GN=smc6 PE=2 SV=1 1 197 1.0E-12
sp|Q9FLR5|SMC6A_ARATH Structural maintenance of chromosomes protein 6A OS=Arabidopsis thaliana GN=SMC6A PE=2 SV=1 58 298 2.0E-12
sp|P53692|SMC6_SCHPO Structural maintenance of chromosomes protein 6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=smc6 PE=1 SV=1 54 517 2.0E-12
sp|Q96SB8|SMC6_HUMAN Structural maintenance of chromosomes protein 6 OS=Homo sapiens GN=SMC6 PE=1 SV=2 4 197 5.0E-12
sp|Q12749|SMC6_YEAST Structural maintenance of chromosomes protein 6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SMC6 PE=1 SV=1 20 369 5.0E-11
sp|Q924W5|SMC6_MOUSE Structural maintenance of chromosomes protein 6 OS=Mus musculus GN=Smc6 PE=1 SV=1 58 197 8.0E-11
sp|Q96SB8|SMC6_HUMAN Structural maintenance of chromosomes protein 6 OS=Homo sapiens GN=SMC6 PE=1 SV=2 798 1077 9.0E-10
sp|Q6P9I7|SMC6_XENLA Structural maintenance of chromosomes protein 6 OS=Xenopus laevis GN=smc6 PE=2 SV=1 816 1071 1.0E-09
sp|Q924W5|SMC6_MOUSE Structural maintenance of chromosomes protein 6 OS=Mus musculus GN=Smc6 PE=1 SV=1 994 1077 3.0E-09
sp|Q54I56|SMC6_DICDI Structural maintenance of chromosomes protein 6 OS=Dictyostelium discoideum GN=smc6 PE=3 SV=1 58 603 4.0E-09
sp|O58687|RAD50_PYRHO DNA double-strand break repair Rad50 ATPase OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=rad50 PE=3 SV=1 60 188 6.0E-09
sp|Q9SN90|SMC22_ARATH Structural maintenance of chromosomes protein 2-2 OS=Arabidopsis thaliana GN=SMC2-2 PE=2 SV=1 68 206 2.0E-07
sp|P38989|SMC2_YEAST Structural maintenance of chromosomes protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SMC2 PE=1 SV=1 80 311 3.0E-07
sp|Q802R8|SMC6_TAKRU Structural maintenance of chromosomes protein 6 OS=Takifugu rubripes GN=smc6 PE=2 SV=1 58 192 3.0E-07
sp|Q69GZ5|SMC_METVO Chromosome partition protein Smc OS=Methanococcus voltae GN=smc PE=3 SV=1 922 1055 1.0E-06
sp|Q24U48|SMC_DESHY Chromosome partition protein Smc OS=Desulfitobacterium hafniense (strain Y51) GN=smc PE=3 SV=1 882 1031 2.0E-06
sp|Q12267|SMC4_YEAST Structural maintenance of chromosomes protein 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SMC4 PE=1 SV=1 685 1055 2.0E-06
sp|Q8IED2|SMC2_PLAF7 Structural maintenance of chromosomes protein 2 OS=Plasmodium falciparum (isolate 3D7) GN=MAL13P1.96 PE=3 SV=1 80 206 2.0E-06
sp|Q9UZC8|RAD50_PYRAB DNA double-strand break repair Rad50 ATPase OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=rad50 PE=3 SV=1 63 164 2.0E-06
sp|Q09591|MIX1_CAEEL Mitotic chromosome and X-chromosome-associated protein mix-1 OS=Caenorhabditis elegans GN=mix-1 PE=1 SV=2 80 454 3.0E-06
sp|Q54LV0|SMC4_DICDI Structural maintenance of chromosomes protein 4 OS=Dictyostelium discoideum GN=smc4 PE=3 SV=1 726 1055 5.0E-06
sp|D4GUK1|RAD50_HALVD DNA double-strand break repair Rad50 ATPase OS=Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) GN=rad50 PE=1 SV=1 62 383 5.0E-06
sp|Q9FII7|SMC6B_ARATH Structural maintenance of chromosomes protein 6B OS=Arabidopsis thaliana GN=SMC6B PE=2 SV=1 994 1056 8.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0140664 ATP-dependent DNA damage sensor activity Yes
GO:0140657 ATP-dependent activity No
GO:0003674 molecular_function No
GO:0140640 catalytic activity, acting on a nucleic acid No
GO:0140612 DNA damage sensor activity No
GO:0008094 ATP-dependent activity, acting on DNA No
GO:0003824 catalytic activity No
GO:0140097 catalytic activity, acting on DNA No
GO:0140299 small molecule sensor activity No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup4077
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5722
Ophiocordyceps australis map64 (Brazil) OphauB2|5734
Ophiocordyceps camponoti-floridani Ophcf2|03448
Ophiocordyceps camponoti-rufipedis Ophun1|1725 (this protein)
Ophiocordyceps kimflemingae Ophio5|4326
Ophiocordyceps subramaniannii Hirsu2|8227

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|1725
MAHSSSRRRRREGSDEGDPFDSDQHDADPPKRRRLDLGSNGTDLSSQDPGIADDFHPGAIIRVKVINFVTYESAE
FFPGPNLNMVIGPNGTGKSSLVCAICLGLGYSPKLLGRAGSVKEFVKHGKDTATIEIELQKRPSDRTNFVVSNQI
RREQNSQKWWLNGKETTHKTVLSLMKSLKIQVDNLCQFLPQDRVVEFAACTPVDLLRETLRAAAPEEMLLWQSEL
RELHGKKKDMGKAVLDDVEDLKNLESRQQGLQADVDRIREREEIQARVTHLQSALVLAQYQEVRAKYQEARERKK
DAEAALRWLQQECEPSLQAVNRKMEYTSQIEAAVSGIDEDLKQAGKEAINMLRDANQAAETINEMKNQLDAERKG
FDTKRKELAASKSKITAYQADLKNQPPEFNAADWNQKIRAQEHIMRELDTEQEQVMADLDSVKTKGSAVVQRIKN
LEHELRDLDTQQGQQMILLKKYFPEAYDVLKWLNEHQHEFEKEVFGPPMISCSIKDERFSNLVQTFMQRDDFVCF
TPQTKNDHKKLSHSVFSLLSTVATIRTVEQPLESFKRPLSPEQAASYGFDGFVLDYIDGPAPVLAMLCSNKGFHQ
TALSLRAHNDSDYERIARSGVVTQWAAGEESFQIRGCRDYGSDVKLTTARAVTPGMFWTSQPVDSQEKTELSRLL
REKNGEKDLLRNELNQLKEKKSSFDERRDETYKKMESLRKEKSSLQKDYQKWRSLPEKIESEERNKTAKETALRD
TRKSMADLGYEWDEATTKRARLVIQHNQLLDKMRSAHHASLESQIRLIEARSDVKGLKLANASLMERLDAEKDKV
ATAAAEVAVKRQEGHVLQEKVRDVMDQDEATRELLTQLAEGKTPQELEMDMSAEEAKLEVMHAANPNIMREFERR
AKEIDRLKAKMDEANQALSGLDGQLEGLMAKWEPKLDELVSSINDAFAYNFEQISCAGEVHVHKDDDFDKWALNI
KVRFRPNETLQQLTAHRQSGGERAVSTIFFLMALQSMAQSPFRVVDEINQGMDPRNERMVHERMVEIACREHTSQ
YFLITPKLLTGLRYDAKMRVLCIASGEHMPSDGLKLDFGRCLARQRALMGVS*
Coding >Ophun1|1725
ATGGCGCACTCTTCATCTCGTCGAAGGAGGCGCGAAGGCTCCGACGAAGGCGACCCTTTCGATTCCGACCAGCAC
GATGCTGACCCGCCCAAGCGACGGCGCCTGGACCTTGGCTCGAATGGCACCGACCTCAGCTCCCAGGACCCTGGC
ATCGCCGACGACTTCCATCCGGGTGCCATCATCCGTGTCAAGGTCATCAACTTCGTCACCTACGAAAGCGCCGAG
TTCTTCCCCGGTCCCAACTTGAACATGGTCATCGGCCCCAACGGCACGGGCAAGAGTTCGCTGGTCTGTGCCATC
TGCCTCGGTCTGGGTTACAGCCCTAAACTCCTCGGCCGCGCTGGATCCGTCAAGGAGTTTGTCAAGCACGGAAAG
GACACGGCTACAATAGAGATCGAGCTGCAGAAGCGACCATCCGATCGGACCAACTTTGTCGTGTCCAACCAGATC
CGCCGCGAGCAGAATAGCCAGAAATGGTGGCTCAACGGCAAAGAAACGACCCACAAGACCGTCTTGAGCCTCATG
AAGTCGCTCAAGATTCAAGTTGACAACCTCTGCCAGTTTCTGCCCCAGGACAGGGTCGTCGAGTTCGCCGCCTGC
ACCCCCGTCGATCTTCTTCGCGAGACGCTACGTGCCGCCGCTCCTGAGGAGATGCTTCTGTGGCAGTCGGAGCTG
CGGGAACTCCACGGCAAGAAAAAAGATATGGGAAAGGCTGTCCTCGACGACGTCGAAGACCTCAAGAACCTCGAG
TCTCGCCAGCAGGGTTTACAAGCCGACGTGGATAGAATCCGCGAACGCGAGGAGATCCAGGCGAGGGTCACCCAT
CTTCAGTCCGCCTTGGTGCTTGCCCAGTACCAAGAGGTTCGCGCCAAGTACCAAGAGGCTCGTGAGCGCAAGAAG
GATGCCGAGGCGGCCCTCAGATGGCTCCAACAGGAATGCGAGCCGTCACTGCAAGCCGTCAACCGAAAAATGGAG
TACACGAGCCAAATAGAAGCCGCCGTCAGCGGCATCGACGAGGACCTCAAACAAGCCGGCAAAGAGGCGATCAAC
ATGTTGCGCGACGCGAATCAAGCGGCCGAGACAATCAACGAGATGAAGAACCAGCTCGACGCCGAACGCAAGGGC
TTCGACACCAAGAGGAAGGAGTTGGCTGCGTCCAAGTCCAAGATTACGGCGTACCAAGCGGACCTCAAGAACCAG
CCGCCAGAATTCAACGCTGCCGACTGGAATCAGAAGATTCGTGCCCAAGAACACATCATGCGCGAGCTGGACACG
GAGCAGGAACAAGTGATGGCCGACCTGGACTCTGTTAAGACCAAGGGCTCAGCCGTCGTCCAAAGAATCAAGAAC
CTCGAACACGAGCTCCGAGATCTCGATACGCAGCAGGGCCAGCAAATGATTTTGTTGAAAAAGTATTTCCCGGAA
GCTTACGACGTCTTGAAATGGCTCAATGAACATCAGCACGAATTCGAAAAGGAGGTCTTTGGGCCGCCCATGATC
AGCTGCTCCATCAAAGACGAGCGCTTTTCGAACCTAGTGCAGACCTTTATGCAGAGAGATGATTTCGTCTGCTTC
ACGCCCCAGACGAAAAATGATCATAAGAAGCTATCTCATTCGGTCTTCTCACTGCTGAGTACCGTCGCCACCATT
CGGACAGTCGAACAACCCCTCGAATCCTTCAAAAGACCGTTGAGCCCAGAGCAAGCGGCGAGTTATGGTTTTGAT
GGGTTTGTACTCGATTACATCGACGGACCCGCGCCGGTCCTCGCCATGCTTTGCAGCAACAAGGGATTCCACCAG
ACTGCCCTCTCACTCAGAGCACACAACGACTCTGACTACGAGCGCATCGCCAGGTCTGGTGTGGTCACGCAGTGG
GCCGCAGGCGAGGAGTCGTTCCAAATCCGCGGCTGCAGAGACTACGGCTCCGACGTGAAGCTCACGACTGCCAGA
GCCGTTACGCCGGGCATGTTTTGGACGTCACAGCCCGTCGATAGCCAAGAGAAGACTGAGCTCAGCCGGCTTCTG
CGGGAGAAGAATGGGGAGAAGGACTTGTTGAGGAATGAGCTCAACCAGCTGAAGGAGAAGAAGTCTAGCTTTGAT
GAGCGTCGGGATGAGACGTACAAGAAGATGGAATCTCTGAGAAAGGAAAAGAGCTCATTGCAAAAGGACTACCAG
AAATGGCGGTCCCTTCCGGAGAAGATAGAATCCGAGGAACGCAATAAGACCGCCAAGGAGACGGCGTTGCGTGAC
ACGAGGAAGAGCATGGCCGACCTCGGGTACGAATGGGACGAGGCGACGACGAAGCGAGCCCGGCTCGTAATCCAG
CACAATCAGCTCCTCGACAAGATGCGAAGCGCCCACCACGCCTCTCTAGAGAGCCAGATCCGACTCATCGAGGCC
CGCTCCGACGTAAAGGGTCTCAAGCTCGCCAATGCCAGCCTGATGGAGCGTCTGGACGCAGAAAAGGACAAGGTC
GCGACGGCAGCGGCCGAGGTAGCAGTCAAGAGGCAAGAAGGCCACGTGCTACAAGAAAAAGTCCGCGATGTCATG
GACCAAGACGAGGCCACAAGGGAGCTCCTCACGCAGTTGGCAGAGGGCAAGACGCCACAAGAGCTCGAAATGGAC
ATGTCAGCCGAGGAGGCCAAGCTGGAGGTTATGCACGCCGCCAACCCCAACATCATGCGCGAGTTTGAGCGCCGC
GCCAAGGAGATTGACAGGCTCAAGGCCAAGATGGACGAGGCCAATCAGGCTCTCTCCGGTCTGGACGGCCAGCTC
GAGGGCTTGATGGCCAAGTGGGAGCCCAAGCTGGACGAGCTGGTCTCGAGCATCAACGACGCCTTTGCCTATAAC
TTTGAGCAGATCAGCTGCGCAGGCGAAGTCCACGTCCACAAAGACGACGACTTTGACAAATGGGCTCTCAACATC
AAGGTCCGCTTCCGCCCAAACGAAACCCTCCAACAACTCACCGCCCACCGCCAATCAGGCGGCGAACGCGCCGTC
TCAACAATCTTCTTCCTAATGGCCCTCCAATCCATGGCCCAATCCCCCTTCCGCGTCGTCGACGAAATCAACCAA
GGCATGGACCCGCGCAACGAACGCATGGTGCACGAACGCATGGTGGAAATCGCCTGCCGCGAACACACCAGCCAG
TATTTCCTCATCACCCCCAAGCTGCTCACCGGCTTGCGGTACGATGCCAAGATGCGCGTCTTGTGCATTGCCAGC
GGCGAGCATATGCCTAGCGATGGGCTCAAGTTGGACTTTGGGCGGTGCTTGGCTAGGCAGAGGGCTTTGATGGGC
GTTTCTTAA
Transcript >Ophun1|1725
ATGGCGCACTCTTCATCTCGTCGAAGGAGGCGCGAAGGCTCCGACGAAGGCGACCCTTTCGATTCCGACCAGCAC
GATGCTGACCCGCCCAAGCGACGGCGCCTGGACCTTGGCTCGAATGGCACCGACCTCAGCTCCCAGGACCCTGGC
ATCGCCGACGACTTCCATCCGGGTGCCATCATCCGTGTCAAGGTCATCAACTTCGTCACCTACGAAAGCGCCGAG
TTCTTCCCCGGTCCCAACTTGAACATGGTCATCGGCCCCAACGGCACGGGCAAGAGTTCGCTGGTCTGTGCCATC
TGCCTCGGTCTGGGTTACAGCCCTAAACTCCTCGGCCGCGCTGGATCCGTCAAGGAGTTTGTCAAGCACGGAAAG
GACACGGCTACAATAGAGATCGAGCTGCAGAAGCGACCATCCGATCGGACCAACTTTGTCGTGTCCAACCAGATC
CGCCGCGAGCAGAATAGCCAGAAATGGTGGCTCAACGGCAAAGAAACGACCCACAAGACCGTCTTGAGCCTCATG
AAGTCGCTCAAGATTCAAGTTGACAACCTCTGCCAGTTTCTGCCCCAGGACAGGGTCGTCGAGTTCGCCGCCTGC
ACCCCCGTCGATCTTCTTCGCGAGACGCTACGTGCCGCCGCTCCTGAGGAGATGCTTCTGTGGCAGTCGGAGCTG
CGGGAACTCCACGGCAAGAAAAAAGATATGGGAAAGGCTGTCCTCGACGACGTCGAAGACCTCAAGAACCTCGAG
TCTCGCCAGCAGGGTTTACAAGCCGACGTGGATAGAATCCGCGAACGCGAGGAGATCCAGGCGAGGGTCACCCAT
CTTCAGTCCGCCTTGGTGCTTGCCCAGTACCAAGAGGTTCGCGCCAAGTACCAAGAGGCTCGTGAGCGCAAGAAG
GATGCCGAGGCGGCCCTCAGATGGCTCCAACAGGAATGCGAGCCGTCACTGCAAGCCGTCAACCGAAAAATGGAG
TACACGAGCCAAATAGAAGCCGCCGTCAGCGGCATCGACGAGGACCTCAAACAAGCCGGCAAAGAGGCGATCAAC
ATGTTGCGCGACGCGAATCAAGCGGCCGAGACAATCAACGAGATGAAGAACCAGCTCGACGCCGAACGCAAGGGC
TTCGACACCAAGAGGAAGGAGTTGGCTGCGTCCAAGTCCAAGATTACGGCGTACCAAGCGGACCTCAAGAACCAG
CCGCCAGAATTCAACGCTGCCGACTGGAATCAGAAGATTCGTGCCCAAGAACACATCATGCGCGAGCTGGACACG
GAGCAGGAACAAGTGATGGCCGACCTGGACTCTGTTAAGACCAAGGGCTCAGCCGTCGTCCAAAGAATCAAGAAC
CTCGAACACGAGCTCCGAGATCTCGATACGCAGCAGGGCCAGCAAATGATTTTGTTGAAAAAGTATTTCCCGGAA
GCTTACGACGTCTTGAAATGGCTCAATGAACATCAGCACGAATTCGAAAAGGAGGTCTTTGGGCCGCCCATGATC
AGCTGCTCCATCAAAGACGAGCGCTTTTCGAACCTAGTGCAGACCTTTATGCAGAGAGATGATTTCGTCTGCTTC
ACGCCCCAGACGAAAAATGATCATAAGAAGCTATCTCATTCGGTCTTCTCACTGCTGAGTACCGTCGCCACCATT
CGGACAGTCGAACAACCCCTCGAATCCTTCAAAAGACCGTTGAGCCCAGAGCAAGCGGCGAGTTATGGTTTTGAT
GGGTTTGTACTCGATTACATCGACGGACCCGCGCCGGTCCTCGCCATGCTTTGCAGCAACAAGGGATTCCACCAG
ACTGCCCTCTCACTCAGAGCACACAACGACTCTGACTACGAGCGCATCGCCAGGTCTGGTGTGGTCACGCAGTGG
GCCGCAGGCGAGGAGTCGTTCCAAATCCGCGGCTGCAGAGACTACGGCTCCGACGTGAAGCTCACGACTGCCAGA
GCCGTTACGCCGGGCATGTTTTGGACGTCACAGCCCGTCGATAGCCAAGAGAAGACTGAGCTCAGCCGGCTTCTG
CGGGAGAAGAATGGGGAGAAGGACTTGTTGAGGAATGAGCTCAACCAGCTGAAGGAGAAGAAGTCTAGCTTTGAT
GAGCGTCGGGATGAGACGTACAAGAAGATGGAATCTCTGAGAAAGGAAAAGAGCTCATTGCAAAAGGACTACCAG
AAATGGCGGTCCCTTCCGGAGAAGATAGAATCCGAGGAACGCAATAAGACCGCCAAGGAGACGGCGTTGCGTGAC
ACGAGGAAGAGCATGGCCGACCTCGGGTACGAATGGGACGAGGCGACGACGAAGCGAGCCCGGCTCGTAATCCAG
CACAATCAGCTCCTCGACAAGATGCGAAGCGCCCACCACGCCTCTCTAGAGAGCCAGATCCGACTCATCGAGGCC
CGCTCCGACGTAAAGGGTCTCAAGCTCGCCAATGCCAGCCTGATGGAGCGTCTGGACGCAGAAAAGGACAAGGTC
GCGACGGCAGCGGCCGAGGTAGCAGTCAAGAGGCAAGAAGGCCACGTGCTACAAGAAAAAGTCCGCGATGTCATG
GACCAAGACGAGGCCACAAGGGAGCTCCTCACGCAGTTGGCAGAGGGCAAGACGCCACAAGAGCTCGAAATGGAC
ATGTCAGCCGAGGAGGCCAAGCTGGAGGTTATGCACGCCGCCAACCCCAACATCATGCGCGAGTTTGAGCGCCGC
GCCAAGGAGATTGACAGGCTCAAGGCCAAGATGGACGAGGCCAATCAGGCTCTCTCCGGTCTGGACGGCCAGCTC
GAGGGCTTGATGGCCAAGTGGGAGCCCAAGCTGGACGAGCTGGTCTCGAGCATCAACGACGCCTTTGCCTATAAC
TTTGAGCAGATCAGCTGCGCAGGCGAAGTCCACGTCCACAAAGACGACGACTTTGACAAATGGGCTCTCAACATC
AAGGTCCGCTTCCGCCCAAACGAAACCCTCCAACAACTCACCGCCCACCGCCAATCAGGCGGCGAACGCGCCGTC
TCAACAATCTTCTTCCTAATGGCCCTCCAATCCATGGCCCAATCCCCCTTCCGCGTCGTCGACGAAATCAACCAA
GGCATGGACCCGCGCAACGAACGCATGGTGCACGAACGCATGGTGGAAATCGCCTGCCGCGAACACACCAGCCAG
TATTTCCTCATCACCCCCAAGCTGCTCACCGGCTTGCGGTACGATGCCAAGATGCGCGTCTTGTGCATTGCCAGC
GGCGAGCATATGCCTAGCGATGGGCTCAAGTTGGACTTTGGGCGGTGCTTGGCTAGGCAGAGGGCTTTGATGGGC
GTTTCTTAA
Gene >Ophun1|1725
ATGGCGCACTCTTCATCTCGTCGAAGGAGGCGCGAAGGCTCCGACGAAGGCGACCCTTTCGATTCCGACCAGCAC
GATGCTGACCCGCCCAAGCGACGGCGCCTGGACCTTGGCTCGAATGGCACCGACCTCAGCTCCCAGGACCCTGGC
ATCGCCGACGACTTCCATCCGGGTGCCATCATCCGTGTCAAGGTCATCAACTTCGTCACCTACGAAAGCGCCGAG
TTCTTCCCCGGTCCCAACTTGAACATGGTCATCGGCCCCAACGGCACGGGCAAGAGTTCGCTGGTCTGTGCCATC
TGCCTCGGTCTGGGTTACAGCCCTAAACTCCTCGGCCGCGCTGGATCCGTCAAGGAGTTTGTCAAGCACGGAAAG
GACACGGCTACAATAGAGATCGAGCTGCAGAAGCGACCATCCGATCGGACCAACTTTGTCGTGTCCAACCAGATC
CGCCGCGAGCAGAATAGCCAGAAATGGTGGCTCAACGGCAAAGAAACGACCCACAAGACCGTCTTGAGCCTCATG
AAGTCGCTCAAGATTCAAGTTGACAACCTCTGCCAGTTTCTGCCCCAGGACAGGGTCGTCGAGTTCGCCGCCTGC
ACCCCCGTCGATCTTCTTCGCGAGACGCTACGTGCCGCCGCTCCTGAGGAGATGCTTCTGTGGCAGTCGGAGCTG
CGGGAACTCCACGGCAAGAAAAAAGATATGGGAAAGGCTGTCCTCGACGACGTCGAAGACCTCAAGAACCTCGAG
TCTCGCCAGCAGGGTTTACAAGCCGACGTGGATAGAATCCGCGAACGCGAGGAGATCCAGGCGAGGGTCACCCAT
CTTCAGTCCGCCTTGGTGCTTGCCCAGTACCAAGAGGTTCGCGCCAAGTACCAAGAGGCTCGTGAGCGCAAGAAG
GATGCCGAGGCGGCCCTCAGATGGCTCCAACAGGAATGCGAGCCGTCACTGCAAGCCGTCAACCGAAAAATGGAG
TACACGAGCCAAATAGAAGCCGCCGTCAGCGGCATCGACGAGGACCTCAAACAAGCCGGCAAAGAGGCGATCAAC
ATGTTGCGCGACGCGAATCAAGCGGCCGAGACAATCAACGAGATGAAGAACCAGCTCGACGCCGAACGCAAGGGC
TTCGACACCAAGAGGAAGGAGTTGGCTGCGTCCAAGTCCAAGATTACGGCGTACCAAGCGGACCTCAAGAACCAG
CCGCCAGAATTCAACGCTGCCGACTGGAATCAGAAGATTGTGAGCTAGCCGTCCTCGCCTTTTCCGTCATGTTAC
TTACTGACTATGCTACCTAGCGTGCCCAAGAACACATCATGCGCGAGCTGGACACGGAGCAGGAACAAGTGATGG
CCGACCTGGACTCTGTTAAGACCAAGGGCTCAGCCGTCGTCCAAAGAATCAAGAACCTCGAACACGAGCTCCGAG
ATCTCGATACGCAGCAGGGCCAGCAAATGATTTTGTTGAAAAAGTATTTCCCGGAAGCTTACGACGTCTTGAAAT
GGCTCAATGAACATCAGCACGAATTCGAAAAGGAGGTCTTTGGGCCGCCCATGATCAGCTGCTCCATCAAAGACG
AGCGCTTTTCGAACCTAGTGCAGACCTTTATGCAGAGAGATGATTTCGTCTGCTTCACGCCCCAGACGAAAAATG
ATCATAAGAAGCTATCTCATTCGGTCTTCTCACTGCTGAGTACCGTCGCCACCATTCGGACAGTCGAACAACCCC
TCGAATCCTTCAAAAGACCGTTGAGCCCAGAGCAAGCGGCGAGTTATGGTTTTGATGGGTTTGTACTCGATTACA
TCGACGGACCCGCGCCGGTCCTCGCCATGCTTTGCAGCAACAAGGGATTCCACCAGACTGCCCTCTCACTCAGAG
CACACAACGACTCTGACTACGAGCGCATCGCCAGGTCTGGTGTGGTCACGCAGTGGGCCGCAGGCGAGGAGTCGT
TCCAAATCCGCGGCTGCAGAGACTACGGCTCCGACGTGAAGCTCACGACTGCCAGAGCCGTTACGCCGGGCATGT
TTTGGACGTCACAGCCCGTCGATAGCCAAGAGAAGACTGAGCTCAGCCGGCTTCTGCGGGAGAAGAATGGGGAGA
AGGACTTGTTGAGGAATGAGCTCAACCAGCTGAAGGAGAAGAAGTCTAGCTTTGATGAGCGTCGGGATGAGACGT
ACAAGAAGATGGTAAGACGTCGGATCCCGAAGATGCGCCGAGACTCTTGCTCACAGACTCCTAGGAATCTCTGAG
AAAGGAAAAGAGCTCATTGCAAAAGGACTACCAGAAATGGCGGTCCCTTCCGGAGAAGATAGGTGAGACGAATCG
TGTCAACGATCGGGACGAAGCTCAGGCTAACGTTGAACAGAATCCGAGGAACGCAATAAGACCGCCAAGGAGACG
GCGTTGCGTGACACGAGGAAGAGCATGGCCGACCTCGGGTACGAATGGGACGAGGCGACGACGAAGCGAGCCCGG
CTCGTAATCCAGCACAATCAGCTCCTCGACAAGATGCGAAGCGCCCACCACGCCTCTCTAGAGAGCCAGATCCGA
CTCATCGAGGCCCGCTCCGACGTAAAGGGTCTCAAGCTCGCCAATGCCAGCCTGATGGAGCGTCTGGACGCAGAA
AAGGACAAGGTCGCGACGGCAGCGGCCGAGGTAGCAGTCAAGAGGCAAGAAGGCCACGTGCTACAAGAAAAAGTC
CGCGATGTCATGGACCAAGACGAGGCCACAAGGGAGCTCCTCACGCAGTTGGCAGAGGGCAAGACGCCACAAGAG
CTCGAAATGGACATGTCAGCCGAGGAGGCCAAGCTGGAGGTTATGCACGCCGCCAACCCCAACATCATGCGCGAG
TTTGAGCGCCGCGCCAAGGAGATTGACAGGCTCAAGGCCAAGATGGACGAGGCCAATCAGGCTCTCTCCGGTCTG
GACGGCCAGCTCGAGGGCTTGATGGCCAAGTGGGAGCCCAAGCTGGACGAGCTGGTCTCGAGCATCAACGACGCC
TTTGCCTATAACTTTGAGCAGATCAGCTGCGCAGGCGAAGTCCACGTCCACAAAGACGACGACTTTGACAAATGG
GCTCTCAACATCAAGGTCCGCTTCCGGTAAGCAAACCCCCCCCCCTACCCATCGCCATCCCCTTCAATCCCCCAG
CTAACCCACACCCCCCCCCCAAGCCCAAACGAAACCCTCCAACAACTCACCGCCCACCGCCAATCAGGCGGCGAA
CGCGCCGTCTCAACAATCTTCTTCCTAATGGCCCTCCAATCCATGGCCCAATCCCCCTTCCGCGTCGTCGACGAA
ATCAACCAAGGCATGGACCCGCGCAACGAACGCATGGTGCACGAACGCATGGTGGAAATCGCCTGCCGCGAACAC
ACCAGCCAGTATTTCCTCATCACCCCCAAGCTGCTCACCGGCTTGCGGTACGATGCCAAGATGCGCGTCTTGTGC
ATTGCCAGCGGCGAGCATATGCCTAGCGATGGGCTCAAGTTGGACTTTGGGCGGTGCTTGGCTAGGCAGAGGGCT
TTGATGGGCGTTTCTTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail