Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|1724
Gene name
LocationContig_175:9751..14483
Strand+
Gene length (bp)4732
Transcript length (bp)4488
Coding sequence length (bp)4488
Protein length (aa) 1496

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13854 Kelch_5 Kelch motif 4.3E-08 282 318
PF13964 Kelch_6 Kelch motif 3.1E-12 285 326
PF13418 Kelch_4 Galactose oxidase, central domain 5.4E-05 227 277
PF13418 Kelch_4 Galactose oxidase, central domain 4.0E-07 285 326
PF13418 Kelch_4 Galactose oxidase, central domain 1.1E-04 335 385
PF13415 Kelch_3 Galactose oxidase, central domain 1.4E-08 295 342
PF13415 Kelch_3 Galactose oxidase, central domain 5.0E-05 346 394
PF01344 Kelch_1 Kelch motif 5.5E-05 228 273
PF01344 Kelch_1 Kelch motif 9.9E-11 285 326
PF07646 Kelch_2 Kelch motif 4.2E-07 285 330

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P87061|TEA1_SCHPO Tip elongation aberrant protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tea1 PE=1 SV=1 87 1115 1.0E-87
sp|P38853|KEL1_YEAST Kelch repeat-containing protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KEL1 PE=1 SV=1 102 428 9.0E-66
sp|P50090|KEL2_YEAST Kelch repeat-containing protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KEL2 PE=1 SV=1 92 427 2.0E-63
sp|O14248|TEA3_SCHPO Tip elongation aberrant protein 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tea3 PE=1 SV=1 131 402 5.0E-36
sp|Q93XW5|NSP5_ARATH Nitrile-specifier protein 5 OS=Arabidopsis thaliana GN=NSP5 PE=2 SV=1 170 440 2.0E-27
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P87061|TEA1_SCHPO Tip elongation aberrant protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tea1 PE=1 SV=1 87 1115 1.0E-87
sp|P38853|KEL1_YEAST Kelch repeat-containing protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KEL1 PE=1 SV=1 102 428 9.0E-66
sp|P50090|KEL2_YEAST Kelch repeat-containing protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KEL2 PE=1 SV=1 92 427 2.0E-63
sp|O14248|TEA3_SCHPO Tip elongation aberrant protein 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tea3 PE=1 SV=1 131 402 5.0E-36
sp|Q93XW5|NSP5_ARATH Nitrile-specifier protein 5 OS=Arabidopsis thaliana GN=NSP5 PE=2 SV=1 170 440 2.0E-27
sp|O49326|JAL21_ARATH Nitrile-specifier protein 2 OS=Arabidopsis thaliana GN=NSP2 PE=2 SV=1 168 429 4.0E-23
sp|Q9BQ90|KLDC3_HUMAN Kelch domain-containing protein 3 OS=Homo sapiens GN=KLHDC3 PE=2 SV=1 171 363 5.0E-22
sp|Q9V4C8|HCF_DROME Host cell factor OS=Drosophila melanogaster GN=Hcf PE=1 SV=2 164 463 1.0E-21
sp|Q58CV6|KLDC3_BOVIN Kelch domain-containing protein 3 OS=Bos taurus GN=KLHDC3 PE=2 SV=2 163 415 2.0E-21
sp|Q9MA55|ACBP4_ARATH Acyl-CoA-binding domain-containing protein 4 OS=Arabidopsis thaliana GN=ACBP4 PE=1 SV=1 196 435 2.0E-21
sp|Q7M3S9|RNGB_DICDI RING finger protein B OS=Dictyostelium discoideum GN=rngB PE=2 SV=2 171 429 2.0E-21
sp|Q6AYI2|KLDC3_RAT Kelch domain-containing protein 3 OS=Rattus norvegicus GN=Klhdc3 PE=2 SV=1 171 415 2.0E-21
sp|Q8VEM9|KLDC3_MOUSE Kelch domain-containing protein 3 OS=Mus musculus GN=Klhdc3 PE=2 SV=1 171 415 2.0E-21
sp|Q9BQ90|KLDC3_HUMAN Kelch domain-containing protein 3 OS=Homo sapiens GN=KLHDC3 PE=2 SV=1 163 415 2.0E-20
sp|Q9SDM9|JAL28_ARATH Nitrile-specifier protein 1 OS=Arabidopsis thaliana GN=NSP1 PE=2 SV=2 168 405 2.0E-20
sp|Q5EA50|RABEK_BOVIN Rab9 effector protein with kelch motifs OS=Bos taurus GN=RABEPK PE=2 SV=1 115 395 5.0E-20
sp|Q8N7A1|KLDC1_HUMAN Kelch domain-containing protein 1 OS=Homo sapiens GN=KLHDC1 PE=2 SV=2 174 415 6.0E-20
sp|Q6AYI2|KLDC3_RAT Kelch domain-containing protein 3 OS=Rattus norvegicus GN=Klhdc3 PE=2 SV=1 215 404 1.0E-19
sp|Q8VEM9|KLDC3_MOUSE Kelch domain-containing protein 3 OS=Mus musculus GN=Klhdc3 PE=2 SV=1 215 404 1.0E-19
sp|O04318|JAL27_ARATH Nitrile-specifier protein 3 OS=Arabidopsis thaliana GN=NSP3 PE=2 SV=1 160 429 2.0E-19
sp|Q9BQ90|KLDC3_HUMAN Kelch domain-containing protein 3 OS=Homo sapiens GN=KLHDC3 PE=2 SV=1 215 404 3.0E-19
sp|Q58CV6|KLDC3_BOVIN Kelch domain-containing protein 3 OS=Bos taurus GN=KLHDC3 PE=2 SV=2 215 404 3.0E-19
sp|Q80YG3|KLDC1_MOUSE Kelch domain-containing protein 1 OS=Mus musculus GN=Klhdc1 PE=2 SV=1 174 395 2.0E-18
sp|Q8H4D4|TYW23_ORYSJ tRNA wybutosine-synthesizing protein 2/3/4 OS=Oryza sativa subsp. japonica GN=Os07g0515000 PE=2 SV=1 171 410 2.0E-18
sp|Q8RY71|ESP_ARATH Epithiospecifier protein OS=Arabidopsis thaliana GN=ESP PE=1 SV=2 170 405 3.0E-18
sp|P80197|AFK_PHYPO Actin-fragmin kinase OS=Physarum polycephalum PE=1 SV=2 215 389 3.0E-18
sp|Q54C94|GEFF_DICDI Ras guanine nucleotide exchange factor F OS=Dictyostelium discoideum GN=gefF PE=2 SV=1 134 404 9.0E-18
sp|Q5EA50|RABEK_BOVIN Rab9 effector protein with kelch motifs OS=Bos taurus GN=RABEPK PE=2 SV=1 162 413 1.0E-17
sp|O14248|TEA3_SCHPO Tip elongation aberrant protein 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tea3 PE=1 SV=1 227 404 2.0E-17
sp|P80197|AFK_PHYPO Actin-fragmin kinase OS=Physarum polycephalum PE=1 SV=2 169 351 2.0E-17
sp|Q54C94|GEFF_DICDI Ras guanine nucleotide exchange factor F OS=Dictyostelium discoideum GN=gefF PE=2 SV=1 230 405 3.0E-17
sp|Q7Z6M1|RABEK_HUMAN Rab9 effector protein with kelch motifs OS=Homo sapiens GN=RABEPK PE=1 SV=1 115 405 3.0E-17
sp|Q8RWD9|ACBP5_ARATH Acyl-CoA-binding domain-containing protein 5 OS=Arabidopsis thaliana GN=ACBP5 PE=1 SV=1 193 435 6.0E-17
sp|Q5U3Y0|KLD10_RAT Kelch domain-containing protein 10 OS=Rattus norvegicus GN=Klhdc10 PE=2 SV=1 169 384 6.0E-17
sp|Q0IIC2|KLD10_BOVIN Kelch domain-containing protein 10 OS=Bos taurus GN=KLHDC10 PE=2 SV=1 169 384 6.0E-17
sp|Q6PID8|KLD10_HUMAN Kelch domain-containing protein 10 OS=Homo sapiens GN=KLHDC10 PE=1 SV=1 169 384 7.0E-17
sp|Q6PAR0|KLD10_MOUSE Kelch domain-containing protein 10 OS=Mus musculus GN=Klhdc10 PE=1 SV=1 169 384 8.0E-17
sp|Q4V8F4|RABEK_RAT Rab9 effector protein with kelch motifs OS=Rattus norvegicus GN=Rabepk PE=2 SV=1 108 416 1.0E-16
sp|Q55A09|Y9963_DICDI Probable serine/threonine-protein kinase DDB_G0272254 OS=Dictyostelium discoideum GN=DDB_G0272254 PE=3 SV=1 173 405 1.0E-16
sp|O04316|JAL29_ARATH Nitrile-specifier protein 4 OS=Arabidopsis thaliana GN=NSP4 PE=2 SV=1 168 405 1.0E-16
sp|Q6AYI2|KLDC3_RAT Kelch domain-containing protein 3 OS=Rattus norvegicus GN=Klhdc3 PE=2 SV=1 169 416 2.0E-16
sp|Q8VEM9|KLDC3_MOUSE Kelch domain-containing protein 3 OS=Mus musculus GN=Klhdc3 PE=2 SV=1 169 416 2.0E-16
sp|Q9CQ33|LZTR1_MOUSE Leucine-zipper-like transcriptional regulator 1 OS=Mus musculus GN=Lztr1 PE=1 SV=2 174 471 2.0E-16
sp|Q58CV6|KLDC3_BOVIN Kelch domain-containing protein 3 OS=Bos taurus GN=KLHDC3 PE=2 SV=2 169 356 3.0E-16
sp|Q8N653|LZTR1_HUMAN Leucine-zipper-like transcriptional regulator 1 OS=Homo sapiens GN=LZTR1 PE=1 SV=2 174 404 3.0E-16
sp|Q8VCH5|RABEK_MOUSE Rab9 effector protein with kelch motifs OS=Mus musculus GN=Rabepk PE=1 SV=2 108 413 3.0E-16
sp|Q8W4K1|TYW23_ARATH tRNA wybutosine-synthesizing protein 2/3/4 OS=Arabidopsis thaliana GN=At4g04670 PE=2 SV=1 164 410 5.0E-16
sp|Q7Z6M1|RABEK_HUMAN Rab9 effector protein with kelch motifs OS=Homo sapiens GN=RABEPK PE=1 SV=1 162 410 7.0E-16
sp|Q5R4Q7|LZTR1_PONAB Leucine-zipper-like transcriptional regulator 1 OS=Pongo abelii GN=LZTR1 PE=2 SV=1 174 404 7.0E-16
sp|Q39610|DYHA_CHLRE Dynein alpha chain, flagellar outer arm OS=Chlamydomonas reinhardtii GN=ODA11 PE=3 SV=2 215 437 2.0E-15
sp|Q61191|HCFC1_MOUSE Host cell factor 1 OS=Mus musculus GN=Hcfc1 PE=1 SV=2 183 404 2.0E-15
sp|P51610|HCFC1_HUMAN Host cell factor 1 OS=Homo sapiens GN=HCFC1 PE=1 SV=2 183 353 2.0E-15
sp|P51611|HCFC1_MESAU Host cell factor 1 OS=Mesocricetus auratus GN=HCFC1 PE=1 SV=1 183 404 2.0E-15
sp|Q8H4D4|TYW23_ORYSJ tRNA wybutosine-synthesizing protein 2/3/4 OS=Oryza sativa subsp. japonica GN=Os07g0515000 PE=2 SV=1 283 429 7.0E-15
sp|Q9Y5Z7|HCFC2_HUMAN Host cell factor 2 OS=Homo sapiens GN=HCFC2 PE=1 SV=1 170 460 7.0E-15
sp|Q8H4D4|TYW23_ORYSJ tRNA wybutosine-synthesizing protein 2/3/4 OS=Oryza sativa subsp. japonica GN=Os07g0515000 PE=2 SV=1 87 353 8.0E-15
sp|Q5ZJ37|RABEK_CHICK Rab9 effector protein with kelch motifs OS=Gallus gallus GN=RABEPK PE=2 SV=1 116 410 1.0E-14
sp|Q5RDA9|FBX42_PONAB F-box only protein 42 OS=Pongo abelii GN=FBXO42 PE=2 SV=1 228 404 1.0E-14
sp|Q6P3S6|FBX42_HUMAN F-box only protein 42 OS=Homo sapiens GN=FBXO42 PE=1 SV=1 228 404 2.0E-14
sp|Q9BQ90|KLDC3_HUMAN Kelch domain-containing protein 3 OS=Homo sapiens GN=KLHDC3 PE=2 SV=1 169 356 3.0E-14
sp|Q9V4C8|HCF_DROME Host cell factor OS=Drosophila melanogaster GN=Hcf PE=1 SV=2 102 317 4.0E-14
sp|Q93XW5|NSP5_ARATH Nitrile-specifier protein 5 OS=Arabidopsis thaliana GN=NSP5 PE=2 SV=1 101 370 7.0E-14
sp|Q4G5Y1|KLDC2_MOUSE Kelch domain-containing protein 2 OS=Mus musculus GN=Klhdc2 PE=2 SV=3 184 353 7.0E-14
sp|Q3KRE6|KLDC2_RAT Kelch domain-containing protein 2 OS=Rattus norvegicus GN=Klhdc2 PE=2 SV=1 184 353 8.0E-14
sp|Q5RKG2|HCFC2_RAT Host cell factor 2 OS=Rattus norvegicus GN=Hcfc2 PE=2 SV=1 170 434 1.0E-13
sp|Q9Y2U9|KLDC2_HUMAN Kelch domain-containing protein 2 OS=Homo sapiens GN=KLHDC2 PE=1 SV=1 184 353 2.0E-13
sp|A8JAM0|DRC7_CHLRE Dynein regulatory complex subunit 7 (Fragment) OS=Chlamydomonas reinhardtii GN=DRC7 PE=1 SV=1 166 413 2.0E-13
sp|Q9BQ90|KLDC3_HUMAN Kelch domain-containing protein 3 OS=Homo sapiens GN=KLHDC3 PE=2 SV=1 269 429 4.0E-13
sp|Q6AXB2|RABEK_XENLA Rab9 effector protein with kelch motifs OS=Xenopus laevis GN=rabepk PE=2 SV=1 171 344 4.0E-13
sp|Q86L99|GACHH_DICDI Rho GTPase-activating protein gacHH OS=Dictyostelium discoideum GN=gacHH PE=3 SV=1 283 429 5.0E-13
sp|Q6AYI2|KLDC3_RAT Kelch domain-containing protein 3 OS=Rattus norvegicus GN=Klhdc3 PE=2 SV=1 269 429 6.0E-13
sp|Q8VEM9|KLDC3_MOUSE Kelch domain-containing protein 3 OS=Mus musculus GN=Klhdc3 PE=2 SV=1 269 429 6.0E-13
sp|Q58CV6|KLDC3_BOVIN Kelch domain-containing protein 3 OS=Bos taurus GN=KLHDC3 PE=2 SV=2 269 429 7.0E-13
sp|Q8N653|LZTR1_HUMAN Leucine-zipper-like transcriptional regulator 1 OS=Homo sapiens GN=LZTR1 PE=1 SV=2 268 404 8.0E-13
sp|Q9CQ33|LZTR1_MOUSE Leucine-zipper-like transcriptional regulator 1 OS=Mus musculus GN=Lztr1 PE=1 SV=2 268 478 9.0E-13
sp|Q6PDJ6|FBX42_MOUSE F-box only protein 42 OS=Mus musculus GN=Fbxo42 PE=1 SV=1 228 404 9.0E-13
sp|Q80YG3|KLDC1_MOUSE Kelch domain-containing protein 1 OS=Mus musculus GN=Klhdc1 PE=2 SV=1 205 356 1.0E-12
sp|Q6GQN7|RABEK_DANRE Rab9 effector protein with kelch motifs OS=Danio rerio GN=rabepk PE=2 SV=1 167 363 1.0E-12
sp|Q5R4Q7|LZTR1_PONAB Leucine-zipper-like transcriptional regulator 1 OS=Pongo abelii GN=LZTR1 PE=2 SV=1 268 478 2.0E-12
sp|Q9SDM9|JAL28_ARATH Nitrile-specifier protein 1 OS=Arabidopsis thaliana GN=NSP1 PE=2 SV=2 183 403 3.0E-12
sp|Q28DE7|KLD10_XENTR Kelch domain-containing protein 10 OS=Xenopus tropicalis GN=klhdc10 PE=2 SV=2 149 385 3.0E-12
sp|Q9C8K7|FBK21_ARATH F-box/kelch-repeat protein At1g51550 OS=Arabidopsis thaliana GN=At1g51550 PE=2 SV=1 171 407 3.0E-12
sp|Q5E9A7|KLDC2_BOVIN Kelch domain-containing protein 2 OS=Bos taurus GN=KLHDC2 PE=2 SV=1 184 353 3.0E-12
sp|Q9CQ33|LZTR1_MOUSE Leucine-zipper-like transcriptional regulator 1 OS=Mus musculus GN=Lztr1 PE=1 SV=2 134 353 4.0E-12
sp|Q8N653|LZTR1_HUMAN Leucine-zipper-like transcriptional regulator 1 OS=Homo sapiens GN=LZTR1 PE=1 SV=2 134 353 4.0E-12
sp|A8JAM0|DRC7_CHLRE Dynein regulatory complex subunit 7 (Fragment) OS=Chlamydomonas reinhardtii GN=DRC7 PE=1 SV=1 134 370 4.0E-12
sp|Q5R8W1|KLDC4_PONAB Kelch domain-containing protein 4 OS=Pongo abelii GN=KLHDC4 PE=2 SV=1 167 429 5.0E-12
sp|Q8TBB5|KLDC4_HUMAN Kelch domain-containing protein 4 OS=Homo sapiens GN=KLHDC4 PE=1 SV=1 167 429 5.0E-12
sp|Q5R4Q7|LZTR1_PONAB Leucine-zipper-like transcriptional regulator 1 OS=Pongo abelii GN=LZTR1 PE=2 SV=1 134 353 6.0E-12
sp|Q9LR78|BSU1_ARATH Serine/threonine-protein phosphatase BSU1 OS=Arabidopsis thaliana GN=BSU1 PE=1 SV=2 166 437 7.0E-12
sp|Q5U580|KLD10_XENLA Kelch domain-containing protein 10 OS=Xenopus laevis GN=klhdc10 PE=2 SV=1 149 385 8.0E-12
sp|O04318|JAL27_ARATH Nitrile-specifier protein 3 OS=Arabidopsis thaliana GN=NSP3 PE=2 SV=1 183 400 2.0E-11
sp|Q2QM47|BSL2_ORYSJ Serine/threonine-protein phosphatase BSL2 homolog OS=Oryza sativa subsp. japonica GN=BSL2 PE=2 SV=2 169 424 2.0E-11
sp|Q9C9W9|ADO3_ARATH Adagio protein 3 OS=Arabidopsis thaliana GN=ADO3 PE=1 SV=1 94 373 2.0E-11
sp|Q5RDA9|FBX42_PONAB F-box only protein 42 OS=Pongo abelii GN=FBXO42 PE=2 SV=1 185 410 3.0E-11
sp|Q6P3S6|FBX42_HUMAN F-box only protein 42 OS=Homo sapiens GN=FBXO42 PE=1 SV=1 185 410 3.0E-11
sp|Q921I2|KLDC4_MOUSE Kelch domain-containing protein 4 OS=Mus musculus GN=Klhdc4 PE=2 SV=2 116 382 3.0E-11
sp|Q8W4K1|TYW23_ARATH tRNA wybutosine-synthesizing protein 2/3/4 OS=Arabidopsis thaliana GN=At4g04670 PE=2 SV=1 207 406 6.0E-11
sp|Q8RY71|ESP_ARATH Epithiospecifier protein OS=Arabidopsis thaliana GN=ESP PE=1 SV=2 221 451 7.0E-11
sp|Q9C8K7|FBK21_ARATH F-box/kelch-repeat protein At1g51550 OS=Arabidopsis thaliana GN=At1g51550 PE=2 SV=1 225 419 7.0E-11
sp|Q25386|SCRB_LIMPO Beta-scruin OS=Limulus polyphemus PE=2 SV=1 185 404 8.0E-11
sp|O49326|JAL21_ARATH Nitrile-specifier protein 2 OS=Arabidopsis thaliana GN=NSP2 PE=2 SV=1 180 403 1.0E-10
sp|O04316|JAL29_ARATH Nitrile-specifier protein 4 OS=Arabidopsis thaliana GN=NSP4 PE=2 SV=1 183 403 1.0E-10
sp|A6NCF5|KLH33_HUMAN Kelch-like protein 33 OS=Homo sapiens GN=KLHL33 PE=4 SV=2 219 404 1.0E-10
sp|Q86L99|GACHH_DICDI Rho GTPase-activating protein gacHH OS=Dictyostelium discoideum GN=gacHH PE=3 SV=1 171 307 2.0E-10
sp|Q6A051|ATRN1_MOUSE Attractin-like protein 1 OS=Mus musculus GN=Atrnl1 PE=1 SV=2 162 416 2.0E-10
sp|Q4G5Y1|KLDC2_MOUSE Kelch domain-containing protein 2 OS=Mus musculus GN=Klhdc2 PE=2 SV=3 171 395 3.0E-10
sp|Q9Y2U9|KLDC2_HUMAN Kelch domain-containing protein 2 OS=Homo sapiens GN=KLHDC2 PE=1 SV=1 171 395 3.0E-10
sp|Q86L99|GACHH_DICDI Rho GTPase-activating protein gacHH OS=Dictyostelium discoideum GN=gacHH PE=3 SV=1 229 374 3.0E-10
sp|Q5E9A7|KLDC2_BOVIN Kelch domain-containing protein 2 OS=Bos taurus GN=KLHDC2 PE=2 SV=1 167 395 3.0E-10
sp|Q3KRE6|KLDC2_RAT Kelch domain-containing protein 2 OS=Rattus norvegicus GN=Klhdc2 PE=2 SV=1 171 395 4.0E-10
sp|Q5VV63|ATRN1_HUMAN Attractin-like protein 1 OS=Homo sapiens GN=ATRNL1 PE=2 SV=2 162 416 4.0E-10
sp|Q6AXB2|RABEK_XENLA Rab9 effector protein with kelch motifs OS=Xenopus laevis GN=rabepk PE=2 SV=1 162 411 6.0E-10
sp|Q96M94|KLH15_HUMAN Kelch-like protein 15 OS=Homo sapiens GN=KLHL15 PE=1 SV=2 168 374 6.0E-10
sp|Q9SJF0|BSL2_ARATH Serine/threonine-protein phosphatase BSL2 OS=Arabidopsis thaliana GN=BSL2 PE=1 SV=2 283 404 8.0E-10
sp|Q5ZJ37|RABEK_CHICK Rab9 effector protein with kelch motifs OS=Gallus gallus GN=RABEPK PE=2 SV=1 215 429 1.0E-09
sp|Q6GQN7|RABEK_DANRE Rab9 effector protein with kelch motifs OS=Danio rerio GN=rabepk PE=2 SV=1 162 448 1.0E-09
sp|Q6DEL7|KLH15_DANRE Kelch-like protein 15 OS=Danio rerio GN=klhl15 PE=2 SV=1 168 374 1.0E-09
sp|Q80TF4|KLH13_MOUSE Kelch-like protein 13 OS=Mus musculus GN=Klhl13 PE=2 SV=3 200 416 1.0E-09
sp|Q9V4C8|HCF_DROME Host cell factor OS=Drosophila melanogaster GN=Hcf PE=1 SV=2 121 354 2.0E-09
sp|Q8N7A1|KLDC1_HUMAN Kelch domain-containing protein 1 OS=Homo sapiens GN=KLHDC1 PE=2 SV=2 171 357 2.0E-09
sp|Q39610|DYHA_CHLRE Dynein alpha chain, flagellar outer arm OS=Chlamydomonas reinhardtii GN=ODA11 PE=3 SV=2 169 354 2.0E-09
sp|A6QQY2|KLH13_BOVIN Kelch-like protein 13 OS=Bos taurus GN=KLHL13 PE=2 SV=1 223 416 2.0E-09
sp|Q9P2N7|KLH13_HUMAN Kelch-like protein 13 OS=Homo sapiens GN=KLHL13 PE=1 SV=3 223 416 2.0E-09
sp|Q6GQN7|RABEK_DANRE Rab9 effector protein with kelch motifs OS=Danio rerio GN=rabepk PE=2 SV=1 213 392 3.0E-09
sp|Q28DE7|KLD10_XENTR Kelch domain-containing protein 10 OS=Xenopus tropicalis GN=klhdc10 PE=2 SV=2 225 416 3.0E-09
sp|Q9SHS7|BSL3_ARATH Serine/threonine-protein phosphatase BSL3 OS=Arabidopsis thaliana GN=BSL3 PE=1 SV=2 283 404 3.0E-09
sp|Q8W420|ADO2_ARATH Adagio protein 2 OS=Arabidopsis thaliana GN=ADO2 PE=1 SV=1 174 405 3.0E-09
sp|Q5U580|KLD10_XENLA Kelch domain-containing protein 10 OS=Xenopus laevis GN=klhdc10 PE=2 SV=1 225 416 4.0E-09
sp|Q60EX6|BSL1_ORYSJ Serine/threonine-protein phosphatase BSL1 homolog OS=Oryza sativa subsp. japonica GN=BSL1 PE=2 SV=1 169 424 4.0E-09
sp|Q86L99|GACHH_DICDI Rho GTPase-activating protein gacHH OS=Dictyostelium discoideum GN=gacHH PE=3 SV=1 320 419 5.0E-09
sp|Q8N653|LZTR1_HUMAN Leucine-zipper-like transcriptional regulator 1 OS=Homo sapiens GN=LZTR1 PE=1 SV=2 149 371 7.0E-09
sp|Q9MA55|ACBP4_ARATH Acyl-CoA-binding domain-containing protein 4 OS=Arabidopsis thaliana GN=ACBP4 PE=1 SV=1 164 353 1.0E-08
sp|Q55A09|Y9963_DICDI Probable serine/threonine-protein kinase DDB_G0272254 OS=Dictyostelium discoideum GN=DDB_G0272254 PE=3 SV=1 214 405 1.0E-08
sp|Q6AXB2|RABEK_XENLA Rab9 effector protein with kelch motifs OS=Xenopus laevis GN=rabepk PE=2 SV=1 168 395 1.0E-08
sp|Q86L99|GACHH_DICDI Rho GTPase-activating protein gacHH OS=Dictyostelium discoideum GN=gacHH PE=3 SV=1 103 245 1.0E-08
sp|A6NCF5|KLH33_HUMAN Kelch-like protein 33 OS=Homo sapiens GN=KLHL33 PE=4 SV=2 174 404 1.0E-08
sp|Q5ZLD3|KLH13_CHICK Kelch-like protein 13 OS=Gallus gallus GN=KLHL13 PE=2 SV=1 223 416 1.0E-08
sp|Q2T9Z7|KLHL9_BOVIN Kelch-like protein 9 OS=Bos taurus GN=KLHL9 PE=2 SV=1 223 416 2.0E-08
sp|Q9P2J3|KLHL9_HUMAN Kelch-like protein 9 OS=Homo sapiens GN=KLHL9 PE=1 SV=2 223 416 4.0E-08
sp|Q99JN2|KLH22_MOUSE Kelch-like protein 22 OS=Mus musculus GN=Klhl22 PE=1 SV=1 232 404 5.0E-08
sp|D3ZZC3|KLH22_RAT Kelch-like protein 22 OS=Rattus norvegicus GN=Klhl22 PE=1 SV=1 232 404 5.0E-08
sp|Q6ZPT1|KLHL9_MOUSE Kelch-like protein 9 OS=Mus musculus GN=Klhl9 PE=2 SV=2 223 416 5.0E-08
sp|Q67UX0|ADO2_ORYSJ Putative adagio-like protein 2 OS=Oryza sativa subsp. japonica GN=Os02g0150800 PE=3 SV=1 174 426 5.0E-08
sp|Q94BT6|ADO1_ARATH Adagio protein 1 OS=Arabidopsis thaliana GN=ADO1 PE=1 SV=2 171 371 5.0E-08
sp|Q9CQ33|LZTR1_MOUSE Leucine-zipper-like transcriptional regulator 1 OS=Mus musculus GN=Lztr1 PE=1 SV=2 149 371 6.0E-08
sp|Q0IIC2|KLD10_BOVIN Kelch domain-containing protein 10 OS=Bos taurus GN=KLHDC10 PE=2 SV=1 225 416 8.0E-08
sp|Q6PID8|KLD10_HUMAN Kelch domain-containing protein 10 OS=Homo sapiens GN=KLHDC10 PE=1 SV=1 225 416 9.0E-08
sp|Q921I2|KLDC4_MOUSE Kelch domain-containing protein 4 OS=Mus musculus GN=Klhdc4 PE=2 SV=2 283 424 9.0E-08
sp|Q5U3Y0|KLD10_RAT Kelch domain-containing protein 10 OS=Rattus norvegicus GN=Klhdc10 PE=2 SV=1 219 416 1.0E-07
sp|Q9H0H3|KLH25_HUMAN Kelch-like protein 25 OS=Homo sapiens GN=KLHL25 PE=1 SV=1 168 371 1.0E-07
sp|Q8L7U5|BSL1_ARATH Serine/threonine-protein phosphatase BSL1 OS=Arabidopsis thaliana GN=BSL1 PE=1 SV=2 169 404 1.0E-07
sp|Q5Z8K3|ADO1_ORYSJ Adagio-like protein 1 OS=Oryza sativa subsp. japonica GN=Os06g0694000 PE=2 SV=1 171 357 1.0E-07
sp|Q8RWD9|ACBP5_ARATH Acyl-CoA-binding domain-containing protein 5 OS=Arabidopsis thaliana GN=ACBP5 PE=1 SV=1 164 353 2.0E-07
sp|Q86L99|GACHH_DICDI Rho GTPase-activating protein gacHH OS=Dictyostelium discoideum GN=gacHH PE=3 SV=1 176 325 2.0E-07
sp|Q2R2W1|ADO3_ORYSJ Adagio-like protein 3 OS=Oryza sativa subsp. japonica GN=Os11g0547000 PE=2 SV=2 174 423 2.0E-07
sp|Q9Y2U9|KLDC2_HUMAN Kelch domain-containing protein 2 OS=Homo sapiens GN=KLHDC2 PE=1 SV=1 139 404 4.0E-07
sp|P60882|MEGF8_MOUSE Multiple epidermal growth factor-like domains protein 8 OS=Mus musculus GN=Megf8 PE=1 SV=2 102 369 4.0E-07
sp|Q8R2P1|KLH25_MOUSE Kelch-like protein 25 OS=Mus musculus GN=Klhl25 PE=2 SV=1 168 371 4.0E-07
sp|Q5R4Q7|LZTR1_PONAB Leucine-zipper-like transcriptional regulator 1 OS=Pongo abelii GN=LZTR1 PE=2 SV=1 187 371 5.0E-07
sp|A8JAM0|DRC7_CHLRE Dynein regulatory complex subunit 7 (Fragment) OS=Chlamydomonas reinhardtii GN=DRC7 PE=1 SV=1 286 419 5.0E-07
sp|Q4KLM4|KLH25_RAT Kelch-like protein 25 OS=Rattus norvegicus GN=Klhl25 PE=2 SV=1 168 371 5.0E-07
sp|Q6PDJ6|FBX42_MOUSE F-box only protein 42 OS=Mus musculus GN=Fbxo42 PE=1 SV=1 100 323 6.0E-07
sp|Q921I2|KLDC4_MOUSE Kelch domain-containing protein 4 OS=Mus musculus GN=Klhdc4 PE=2 SV=2 223 404 6.0E-07
sp|Q6PAR0|KLD10_MOUSE Kelch domain-containing protein 10 OS=Mus musculus GN=Klhdc10 PE=1 SV=1 225 416 7.0E-07
sp|Q4G5Y1|KLDC2_MOUSE Kelch domain-containing protein 2 OS=Mus musculus GN=Klhdc2 PE=2 SV=3 166 303 9.0E-07
sp|O75882|ATRN_HUMAN Attractin OS=Homo sapiens GN=ATRN PE=1 SV=2 163 413 9.0E-07
sp|Q3KRE6|KLDC2_RAT Kelch domain-containing protein 2 OS=Rattus norvegicus GN=Klhdc2 PE=2 SV=1 166 303 1.0E-06
sp|Q3KRE6|KLDC2_RAT Kelch domain-containing protein 2 OS=Rattus norvegicus GN=Klhdc2 PE=2 SV=1 166 404 1.0E-06
sp|Q9LR78|BSU1_ARATH Serine/threonine-protein phosphatase BSU1 OS=Arabidopsis thaliana GN=BSU1 PE=1 SV=2 164 353 1.0E-06
sp|O75882|ATRN_HUMAN Attractin OS=Homo sapiens GN=ATRN PE=1 SV=2 173 404 1.0E-06
sp|Q9WU60|ATRN_MOUSE Attractin OS=Mus musculus GN=Atrn PE=1 SV=3 59 413 1.0E-06
sp|Q5R774|KEAP1_PONAB Kelch-like ECH-associated protein 1 OS=Pongo abelii GN=KEAP1 PE=2 SV=1 173 457 1.0E-06
sp|Q14145|KEAP1_HUMAN Kelch-like ECH-associated protein 1 OS=Homo sapiens GN=KEAP1 PE=1 SV=2 173 457 1.0E-06
sp|Q96NJ5|KLH32_HUMAN Kelch-like protein 32 OS=Homo sapiens GN=KLHL32 PE=2 SV=2 208 502 1.0E-06
sp|Q8W4K1|TYW23_ARATH tRNA wybutosine-synthesizing protein 2/3/4 OS=Arabidopsis thaliana GN=At4g04670 PE=2 SV=1 333 435 2.0E-06
sp|Q4G5Y1|KLDC2_MOUSE Kelch domain-containing protein 2 OS=Mus musculus GN=Klhdc2 PE=2 SV=3 166 404 2.0E-06
sp|Q86L99|GACHH_DICDI Rho GTPase-activating protein gacHH OS=Dictyostelium discoideum GN=gacHH PE=3 SV=1 171 281 2.0E-06
sp|Q5E9A7|KLDC2_BOVIN Kelch domain-containing protein 2 OS=Bos taurus GN=KLHDC2 PE=2 SV=1 139 404 2.0E-06
sp|Q8W420|ADO2_ARATH Adagio protein 2 OS=Arabidopsis thaliana GN=ADO2 PE=1 SV=1 114 357 2.0E-06
sp|Q684M4|KEAP1_PIG Kelch-like ECH-associated protein 1 OS=Sus scrofa GN=KEAP1 PE=3 SV=1 173 457 2.0E-06
sp|Q0D2A9|KLH25_XENTR Kelch-like protein 25 OS=Xenopus tropicalis GN=klhl25 PE=2 SV=1 168 404 2.0E-06
sp|Q53GT1|KLH22_HUMAN Kelch-like protein 22 OS=Homo sapiens GN=KLHL22 PE=1 SV=2 232 426 2.0E-06
sp|D2HEW7|KLH22_AILME Kelch-like protein 22 OS=Ailuropoda melanoleuca GN=KLHL22 PE=3 SV=1 232 426 2.0E-06
sp|A6NCF5|KLH33_HUMAN Kelch-like protein 33 OS=Homo sapiens GN=KLHL33 PE=4 SV=2 196 388 3.0E-06
sp|Q25390|SCRA_LIMPO Alpha-scruin OS=Limulus polyphemus PE=2 SV=1 252 404 3.0E-06
sp|Q9Y6Y0|NS1BP_HUMAN Influenza virus NS1A-binding protein OS=Homo sapiens GN=IVNS1ABP PE=1 SV=3 181 374 3.0E-06
sp|Q25390|SCRA_LIMPO Alpha-scruin OS=Limulus polyphemus PE=2 SV=1 228 426 4.0E-06
sp|Q08CY1|KLH22_XENTR Kelch-like protein 22 OS=Xenopus tropicalis GN=klhl22 PE=2 SV=1 173 404 5.0E-06
sp|B4QLQ2|KLHDB_DROSI Kelch-like protein diablo OS=Drosophila simulans GN=dbo PE=3 SV=1 212 353 5.0E-06
sp|Q69ZK5|KLH14_MOUSE Kelch-like protein 14 OS=Mus musculus GN=Klhl14 PE=1 SV=2 236 404 6.0E-06
sp|Q6PF15|KLH35_HUMAN Kelch-like protein 35 OS=Homo sapiens GN=KLHL35 PE=1 SV=3 117 371 6.0E-06
sp|Q5ZKD9|KLH20_CHICK Kelch-like protein 20 OS=Gallus gallus GN=KLHL20 PE=2 SV=1 212 381 7.0E-06
sp|Q9QYP0|MEGF8_RAT Multiple epidermal growth factor-like domains protein 8 OS=Rattus norvegicus GN=Megf8 PE=1 SV=2 102 369 7.0E-06
sp|Q5R7B8|KLH20_PONAB Kelch-like protein 20 OS=Pongo abelii GN=KLHL20 PE=2 SV=3 212 381 8.0E-06
sp|Q19981|TAG53_CAEEL Putative protein tag-53 OS=Caenorhabditis elegans GN=tag-53 PE=1 SV=3 210 474 8.0E-06
sp|Q6DFF6|KLH20_XENLA Kelch-like protein 20 OS=Xenopus laevis GN=klhl20 PE=2 SV=1 212 381 8.0E-06
sp|Q25390|SCRA_LIMPO Alpha-scruin OS=Limulus polyphemus PE=2 SV=1 171 428 9.0E-06
sp|Q5F3N5|KLH14_CHICK Kelch-like protein 14 OS=Gallus gallus GN=KLHL14 PE=2 SV=1 236 404 9.0E-06
sp|D3Z8N4|KLH20_RAT Kelch-like protein 20 OS=Rattus norvegicus GN=Klhl20 PE=3 SV=1 212 381 1.0E-05
sp|Q9Y2M5|KLH20_HUMAN Kelch-like protein 20 OS=Homo sapiens GN=KLHL20 PE=1 SV=4 212 381 1.0E-05
sp|Q08DK3|KLH20_BOVIN Kelch-like protein 20 OS=Bos taurus GN=KLHL20 PE=2 SV=3 212 381 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup3995
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1674
Ophiocordyceps australis map64 (Brazil) OphauB2|5735
Ophiocordyceps camponoti-floridani Ophcf2|03447
Ophiocordyceps camponoti-rufipedis Ophun1|1724 (this protein)
Ophiocordyceps kimflemingae Ophio5|6012
Ophiocordyceps subramaniannii Hirsu2|7993

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|1724
MAFLFKSKKSQDRALSSRDGNSSSQSSIPPVSSRIPRDEKNAAAQRGTPTGSLNSADNDVSAASPDHGHSRRGGS
VDTTQQSDLPLRNGPPPTNPNASLYPWSQRRLTYSSSHSSPFPRYGAAVNALSSKEGDIYMMGGLINSSTVKGDL
WLIEAGGSMNCYPLATTAEGPCPRVGHASLLVGNAFIVYGGDTKIKDSDVLDETLYLLNTSTRNWSLALPAGPRP
SGRYGHSLNILGSKIYIFGGQVEGSFMNDLSAFDLNQLQKPSNRWEILVPGEASPKVPAPRTNHSMVTYNDRMYL
FGGTNGFQWFNDVWCYDPSANSWTQLDCIGYIPAPREGHAAALVDDVMYVFGGRTEEGSDLGDLAAFRISSRRWY
TFQNMGPSPSPRSGHSMTTVGKWIVVLGGEPSAAASAINDLGILYVLDTTKIRYPNDSQQSTQRAVQGRRPSGSE
VQSPVRQLQSRDGSTGPSEQRKLGAVPPLAAPAVNGGFKAPPTSGPQEVSVPPSNQTQAGPGAPTSKLPRAAATM
SPTAGMAPPQGPPPSRPPADAGRVRGMSVDRSGASGSPRLRSAQSPVARDGGLDMDTAAVNGRRTPTQTVKKSHE
LEATAATVTAAADAAAKSKQPRHNPSQGSVDSTTDQSLKAPRPSSPPPPIRQTGTPSRRLSGRNSQTVALLKELD
SSRNRNAWYASELELARKAGYVTTTGLSPTLDAKATETFDDEDRPLVEALLAMRTELANVQSAVDKQAVIAAKQI
AEAEKQRDAAIQEAVYAKAKIAAHGANVNSTPQHEKERGDAGDRTAEMSRKLATALNLQRDMQSQLDGMRMELEA
ERKARKLADETTTVAQKRMTDLENYKQQTSTEVERLKAELHMVQREAREQSVSSAEAVAALELLRVEKAEMTSKY
DRALDSSKDHGETFESLRSAIVASQDARAHLEKKAEDERLEREALQEKFNKLKAEHDACVAELGTATQRLKDAEE
LAKKHIEEARTHRQAVISGLDKISARDIPRSVPADSERLTVLQNQMATSNGLVKKYKAEADSAADKLRSAEERIA
GLEQYQEQSSREGVAIRRQLQSSLREVQSLQAAQADVKNQLAAQQLEANAMTVQNKALKAILGERGISPTTAVRT
RALASPRMASPDMGRVRELESQLANTVAAHEETKQTFAAQAQESETAYREKLSQLESDYQSAVHYVKGTEKMLKQ
LKDQLTRYKTDNGKLKAEVEELEARLDKDAGDTTAEWESERSKMRQRTEELESELREAGAQLDKDLEKLKTELAE
SKRQRDAAVKSSEEATRSLTSQRRDLEQLQSTNSLLEQRAAEAEQKVSLLLDQVENSVDNYRRRSRQVASLGSDS
GQGANGLDLVNRGHNRTESSDTVGGYVGAVSSHHSQSHSQSHNHNHNHGLEARNSAALDNLASELETLRSHWEST
NKSYRLSSNFDFDHPPPAAARDADDAAATATSTAAATAGSGLSKSLADWRKRLDTDDVAHNGVDKTHSTT*
Coding >Ophun1|1724
ATGGCCTTCCTCTTCAAGTCAAAGAAGAGCCAGGACCGCGCCTTGTCGAGCCGCGATGGCAACTCGAGCTCGCAG
TCGTCCATCCCGCCCGTCAGCTCTCGCATCCCCCGCGATGAGAAGAATGCCGCGGCGCAACGAGGGACGCCTACG
GGGAGCCTCAACTCGGCCGACAACGACGTCTCTGCTGCCAGTCCCGATCACGGCCATTCGCGCCGCGGTGGGAGC
GTCGACACGACCCAGCAGAGCGATTTACCCCTTCGAAATGGACCGCCGCCGACGAATCCGAATGCTTCGCTCTAT
CCGTGGTCGCAACGCCGCTTGACCTACTCCTCATCCCATTCCAGCCCGTTTCCGCGATACGGTGCCGCCGTCAAT
GCGCTGTCGTCCAAGGAAGGCGACATTTACATGATGGGGGGCCTGATCAACAGTTCTACGGTCAAGGGCGATCTG
TGGCTGATTGAAGCTGGCGGAAGCATGAATTGCTATCCCCTCGCTACCACGGCCGAGGGTCCTTGTCCGAGGGTG
GGACATGCCAGTTTGCTGGTCGGCAACGCCTTCATCGTTTACGGTGGCGATACCAAGATTAAAGACTCCGACGTC
CTCGATGAGACGCTATACCTGCTTAATACGTCCACACGGAACTGGTCGCTGGCTCTTCCCGCTGGCCCTCGGCCC
TCAGGCCGCTACGGACATTCGCTGAATATCTTGGGGTCCAAGATTTACATCTTTGGTGGTCAGGTTGAAGGCTCG
TTCATGAATGACCTCTCCGCCTTTGACCTCAACCAGCTCCAGAAGCCCAGCAACCGATGGGAGATTTTGGTACCG
GGCGAGGCATCGCCCAAGGTTCCGGCTCCGCGGACGAACCATTCCATGGTCACGTACAACGATAGGATGTACTTG
TTCGGTGGCACCAACGGGTTTCAATGGTTCAACGATGTCTGGTGCTACGATCCGTCGGCCAACTCGTGGACGCAG
CTCGATTGCATAGGCTACATCCCGGCCCCTCGCGAGGGACACGCGGCCGCGCTCGTCGACGATGTCATGTACGTC
TTTGGCGGCCGCACCGAAGAAGGCAGCGATCTTGGCGATCTCGCGGCATTCAGGATATCGTCGCGCCGATGGTAT
ACGTTCCAGAACATGGGTCCGTCTCCTTCGCCGCGGTCCGGCCACAGTATGACGACTGTGGGCAAATGGATTGTT
GTCCTGGGCGGCGAACCCAGCGCTGCTGCCTCCGCCATCAACGACCTCGGCATCCTCTATGTCTTGGATACGACT
AAGATTCGGTATCCCAATGATAGCCAGCAGAGCACGCAGAGGGCGGTTCAGGGCCGGCGCCCGAGCGGGAGCGAA
GTCCAGAGCCCCGTCCGCCAGCTGCAGTCTCGGGACGGGTCTACGGGGCCGTCCGAGCAGCGGAAACTGGGCGCT
GTGCCCCCTCTGGCCGCCCCGGCCGTCAATGGTGGATTCAAGGCGCCTCCGACGAGCGGCCCTCAGGAAGTCAGC
GTCCCACCGTCAAACCAGACACAGGCGGGACCCGGGGCGCCGACATCCAAGCTCCCGCGTGCCGCCGCGACCATG
AGCCCTACTGCCGGCATGGCGCCTCCGCAAGGTCCGCCGCCGTCGAGGCCCCCGGCGGACGCAGGGCGAGTGCGC
GGCATGTCGGTCGATCGCAGCGGTGCTTCGGGCTCGCCACGGCTCAGGTCAGCTCAGTCTCCCGTGGCCCGCGAC
GGTGGACTCGACATGGACACGGCCGCCGTCAATGGCCGACGAACGCCGACGCAGACGGTTAAGAAAAGCCATGAG
CTAGAAGCGACGGCTGCCACAGTCACCGCAGCCGCCGATGCTGCCGCCAAGTCGAAGCAGCCTCGTCACAACCCG
TCACAGGGCTCCGTTGACAGCACGACGGACCAGAGCCTGAAAGCGCCACGGCCGTCATCACCGCCTCCGCCGATC
CGACAGACGGGCACCCCCTCCAGACGGCTGTCTGGCCGCAACTCGCAGACGGTAGCCCTGCTCAAGGAGCTCGAC
TCGTCCCGCAACAGGAACGCGTGGTACGCATCGGAGCTGGAGTTGGCTCGGAAAGCAGGCTACGTCACCACCACC
GGCTTAAGCCCGACGCTGGACGCCAAGGCAACCGAGACCTTTGACGACGAGGACCGTCCGCTCGTCGAGGCCCTG
CTGGCGATGCGCACCGAGCTGGCCAACGTGCAGAGCGCCGTAGACAAGCAGGCTGTCATTGCCGCCAAGCAGATC
GCCGAGGCCGAGAAGCAGCGGGACGCGGCCATCCAGGAGGCCGTCTACGCAAAGGCAAAGATTGCCGCTCACGGG
GCCAACGTGAACAGCACTCCCCAGCACGAGAAAGAGCGAGGCGACGCCGGCGATAGGACCGCCGAGATGAGCCGG
AAGCTCGCTACGGCCCTGAATCTCCAGAGAGACATGCAGTCGCAGCTGGATGGCATGAGGATGGAGCTCGAAGCC
GAACGAAAGGCACGAAAACTCGCAGACGAGACGACGACGGTGGCCCAGAAGCGCATGACTGACCTGGAAAACTAC
AAGCAGCAGACGTCGACCGAAGTTGAGCGGTTGAAGGCGGAGCTCCACATGGTGCAACGTGAAGCTCGCGAGCAG
TCGGTATCCAGCGCCGAGGCCGTGGCCGCCCTGGAGCTCCTGAGGGTCGAGAAGGCGGAGATGACCAGCAAGTAC
GACAGGGCCTTGGACAGCTCCAAGGATCACGGCGAGACGTTCGAGTCCCTCCGCAGCGCCATCGTGGCGTCGCAG
GATGCCAGGGCGCACCTGGAGAAGAAGGCCGAGGATGAGCGGCTCGAGAGAGAGGCGCTCCAGGAAAAGTTTAAC
AAACTCAAGGCCGAGCACGACGCGTGCGTGGCGGAACTGGGGACGGCTACACAGCGGCTCAAAGACGCCGAAGAG
CTGGCCAAGAAGCACATTGAGGAGGCGAGAACACATCGGCAAGCCGTCATCTCTGGACTCGACAAGATCTCGGCC
AGGGACATTCCGAGGTCGGTCCCGGCGGACAGCGAGCGTCTGACGGTGCTCCAAAACCAGATGGCGACGTCCAAC
GGCCTGGTTAAGAAGTACAAGGCCGAGGCGGACTCGGCGGCCGACAAGCTACGCAGCGCCGAGGAGCGCATCGCC
GGGCTGGAGCAGTACCAGGAGCAGTCGAGCAGGGAGGGCGTCGCGATACGGCGACAGCTGCAGTCGTCGCTACGG
GAGGTTCAGAGCCTGCAGGCGGCGCAGGCCGATGTCAAGAACCAACTGGCGGCCCAGCAGCTCGAGGCCAACGCC
ATGACGGTCCAGAACAAGGCTCTCAAGGCCATCCTCGGCGAGCGAGGCATCAGCCCGACGACTGCGGTACGGACA
CGGGCCCTGGCCAGCCCCAGGATGGCGTCTCCGGACATGGGCCGCGTCCGAGAGCTCGAATCGCAGCTCGCCAAC
ACCGTGGCGGCACACGAGGAGACGAAGCAGACGTTTGCGGCGCAGGCTCAGGAATCCGAGACGGCCTATCGCGAG
AAGCTGTCGCAGCTCGAGAGCGACTATCAGTCAGCCGTGCACTACGTAAAGGGGACGGAGAAGATGCTGAAGCAG
CTCAAGGATCAGCTAACACGCTACAAGACGGACAACGGGAAGCTCAAGGCCGAGGTAGAAGAGCTCGAGGCCCGA
CTCGACAAGGACGCCGGCGATACGACGGCCGAGTGGGAAAGCGAACGCAGCAAGATGCGCCAGAGAACGGAAGAG
CTCGAGAGCGAACTGCGAGAAGCCGGCGCCCAGCTGGACAAGGACCTGGAGAAGCTCAAGACGGAGCTGGCCGAG
AGCAAGCGACAGCGAGACGCGGCCGTCAAGAGCAGCGAGGAGGCGACCAGGAGTCTCACCTCTCAGCGCAGGGAC
CTGGAGCAACTCCAGTCCACCAACTCGCTGCTGGAGCAACGGGCAGCCGAGGCGGAGCAAAAGGTCTCGCTGCTA
CTGGACCAGGTCGAGAACTCGGTCGACAACTACCGCCGCCGAAGCCGACAGGTAGCCAGCCTCGGCTCCGACTCG
GGCCAGGGAGCCAACGGCCTCGACCTCGTCAACCGGGGCCACAACCGGACCGAGAGCTCCGACACGGTGGGCGGC
TACGTCGGAGCCGTCAGCAGCCATCACAGCCAAAGCCACAGCCAAAGCCACAACCACAACCACAACCACGGCCTG
GAAGCCCGCAACAGCGCCGCCCTCGACAACCTGGCCTCGGAGCTGGAAACGCTGCGCTCCCACTGGGAATCAACC
AACAAGAGCTACAGGCTCTCGTCGAACTTCGACTTCGACCACCCGCCTCCCGCCGCTGCCCGTGACGCCGACGAC
GCTGCTGCCACTGCAACGTCCACCGCCGCCGCCACCGCCGGCTCCGGCCTCAGCAAGAGCCTCGCTGACTGGAGG
AAGAGGCTTGATACCGATGACGTGGCTCATAATGGCGTCGATAAGACGCACTCTACTACCTAA
Transcript >Ophun1|1724
ATGGCCTTCCTCTTCAAGTCAAAGAAGAGCCAGGACCGCGCCTTGTCGAGCCGCGATGGCAACTCGAGCTCGCAG
TCGTCCATCCCGCCCGTCAGCTCTCGCATCCCCCGCGATGAGAAGAATGCCGCGGCGCAACGAGGGACGCCTACG
GGGAGCCTCAACTCGGCCGACAACGACGTCTCTGCTGCCAGTCCCGATCACGGCCATTCGCGCCGCGGTGGGAGC
GTCGACACGACCCAGCAGAGCGATTTACCCCTTCGAAATGGACCGCCGCCGACGAATCCGAATGCTTCGCTCTAT
CCGTGGTCGCAACGCCGCTTGACCTACTCCTCATCCCATTCCAGCCCGTTTCCGCGATACGGTGCCGCCGTCAAT
GCGCTGTCGTCCAAGGAAGGCGACATTTACATGATGGGGGGCCTGATCAACAGTTCTACGGTCAAGGGCGATCTG
TGGCTGATTGAAGCTGGCGGAAGCATGAATTGCTATCCCCTCGCTACCACGGCCGAGGGTCCTTGTCCGAGGGTG
GGACATGCCAGTTTGCTGGTCGGCAACGCCTTCATCGTTTACGGTGGCGATACCAAGATTAAAGACTCCGACGTC
CTCGATGAGACGCTATACCTGCTTAATACGTCCACACGGAACTGGTCGCTGGCTCTTCCCGCTGGCCCTCGGCCC
TCAGGCCGCTACGGACATTCGCTGAATATCTTGGGGTCCAAGATTTACATCTTTGGTGGTCAGGTTGAAGGCTCG
TTCATGAATGACCTCTCCGCCTTTGACCTCAACCAGCTCCAGAAGCCCAGCAACCGATGGGAGATTTTGGTACCG
GGCGAGGCATCGCCCAAGGTTCCGGCTCCGCGGACGAACCATTCCATGGTCACGTACAACGATAGGATGTACTTG
TTCGGTGGCACCAACGGGTTTCAATGGTTCAACGATGTCTGGTGCTACGATCCGTCGGCCAACTCGTGGACGCAG
CTCGATTGCATAGGCTACATCCCGGCCCCTCGCGAGGGACACGCGGCCGCGCTCGTCGACGATGTCATGTACGTC
TTTGGCGGCCGCACCGAAGAAGGCAGCGATCTTGGCGATCTCGCGGCATTCAGGATATCGTCGCGCCGATGGTAT
ACGTTCCAGAACATGGGTCCGTCTCCTTCGCCGCGGTCCGGCCACAGTATGACGACTGTGGGCAAATGGATTGTT
GTCCTGGGCGGCGAACCCAGCGCTGCTGCCTCCGCCATCAACGACCTCGGCATCCTCTATGTCTTGGATACGACT
AAGATTCGGTATCCCAATGATAGCCAGCAGAGCACGCAGAGGGCGGTTCAGGGCCGGCGCCCGAGCGGGAGCGAA
GTCCAGAGCCCCGTCCGCCAGCTGCAGTCTCGGGACGGGTCTACGGGGCCGTCCGAGCAGCGGAAACTGGGCGCT
GTGCCCCCTCTGGCCGCCCCGGCCGTCAATGGTGGATTCAAGGCGCCTCCGACGAGCGGCCCTCAGGAAGTCAGC
GTCCCACCGTCAAACCAGACACAGGCGGGACCCGGGGCGCCGACATCCAAGCTCCCGCGTGCCGCCGCGACCATG
AGCCCTACTGCCGGCATGGCGCCTCCGCAAGGTCCGCCGCCGTCGAGGCCCCCGGCGGACGCAGGGCGAGTGCGC
GGCATGTCGGTCGATCGCAGCGGTGCTTCGGGCTCGCCACGGCTCAGGTCAGCTCAGTCTCCCGTGGCCCGCGAC
GGTGGACTCGACATGGACACGGCCGCCGTCAATGGCCGACGAACGCCGACGCAGACGGTTAAGAAAAGCCATGAG
CTAGAAGCGACGGCTGCCACAGTCACCGCAGCCGCCGATGCTGCCGCCAAGTCGAAGCAGCCTCGTCACAACCCG
TCACAGGGCTCCGTTGACAGCACGACGGACCAGAGCCTGAAAGCGCCACGGCCGTCATCACCGCCTCCGCCGATC
CGACAGACGGGCACCCCCTCCAGACGGCTGTCTGGCCGCAACTCGCAGACGGTAGCCCTGCTCAAGGAGCTCGAC
TCGTCCCGCAACAGGAACGCGTGGTACGCATCGGAGCTGGAGTTGGCTCGGAAAGCAGGCTACGTCACCACCACC
GGCTTAAGCCCGACGCTGGACGCCAAGGCAACCGAGACCTTTGACGACGAGGACCGTCCGCTCGTCGAGGCCCTG
CTGGCGATGCGCACCGAGCTGGCCAACGTGCAGAGCGCCGTAGACAAGCAGGCTGTCATTGCCGCCAAGCAGATC
GCCGAGGCCGAGAAGCAGCGGGACGCGGCCATCCAGGAGGCCGTCTACGCAAAGGCAAAGATTGCCGCTCACGGG
GCCAACGTGAACAGCACTCCCCAGCACGAGAAAGAGCGAGGCGACGCCGGCGATAGGACCGCCGAGATGAGCCGG
AAGCTCGCTACGGCCCTGAATCTCCAGAGAGACATGCAGTCGCAGCTGGATGGCATGAGGATGGAGCTCGAAGCC
GAACGAAAGGCACGAAAACTCGCAGACGAGACGACGACGGTGGCCCAGAAGCGCATGACTGACCTGGAAAACTAC
AAGCAGCAGACGTCGACCGAAGTTGAGCGGTTGAAGGCGGAGCTCCACATGGTGCAACGTGAAGCTCGCGAGCAG
TCGGTATCCAGCGCCGAGGCCGTGGCCGCCCTGGAGCTCCTGAGGGTCGAGAAGGCGGAGATGACCAGCAAGTAC
GACAGGGCCTTGGACAGCTCCAAGGATCACGGCGAGACGTTCGAGTCCCTCCGCAGCGCCATCGTGGCGTCGCAG
GATGCCAGGGCGCACCTGGAGAAGAAGGCCGAGGATGAGCGGCTCGAGAGAGAGGCGCTCCAGGAAAAGTTTAAC
AAACTCAAGGCCGAGCACGACGCGTGCGTGGCGGAACTGGGGACGGCTACACAGCGGCTCAAAGACGCCGAAGAG
CTGGCCAAGAAGCACATTGAGGAGGCGAGAACACATCGGCAAGCCGTCATCTCTGGACTCGACAAGATCTCGGCC
AGGGACATTCCGAGGTCGGTCCCGGCGGACAGCGAGCGTCTGACGGTGCTCCAAAACCAGATGGCGACGTCCAAC
GGCCTGGTTAAGAAGTACAAGGCCGAGGCGGACTCGGCGGCCGACAAGCTACGCAGCGCCGAGGAGCGCATCGCC
GGGCTGGAGCAGTACCAGGAGCAGTCGAGCAGGGAGGGCGTCGCGATACGGCGACAGCTGCAGTCGTCGCTACGG
GAGGTTCAGAGCCTGCAGGCGGCGCAGGCCGATGTCAAGAACCAACTGGCGGCCCAGCAGCTCGAGGCCAACGCC
ATGACGGTCCAGAACAAGGCTCTCAAGGCCATCCTCGGCGAGCGAGGCATCAGCCCGACGACTGCGGTACGGACA
CGGGCCCTGGCCAGCCCCAGGATGGCGTCTCCGGACATGGGCCGCGTCCGAGAGCTCGAATCGCAGCTCGCCAAC
ACCGTGGCGGCACACGAGGAGACGAAGCAGACGTTTGCGGCGCAGGCTCAGGAATCCGAGACGGCCTATCGCGAG
AAGCTGTCGCAGCTCGAGAGCGACTATCAGTCAGCCGTGCACTACGTAAAGGGGACGGAGAAGATGCTGAAGCAG
CTCAAGGATCAGCTAACACGCTACAAGACGGACAACGGGAAGCTCAAGGCCGAGGTAGAAGAGCTCGAGGCCCGA
CTCGACAAGGACGCCGGCGATACGACGGCCGAGTGGGAAAGCGAACGCAGCAAGATGCGCCAGAGAACGGAAGAG
CTCGAGAGCGAACTGCGAGAAGCCGGCGCCCAGCTGGACAAGGACCTGGAGAAGCTCAAGACGGAGCTGGCCGAG
AGCAAGCGACAGCGAGACGCGGCCGTCAAGAGCAGCGAGGAGGCGACCAGGAGTCTCACCTCTCAGCGCAGGGAC
CTGGAGCAACTCCAGTCCACCAACTCGCTGCTGGAGCAACGGGCAGCCGAGGCGGAGCAAAAGGTCTCGCTGCTA
CTGGACCAGGTCGAGAACTCGGTCGACAACTACCGCCGCCGAAGCCGACAGGTAGCCAGCCTCGGCTCCGACTCG
GGCCAGGGAGCCAACGGCCTCGACCTCGTCAACCGGGGCCACAACCGGACCGAGAGCTCCGACACGGTGGGCGGC
TACGTCGGAGCCGTCAGCAGCCATCACAGCCAAAGCCACAGCCAAAGCCACAACCACAACCACAACCACGGCCTG
GAAGCCCGCAACAGCGCCGCCCTCGACAACCTGGCCTCGGAGCTGGAAACGCTGCGCTCCCACTGGGAATCAACC
AACAAGAGCTACAGGCTCTCGTCGAACTTCGACTTCGACCACCCGCCTCCCGCCGCTGCCCGTGACGCCGACGAC
GCTGCTGCCACTGCAACGTCCACCGCCGCCGCCACCGCCGGCTCCGGCCTCAGCAAGAGCCTCGCTGACTGGAGG
AAGAGGCTTGATACCGATGACGTGGCTCATAATGGCGTCGATAAGACGCACTCTACTACCTAA
Gene >Ophun1|1724
ATGGCCTTCCTCTTCAAGTCAAAGAAGAGCCAGGACCGCGCCTTGTCGAGCCGCGATGGCAACTCGAGCTCGCAG
TCGTCCATCCCGCCCGTCAGCTCTCGCATCCCCCGCGATGAGAAGAATGCCGCGGCGCAACGAGGGACGCCTACG
GGGAGCCTCAACTCGGCCGACAACGACGTCTCTGCTGCCAGTCCCGATCACGGCCATTCGCGCCGCGGTGGGAGC
GTCGACACGACCCAGCAGAGCGATTTACCCGTCAGTGGCGCCCCCTCTCCTTTCCCCTCCTCTCCCCTCCTCTCG
TCTTCGCCGGAAAAAAAAAGCCTTCGTGCTATGCTGTGTCCAGCCCCCCTCTTTAATCATGGCTCGTCTTTCTGA
CTTGTGTTGTACAGCTTCGAAATGGACCGCCGCCGACGAATCCGAATGCTTCGCTCTATCCGTGGTCGCAACGCC
GCTTGACCTACTCCTCATCCCATTCCAGCCCGTTTCCGCGATACGGTGCCGCCGTCAATGCGCTGTCGTCCAAGG
AAGGCGACATTTACATGATGGGGGGCCTGATCAACAGTTCTACGGTCAAGGGCGATCTGTGGCTGATTGAAGCTG
GCGGAAGCATGAATTGCTATCCCCTCGCTACCACGGCCGAGGGTCCTTGTCCGAGGGTGGGACATGCCAGTTTGC
TGGTCGGCAACGCCTTCATCGTTTACGGTGGCGATACCAAGATTAAAGACTCCGACGTCCTCGATGAGACGCTAT
ACCTGCTTAATACGTGTAAGTATAGTATGCCGCAGTTCTGGCCCGCGCTGTTGACTGACATGGTCTCTACTAGCC
ACACGGAACTGGTCGCTGGCTCTTCCCGCTGGCCCTCGGCCCTCAGGCCGCTACGGACATTCGCTGAATATCTTG
GGGTCCAAGATTTACATCTTTGGTGGTCAGGTTGAAGGCTCGTTCATGAATGACCTCTCCGCCTTTGACCTCAAC
CAGCTCCAGAAGCCCAGCAACCGATGGGAGATTTTGGTACCGGGCGAGGCATCGCCCAAGGTTCCGGCTCCGCGG
ACGAACCATTCCATGGTCACGTACAACGATAGGATGTACTTGTAAGTTTTCCAAGATTGCACAGCTTCGCCCTCT
TGACTGACGGTGTGCTAGGTTCGGTGGCACCAACGGGTTTCAATGGTTCAACGATGTCTGGTGCTACGATCCGTC
GGCCAACTCGTGGACGCAGCTCGATTGCATAGGCTACATCCCGGCCCCTCGCGAGGGACACGCGGCCGCGCTCGT
CGACGATGTCATGTACGTCTTTGGCGGCCGCACCGAAGAAGGCAGCGATCTTGGCGATCTCGCGGCATTCAGGAT
ATCGTCGCGCCGATGGTATACGTTCCAGAACATGGGTCCGTCTCCTTCGCCGCGGTCCGGCCACAGTATGACGAC
TGTGGGCAAATGGATTGTTGTCCTGGGCGGCGAACCCAGCGCTGCTGCCTCCGCCATCAACGACCTCGGCATCCT
CTATGTCTTGGATACGACTAAGATTCGGTATCCCAATGATAGCCAGCAGAGCACGCAGAGGGCGGTTCAGGGCCG
GCGCCCGAGCGGGAGCGAAGTCCAGAGCCCCGTCCGCCAGCTGCAGTCTCGGGACGGGTCTACGGGGCCGTCCGA
GCAGCGGAAACTGGGCGCTGTGCCCCCTCTGGCCGCCCCGGCCGTCAATGGTGGATTCAAGGCGCCTCCGACGAG
CGGCCCTCAGGAAGTCAGCGTCCCACCGTCAAACCAGACACAGGCGGGACCCGGGGCGCCGACATCCAAGCTCCC
GCGTGCCGCCGCGACCATGAGCCCTACTGCCGGCATGGCGCCTCCGCAAGGTCCGCCGCCGTCGAGGCCCCCGGC
GGACGCAGGGCGAGTGCGCGGCATGTCGGTCGATCGCAGCGGTGCTTCGGGCTCGCCACGGCTCAGGTCAGCTCA
GTCTCCCGTGGCCCGCGACGGTGGACTCGACATGGACACGGCCGCCGTCAATGGCCGACGAACGCCGACGCAGAC
GGTTAAGAAAAGCCATGAGCTAGAAGCGACGGCTGCCACAGTCACCGCAGCCGCCGATGCTGCCGCCAAGTCGAA
GCAGCCTCGTCACAACCCGTCACAGGGCTCCGTTGACAGCACGACGGACCAGAGCCTGAAAGCGCCACGGCCGTC
ATCACCGCCTCCGCCGATCCGACAGACGGGCACCCCCTCCAGACGGCTGTCTGGCCGCAACTCGCAGACGGTAGC
CCTGCTCAAGGAGCTCGACTCGTCCCGCAACAGGAACGCGTGGTACGCATCGGAGCTGGAGTTGGCTCGGAAAGC
AGGCTACGTCACCACCACCGGCTTAAGCCCGACGCTGGACGCCAAGGCAACCGAGACCTTTGACGACGAGGACCG
TCCGCTCGTCGAGGCCCTGCTGGCGATGCGCACCGAGCTGGCCAACGTGCAGAGCGCCGTAGACAAGCAGGCTGT
CATTGCCGCCAAGCAGATCGCCGAGGCCGAGAAGCAGCGGGACGCGGCCATCCAGGAGGCCGTCTACGCAAAGGC
AAAGATTGCCGCTCACGGGGCCAACGTGAACAGCACTCCCCAGCACGAGAAAGAGCGAGGCGACGCCGGCGATAG
GACCGCCGAGATGAGCCGGAAGCTCGCTACGGCCCTGAATCTCCAGAGAGACATGCAGTCGCAGCTGGATGGCAT
GAGGATGGAGCTCGAAGCCGAACGAAAGGCACGAAAACTCGCAGACGAGACGACGACGGTGGCCCAGAAGCGCAT
GACTGACCTGGAAAACTACAAGCAGCAGACGTCGACCGAAGTTGAGCGGTTGAAGGCGGAGCTCCACATGGTGCA
ACGTGAAGCTCGCGAGCAGTCGGTATCCAGCGCCGAGGCCGTGGCCGCCCTGGAGCTCCTGAGGGTCGAGAAGGC
GGAGATGACCAGCAAGTACGACAGGGCCTTGGACAGCTCCAAGGATCACGGCGAGACGTTCGAGTCCCTCCGCAG
CGCCATCGTGGCGTCGCAGGATGCCAGGGCGCACCTGGAGAAGAAGGCCGAGGATGAGCGGCTCGAGAGAGAGGC
GCTCCAGGAAAAGTTTAACAAACTCAAGGCCGAGCACGACGCGTGCGTGGCGGAACTGGGGACGGCTACACAGCG
GCTCAAAGACGCCGAAGAGCTGGCCAAGAAGCACATTGAGGAGGCGAGAACACATCGGCAAGCCGTCATCTCTGG
ACTCGACAAGATCTCGGCCAGGGACATTCCGAGGTCGGTCCCGGCGGACAGCGAGCGTCTGACGGTGCTCCAAAA
CCAGATGGCGACGTCCAACGGCCTGGTTAAGAAGTACAAGGCCGAGGCGGACTCGGCGGCCGACAAGCTACGCAG
CGCCGAGGAGCGCATCGCCGGGCTGGAGCAGTACCAGGAGCAGTCGAGCAGGGAGGGCGTCGCGATACGGCGACA
GCTGCAGTCGTCGCTACGGGAGGTTCAGAGCCTGCAGGCGGCGCAGGCCGATGTCAAGAACCAACTGGCGGCCCA
GCAGCTCGAGGCCAACGCCATGACGGTCCAGAACAAGGCTCTCAAGGCCATCCTCGGCGAGCGAGGCATCAGCCC
GACGACTGCGGTACGGACACGGGCCCTGGCCAGCCCCAGGATGGCGTCTCCGGACATGGGCCGCGTCCGAGAGCT
CGAATCGCAGCTCGCCAACACCGTGGCGGCACACGAGGAGACGAAGCAGACGTTTGCGGCGCAGGCTCAGGAATC
CGAGACGGCCTATCGCGAGAAGCTGTCGCAGCTCGAGAGCGACTATCAGTCAGCCGTGCACTACGTAAAGGGGAC
GGAGAAGATGCTGAAGCAGCTCAAGGATCAGCTAACACGCTACAAGACGGACAACGGGAAGCTCAAGGCCGAGGT
AGAAGAGCTCGAGGCCCGACTCGACAAGGACGCCGGCGATACGACGGCCGAGTGGGAAAGCGAACGCAGCAAGAT
GCGCCAGAGAACGGAAGAGCTCGAGAGCGAACTGCGAGAAGCCGGCGCCCAGCTGGACAAGGACCTGGAGAAGCT
CAAGACGGAGCTGGCCGAGAGCAAGCGACAGCGAGACGCGGCCGTCAAGAGCAGCGAGGAGGCGACCAGGAGTCT
CACCTCTCAGCGCAGGGACCTGGAGCAACTCCAGTCCACCAACTCGCTGCTGGAGCAACGGGCAGCCGAGGCGGA
GCAAAAGGTCTCGCTGCTACTGGACCAGGTCGAGAACTCGGTCGACAACTACCGCCGCCGAAGCCGACAGGTAGC
CAGCCTCGGCTCCGACTCGGGCCAGGGAGCCAACGGCCTCGACCTCGTCAACCGGGGCCACAACCGGACCGAGAG
CTCCGACACGGTGGGCGGCTACGTCGGAGCCGTCAGCAGCCATCACAGCCAAAGCCACAGCCAAAGCCACAACCA
CAACCACAACCACGGCCTGGAAGCCCGCAACAGCGCCGCCCTCGACAACCTGGCCTCGGAGCTGGAAACGCTGCG
CTCCCACTGGGAATCAACCAACAAGAGCTACAGGCTCTCGTCGAACTTCGACTTCGACCACCCGCCTCCCGCCGC
TGCCCGTGACGCCGACGACGCTGCTGCCACTGCAACGTCCACCGCCGCCGCCACCGCCGGCTCCGGCCTCAGCAA
GAGCCTCGCTGACTGGAGGAAGAGGCTTGATACCGATGACGTGGCTCATAATGGCGTCGATAAGACGCACTCTAC
TACCTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail