Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|1709
Gene name
LocationContig_174:9103..10362
Strand-
Gene length (bp)1259
Transcript length (bp)1146
Coding sequence length (bp)1146
Protein length (aa) 382

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00650 CRAL_TRIO CRAL/TRIO domain 2.9E-23 109 286
PF03765 CRAL_TRIO_N CRAL/TRIO, N-terminal domain 2.2E-08 35 75

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P33324|YKJ1_YEAST CRAL-TRIO domain-containing protein YKL091C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YKL091C PE=1 SV=2 18 287 9.0E-25
sp|P46250|SEC14_CANAL SEC14 cytosolic factor OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SEC14 PE=2 SV=1 4 314 1.0E-24
sp|P24280|SEC14_YEAST SEC14 cytosolic factor OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SEC14 PE=1 SV=3 4 295 8.0E-22
sp|Q10137|SEC14_SCHPO Sec14 cytosolic factor OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sec14 PE=3 SV=1 1 290 2.0E-21
sp|F4JYJ3|SFH11_ARATH Phosphatidylinositol/phosphatidylcholine transfer protein SFH11 OS=Arabidopsis thaliana GN=SFH11 PE=3 SV=1 29 311 4.0E-19
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P33324|YKJ1_YEAST CRAL-TRIO domain-containing protein YKL091C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YKL091C PE=1 SV=2 18 287 9.0E-25
sp|P46250|SEC14_CANAL SEC14 cytosolic factor OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SEC14 PE=2 SV=1 4 314 1.0E-24
sp|P24280|SEC14_YEAST SEC14 cytosolic factor OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SEC14 PE=1 SV=3 4 295 8.0E-22
sp|Q10137|SEC14_SCHPO Sec14 cytosolic factor OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sec14 PE=3 SV=1 1 290 2.0E-21
sp|F4JYJ3|SFH11_ARATH Phosphatidylinositol/phosphatidylcholine transfer protein SFH11 OS=Arabidopsis thaliana GN=SFH11 PE=3 SV=1 29 311 4.0E-19
sp|P45816|SEC14_YARLI SEC14 cytosolic factor OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=SEC14 PE=3 SV=2 4 286 1.0E-18
sp|F4JVA9|SFH2_ARATH Phosphatidylinositol/phosphatidylcholine transfer protein SFH2 OS=Arabidopsis thaliana GN=SFH2 PE=2 SV=1 20 301 8.0E-18
sp|P53989|SEC14_CANGA SEC14 cytosolic factor OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=SEC14 PE=3 SV=1 8 295 2.0E-17
sp|Q75DK1|SEC14_ASHGO SEC14 cytosolic factor OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=SEC14 PE=3 SV=2 4 295 2.0E-17
sp|Q9SIW3|SFH7_ARATH Phosphatidylinositol/phosphatidylcholine transfer protein SFH7 OS=Arabidopsis thaliana GN=SFH7 PE=2 SV=2 30 290 6.0E-17
sp|Q93ZE9|SFH3_ARATH Phosphatidylinositol/phosphatidylcholine transfer protein SFH3 OS=Arabidopsis thaliana GN=SFH3 PE=2 SV=1 20 290 8.0E-17
sp|Q9SI13|SFH10_ARATH Phosphatidylinositol/phosphatidylcholine transfer protein SFH10 OS=Arabidopsis thaliana GN=SFH10 PE=3 SV=1 25 300 1.0E-16
sp|F4JLE5|SFH1_ARATH Phosphatidylinositol/phosphatidylcholine transfer protein SFH1 OS=Arabidopsis thaliana GN=SFH1 PE=2 SV=1 23 300 1.0E-16
sp|P58875|S14L2_BOVIN SEC14-like protein 2 OS=Bos taurus GN=SEC14L2 PE=1 SV=2 18 288 2.0E-16
sp|Q99MS0|S14L2_RAT SEC14-like protein 2 OS=Rattus norvegicus GN=Sec14l2 PE=1 SV=1 18 288 2.0E-16
sp|Q94A34|SFH12_ARATH Phosphatidylinositol/phosphatidylcholine transfer protein SFH12 OS=Arabidopsis thaliana GN=SFH12 PE=2 SV=1 25 300 2.0E-16
sp|F4J7S8|SFH9_ARATH Phosphatidylinositol/phosphatidylcholine transfer protein SFH9 OS=Arabidopsis thaliana GN=SFH9 PE=2 SV=1 26 306 4.0E-16
sp|Q99J08|S14L2_MOUSE SEC14-like protein 2 OS=Mus musculus GN=Sec14l2 PE=1 SV=1 18 288 1.0E-15
sp|F4IHJ0|SFH8_ARATH Phosphatidylinositol/phosphatidylcholine transfer protein SFH8 OS=Arabidopsis thaliana GN=SFH8 PE=2 SV=1 26 300 1.0E-15
sp|Q9UDX3|S14L4_HUMAN SEC14-like protein 4 OS=Homo sapiens GN=SEC14L4 PE=1 SV=1 19 288 2.0E-15
sp|Q92503|S14L1_HUMAN SEC14-like protein 1 OS=Homo sapiens GN=SEC14L1 PE=1 SV=2 4 307 5.0E-15
sp|Q8R0F9|S14L4_MOUSE SEC14-like protein 4 OS=Mus musculus GN=Sec14l4 PE=1 SV=1 17 288 6.0E-15
sp|P24859|SEC14_KLULA SEC14 cytosolic factor OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=SEC14 PE=3 SV=2 18 295 1.0E-14
sp|F4JVA6|SFH6_ARATH Phosphatidylinositol/phosphatidylcholine transfer protein SFH6 OS=Arabidopsis thaliana GN=SFH6 PE=2 SV=1 26 300 2.0E-14
sp|Q0V9N0|S14L5_XENTR SEC14-like protein 5 OS=Xenopus tropicalis GN=sec14l1 PE=2 SV=1 11 302 2.0E-14
sp|O76054|S14L2_HUMAN SEC14-like protein 2 OS=Homo sapiens GN=SEC14L2 PE=1 SV=1 18 288 5.0E-14
sp|F4HP88|SFH4_ARATH Phosphatidylinositol/phosphatidylcholine transfer protein SFH4 OS=Arabidopsis thaliana GN=SFH4 PE=2 SV=1 48 300 8.0E-14
sp|O43304|S14L5_HUMAN SEC14-like protein 5 OS=Homo sapiens GN=SEC14L5 PE=2 SV=3 1 302 7.0E-13
sp|Q7PWB1|RETM_ANOGA Protein real-time OS=Anopheles gambiae GN=retm PE=3 SV=4 14 298 2.0E-12
sp|Q9UDX4|S14L3_HUMAN SEC14-like protein 3 OS=Homo sapiens GN=SEC14L3 PE=1 SV=1 18 288 2.0E-12
sp|Q757H2|CSR1_ASHGO Phosphatidylinositol transfer protein CSR1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=CSR1 PE=3 SV=2 24 301 2.0E-12
sp|Q9Z1J8|S14L3_RAT SEC14-like protein 3 OS=Rattus norvegicus GN=Sec14l3 PE=1 SV=1 18 288 3.0E-12
sp|Q06705|CSR1_YEAST Phosphatidylinositol transfer protein CSR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CSR1 PE=1 SV=1 54 324 1.0E-10
sp|F4K6D3|SFH14_ARATH Phosphatidylinositol/phosphatidylcholine transfer protein SFH14 OS=Arabidopsis thaliana GN=SFH14 PE=2 SV=1 26 290 2.0E-10
sp|Q8GXC6|SFH5_ARATH Phosphatidylinositol/phosphatidylcholine transfer protein SFH5 OS=Arabidopsis thaliana GN=SFH5 PE=2 SV=1 26 290 2.0E-10
sp|Q29JQ0|RETM_DROPS Protein real-time OS=Drosophila pseudoobscura pseudoobscura GN=retm PE=3 SV=1 19 302 3.0E-10
sp|Q9VMD6|RETM_DROME Protein real-time OS=Drosophila melanogaster GN=retm PE=1 SV=2 20 302 9.0E-10
sp|B5MCN3|S14L6_HUMAN Putative SEC14-like protein 6 OS=Homo sapiens GN=SEC14L6 PE=5 SV=1 18 288 1.0E-09
sp|Q501H5|SFH13_ARATH Phosphatidylinositol/phosphatidylcholine transfer protein SFH13 OS=Arabidopsis thaliana GN=SFH13 PE=2 SV=1 34 295 7.0E-08
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 57 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|1709
MSAIASPPTGLVPEYPRGHVGHLTAEQAEALDSFKALLEERDMWQRGPPASHDDGTLLRFLRARQWVPDKAVEQF
ASSLSWLTTADVNKLRSTMEVSQWQQSRASVPVWTGRRDKRGQPIYYVDCGAVDEKAWTEKGQTKAVRAFAASKA
NSEVTASMLTSVLHLEMMEHVFNPMCSRTTDRLHPEVPVTMATYVADIGQLSLRRFWTVKNHVFSLLTSISVLFP
ETASHIFILNAPSYVGVMWNWVRSWLDPVTASKVVILKAHEVKPALEAYIHPSNIPVRYGGTLDCDFSDGPVLDD
SLRAVVEWEPSFEGLPPGPLTVEADGDLLVCYTSGVEDGKPRRQKVFTIPAQVGSSNKSIEVVDEKHAPGCVVVP
TASVEA*
Coding >Ophun1|1709
ATGTCCGCCATCGCCAGCCCGCCAACGGGGCTCGTGCCTGAGTATCCACGTGGCCATGTTGGACACCTGACTGCC
GAGCAGGCGGAGGCTCTGGATAGCTTCAAGGCTCTGCTGGAAGAGCGGGATATGTGGCAGCGCGGTCCGCCGGCT
TCGCACGACGATGGCACTCTTCTCCGCTTTCTTCGGGCTCGGCAGTGGGTGCCTGACAAGGCGGTCGAGCAGTTC
GCCAGCAGTCTCTCCTGGTTAACAACCGCCGACGTCAACAAACTGCGATCCACCATGGAAGTATCGCAGTGGCAG
CAATCTCGCGCCTCGGTCCCCGTCTGGACCGGCCGACGAGACAAACGCGGCCAGCCCATCTACTACGTCGACTGC
GGCGCCGTCGACGAGAAAGCCTGGACGGAAAAGGGTCAGACCAAGGCGGTGCGGGCCTTTGCAGCAAGCAAGGCA
AACTCGGAGGTGACGGCTTCGATGCTGACGTCGGTGCTTCATCTTGAGATGATGGAACACGTCTTCAATCCCATG
TGTTCGCGCACCACCGATAGGCTTCATCCAGAGGTGCCCGTCACAATGGCCACGTACGTAGCCGACATCGGCCAG
CTCTCGCTCCGCAGGTTCTGGACGGTGAAGAACCACGTCTTCTCGCTACTGACGAGCATCTCGGTCCTCTTCCCG
GAGACGGCATCGCACATCTTCATCCTCAACGCGCCATCTTACGTCGGAGTCATGTGGAACTGGGTTCGCTCTTGG
CTCGATCCCGTCACAGCCTCCAAGGTCGTCATCCTCAAGGCCCACGAGGTGAAGCCCGCGCTCGAGGCGTATATC
CATCCGAGTAACATCCCCGTTCGCTACGGAGGTACCCTCGACTGTGATTTCTCCGACGGGCCTGTGCTTGACGAT
AGCTTGCGCGCGGTTGTTGAATGGGAGCCTTCCTTTGAGGGTCTGCCTCCTGGGCCGCTCACTGTCGAGGCTGAT
GGTGATTTACTCGTTTGCTACACCTCCGGAGTCGAGGATGGCAAGCCCCGGAGGCAAAAGGTATTCACCATACCG
GCGCAGGTCGGCTCGTCAAACAAGTCGATCGAGGTGGTGGACGAGAAGCACGCTCCCGGATGCGTCGTCGTCCCT
ACAGCCTCGGTAGAGGCGTAA
Transcript >Ophun1|1709
ATGTCCGCCATCGCCAGCCCGCCAACGGGGCTCGTGCCTGAGTATCCACGTGGCCATGTTGGACACCTGACTGCC
GAGCAGGCGGAGGCTCTGGATAGCTTCAAGGCTCTGCTGGAAGAGCGGGATATGTGGCAGCGCGGTCCGCCGGCT
TCGCACGACGATGGCACTCTTCTCCGCTTTCTTCGGGCTCGGCAGTGGGTGCCTGACAAGGCGGTCGAGCAGTTC
GCCAGCAGTCTCTCCTGGTTAACAACCGCCGACGTCAACAAACTGCGATCCACCATGGAAGTATCGCAGTGGCAG
CAATCTCGCGCCTCGGTCCCCGTCTGGACCGGCCGACGAGACAAACGCGGCCAGCCCATCTACTACGTCGACTGC
GGCGCCGTCGACGAGAAAGCCTGGACGGAAAAGGGTCAGACCAAGGCGGTGCGGGCCTTTGCAGCAAGCAAGGCA
AACTCGGAGGTGACGGCTTCGATGCTGACGTCGGTGCTTCATCTTGAGATGATGGAACACGTCTTCAATCCCATG
TGTTCGCGCACCACCGATAGGCTTCATCCAGAGGTGCCCGTCACAATGGCCACGTACGTAGCCGACATCGGCCAG
CTCTCGCTCCGCAGGTTCTGGACGGTGAAGAACCACGTCTTCTCGCTACTGACGAGCATCTCGGTCCTCTTCCCG
GAGACGGCATCGCACATCTTCATCCTCAACGCGCCATCTTACGTCGGAGTCATGTGGAACTGGGTTCGCTCTTGG
CTCGATCCCGTCACAGCCTCCAAGGTCGTCATCCTCAAGGCCCACGAGGTGAAGCCCGCGCTCGAGGCGTATATC
CATCCGAGTAACATCCCCGTTCGCTACGGAGGTACCCTCGACTGTGATTTCTCCGACGGGCCTGTGCTTGACGAT
AGCTTGCGCGCGGTTGTTGAATGGGAGCCTTCCTTTGAGGGTCTGCCTCCTGGGCCGCTCACTGTCGAGGCTGAT
GGTGATTTACTCGTTTGCTACACCTCCGGAGTCGAGGATGGCAAGCCCCGGAGGCAAAAGGTATTCACCATACCG
GCGCAGGTCGGCTCGTCAAACAAGTCGATCGAGGTGGTGGACGAGAAGCACGCTCCCGGATGCGTCGTCGTCCCT
ACAGCCTCGGTAGAGGCGTAA
Gene >Ophun1|1709
ATGTCCGCCATCGCCAGCCCGCCAACGGGGCTCGTGCCTGAGTATCCACGTGGCCATGTTGGACACCTGACTGCC
GAGCAGGCGGAGGCTCTGGATAGCTTCAAGGCTCTGCTGGAAGAGCGGGATATGTGGCAGCGCGGTCCGCCGGCT
TCGCACGACGATGGCACTCTTCTGTAGGGATGCTTGTGTTCCTGTGTGTGTGTGTGTGTGTGTTTCTCTGGCTGA
CTGTTGGCAGCCGCTTTCTTCGGGCTCGGCAGTGGGTGCCTGACAAGGCGGTCGAGCAGTTCGCCAGCAGTCTCT
CCTGGTTAACAACCGCCGACGTCAACAAACTGCGATCCACCATGGAAGTATCGCAGTGGCAGCAATCTCGCGCCT
CGGTTCGTCTCCCCCTCGATCGAGCTATTCGCCCCAAGCGCTCATCCGTATAGGTCCCCGTCTGGACCGGCCGAC
GAGACAAACGCGGCCAGCCCATCTACTACGTCGACTGCGGCGCCGTCGACGAGAAAGCCTGGACGGAAAAGGGTC
AGACCAAGGCGGTGCGGGCCTTTGCAGCAAGCAAGGCAAACTCGGAGGTGACGGCTTCGATGCTGACGTCGGTGC
TTCATCTTGAGATGATGGAACACGTCTTCAATCCCATGTGTTCGCGCACCACCGATAGGCTTCATCCAGAGGTGC
CCGTCACAATGGCCACGTACGTAGCCGACATCGGCCAGCTCTCGCTCCGCAGGTTCTGGACGGTGAAGAACCACG
TCTTCTCGCTACTGACGAGCATCTCGGTCCTCTTCCCGGAGACGGCATCGCACATCTTCATCCTCAACGCGCCAT
CTTACGTCGGAGTCATGTGGAACTGGGTTCGCTCTTGGCTCGATCCCGTCACAGCCTCCAAGGTCGTCATCCTCA
AGGCCCACGAGGTGAAGCCCGCGCTCGAGGCGTATATCCATCCGAGTAACATCCCCGTTCGCTACGGAGGTACCC
TCGACTGTGATTTCTCCGACGGGCCTGTGCTTGACGATAGCTTGCGCGCGGTTGTTGAATGGGAGCCTTCCTTTG
AGGGTCTGCCTCCTGGGCCGCTCACTGTCGAGGCTGATGGTGATTTACTCGTTTGCTACACCTCCGGAGTCGAGG
ATGGCAAGCCCCGGAGGCAAAAGGTATTCACCATACCGGCGCAGGTCGGCTCGTCAAACAAGTCGATCGAGGTGG
TGGACGAGAAGCACGCTCCCGGATGCGTCGTCGTCCCTACAGCCTCGGTAGAGGCGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail