Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|1706
Gene name
LocationContig_174:4544..5581
Strand-
Gene length (bp)1037
Transcript length (bp)825
Coding sequence length (bp)825
Protein length (aa) 275

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03661 TMEM33_Pom33 Transmembrane protein 33/Nucleoporin POM33 6.4E-32 10 249

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|G0S6T0|POM33_CHATD Nucleoporin POM33 OS=Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) GN=POM33 PE=3 SV=1 1 274 3.0E-104
sp|Q12164|POM33_YEAST Pore membrane protein of 33 kDa OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=POM33 PE=1 SV=1 2 248 8.0E-43
sp|Q9Y7Z5|TTS1_SCHPO Tetra-spanning protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tts1 PE=1 SV=1 3 254 2.0E-30
sp|Q54ME7|TMM33_DICDI Transmembrane protein 33 homolog OS=Dictyostelium discoideum GN=tmem33 PE=3 SV=1 17 248 9.0E-07
sp|Q12144|PER33_YEAST Pore and endoplasmic reticulum protein of 33 kDa OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PER33 PE=1 SV=1 15 249 5.0E-06

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0110165 cellular anatomical entity No
GO:0031224 intrinsic component of membrane No
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.5

Transmembrane Domains

Domain # Start End Length
1 7 29 22
2 44 66 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|1706
MSLQERLLALAKTLQFAWFVGHMTLLTSTLRYFMSWLRMNYYSGWAQGSYRASFAAAIVTYGIVVYKTQRARAKM
NSRPSGGLAGHLSDENVQYLLMALVWLFSPQYPLALLPYSVYSIFHVATYTRTNLIPACQAPPPPAADGSARPRS
NSPLADRIGNFVKEYYETSMSVVSAMELLLWVRILFSAILFQRRSWILICLYTAFIRARYSQSTHMQSSIAQLCA
RIDSLVGAQGTPPAARQAWNSIKNGTRQFHDATEMGRYVNTGGPAKKTS*
Coding >Ophun1|1706
ATGTCGCTCCAGGAGCGGCTCCTGGCTCTGGCCAAGACGCTGCAGTTCGCCTGGTTTGTCGGGCACATGACGCTC
CTCACATCGACGCTGCGATACTTCATGTCGTGGTTGCGAATGAACTACTATAGCGGCTGGGCGCAGGGCTCGTAT
CGGGCATCATTCGCCGCCGCCATCGTCACGTACGGCATCGTCGTCTACAAGACGCAACGGGCGCGCGCCAAGATG
AACTCTAGGCCCTCGGGCGGCCTCGCTGGTCACCTCTCGGACGAAAACGTGCAATACCTGCTCATGGCCCTCGTC
TGGCTCTTTTCCCCTCAGTATCCCCTGGCGCTGCTGCCCTATTCGGTCTACTCCATCTTTCACGTCGCCACCTAC
ACTCGCACCAACCTCATCCCCGCCTGCCAAGCGCCTCCACCGCCCGCCGCCGACGGCTCCGCTCGGCCGAGGTCC
AACAGCCCGCTGGCCGATAGGATCGGAAACTTTGTCAAGGAGTACTACGAGACGTCCATGTCCGTTGTCTCGGCC
ATGGAGTTGCTCCTCTGGGTGCGCATCTTGTTCTCGGCCATTCTCTTCCAGCGCAGGTCCTGGATCCTGATTTGC
CTCTACACGGCCTTTATCCGCGCCCGCTACTCGCAGAGCACCCACATGCAGAGCTCGATAGCCCAGCTCTGCGCC
CGCATCGACTCTCTGGTCGGCGCTCAGGGCACGCCCCCGGCTGCGCGTCAGGCTTGGAACAGCATCAAGAATGGG
ACCCGGCAGTTCCACGACGCCACCGAGATGGGTAGATATGTCAACACCGGCGGCCCGGCCAAGAAGACGTCGTGA
Transcript >Ophun1|1706
ATGTCGCTCCAGGAGCGGCTCCTGGCTCTGGCCAAGACGCTGCAGTTCGCCTGGTTTGTCGGGCACATGACGCTC
CTCACATCGACGCTGCGATACTTCATGTCGTGGTTGCGAATGAACTACTATAGCGGCTGGGCGCAGGGCTCGTAT
CGGGCATCATTCGCCGCCGCCATCGTCACGTACGGCATCGTCGTCTACAAGACGCAACGGGCGCGCGCCAAGATG
AACTCTAGGCCCTCGGGCGGCCTCGCTGGTCACCTCTCGGACGAAAACGTGCAATACCTGCTCATGGCCCTCGTC
TGGCTCTTTTCCCCTCAGTATCCCCTGGCGCTGCTGCCCTATTCGGTCTACTCCATCTTTCACGTCGCCACCTAC
ACTCGCACCAACCTCATCCCCGCCTGCCAAGCGCCTCCACCGCCCGCCGCCGACGGCTCCGCTCGGCCGAGGTCC
AACAGCCCGCTGGCCGATAGGATCGGAAACTTTGTCAAGGAGTACTACGAGACGTCCATGTCCGTTGTCTCGGCC
ATGGAGTTGCTCCTCTGGGTGCGCATCTTGTTCTCGGCCATTCTCTTCCAGCGCAGGTCCTGGATCCTGATTTGC
CTCTACACGGCCTTTATCCGCGCCCGCTACTCGCAGAGCACCCACATGCAGAGCTCGATAGCCCAGCTCTGCGCC
CGCATCGACTCTCTGGTCGGCGCTCAGGGCACGCCCCCGGCTGCGCGTCAGGCTTGGAACAGCATCAAGAATGGG
ACCCGGCAGTTCCACGACGCCACCGAGATGGGTAGATATGTCAACACCGGCGGCCCGGCCAAGAAGACGTCGTGA
Gene >Ophun1|1706
ATGTCGCTCCAGGAGCGGCTCCTGGCTCTGGCCAAGACGCTGCAGTGTACGATGGCGCCCGCCTGAACTCTCCCT
ACGTATCTCGCGTCGCTGACCTCGCTCCGTGGCTTCCAGTCGCCTGGTTTGTCGGGTACGTCTAGCTCATGGCCG
TTGCTCTTCGATGCGCTGTTTGGTTTGCTGATCAGGTTTCGCTCCTCATGACAGGCACATGACGCTCCTCACATC
GACGCTGCGATACTTCATGTCGTGGTTGCGAATGAACTACTATAGCGGCTGGGCGCAGGGCTCGTATCGGGCATC
ATTCGCCGCCGCCATCGTCACGTACGGCATCGTCGTCTACAAGACGCAACGGGCGCGCGCCAAGATGAACTCTAG
GCCCTCGGGCGGCCTCGCTGGTCACCTCTCGGACGAAAACGTGCAATACCTGCGTACGATAATCCCCACCTCGTT
ACCCCTTGTCGCTGTGGCTGACCGTCGACGTCCATCTCGTGTCTGCAGTCATGGCCCTCGTCTGGCTCTTTTCCC
CTCAGTATCCCCTGGCGCTGCTGCCCTATTCGGTCTACTCCATCTTTCACGTCGCCACCTACACTCGCACCAACC
TCATCCCCGCCTGCCAAGCGCCTCCACCGCCCGCCGCCGACGGCTCCGCTCGGCCGAGGTCCAACAGCCCGCTGG
CCGATAGGATCGGAAACTTTGTCAAGGAGTACTACGAGACGTCCATGTCCGTTGTCTCGGCCATGGAGTTGCTCC
TCTGGGTGCGCATCTTGTTCTCGGCCATTCTCTTCCAGCGCAGGTCCTGGATCCTGATTTGCCTCTACACGGCCT
TTATCCGCGCCCGCTACTCGCAGAGCACCCACATGCAGAGCTCGATAGCCCAGCTCTGCGCCCGCATCGACTCTC
TGGTCGGCGCTCAGGGCACGCCCCCGGCTGCGCGTCAGGCTTGGAACAGCATCAAGAATGGGACCCGGCAGTTCC
ACGACGCCACCGAGATGGGTAGATATGTCAACACCGGCGGCCCGGCCAAGAAGACGTCGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail