Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|1695
Gene name
LocationContig_173:18088..19587
Strand+
Gene length (bp)1499
Transcript length (bp)1365
Coding sequence length (bp)1365
Protein length (aa) 455

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05730 CFEM CFEM domain 4.6E-11 35 95

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 15 0.45

Transmembrane Domains

Domain # Start End Length
1 104 126 22
2 141 158 17
3 186 208 22
4 218 240 22
5 271 293 22
6 303 321 18

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|1695
MRLAMLAVVGLAAATDESLWPRASNDSNAIAAMLPMYPACAQPCIATALANSPCLDTRCICMDQEYRRQVRTCVK
ASCRIREAMQSKNRTEHACQRPRRDKTSSFTAMSISIAAVAYVIVAARLIFKQFFSQGRRLGVDDWLVLAGAVAG
ICCTVINVRGLSRHGLGKDVWTLEAETISDFKLDFYLVALFYIIMTIVAKAAINFFYLSIFPGERTRLLLWCTAV
FILSFGMASLLVGIFQCRPVAFYWKMYRPKQDAKAGSCVNIHVATYVNGGINIALNIWLIMVPLVIIGKLELHWK
KKLGVIIMFLIGVFDTVVSILRLRSIVHFGNSWNPTWDQFDIAWWSVIETNVALICSSLPTMRLILVLVFPRVFS
TIRNKTASTTSSSTVPRKNGSVDKNAPRMTTMSLDIIEAQNVPRDEYEDDDQATNNNHEKASQAEDGRNSLSIEI
ANTR*
Coding >Ophun1|1695
ATGAGGTTGGCAATGCTGGCCGTCGTCGGATTGGCGGCCGCCACGGACGAGTCGCTGTGGCCGAGGGCCTCCAAC
GACAGCAATGCCATTGCCGCGATGCTGCCCATGTATCCGGCCTGCGCGCAACCGTGTATTGCGACGGCATTGGCG
AATAGCCCCTGTTTGGACACGCGGTGTATCTGTATGGATCAGGAGTATCGACGTCAGGTGCGGACTTGCGTCAAG
GCTTCGTGCCGGATTCGCGAGGCTATGCAATCCAAGAACAGGACCGAACACGCCTGCCAACGCCCCCGTCGCGAC
AAAACCTCGAGCTTCACAGCCATGAGCATCTCCATCGCGGCCGTCGCCTACGTCATCGTGGCCGCCCGCCTCATC
TTCAAGCAATTCTTCAGCCAGGGGCGAAGACTCGGTGTCGACGACTGGCTCGTTCTCGCCGGAGCCGTGGCGGGA
ATCTGCTGTACCGTCATCAACGTCCGGGGCCTGAGTCGCCATGGCCTCGGAAAGGACGTGTGGACGCTCGAGGCT
GAGACGATATCGGACTTTAAGCTGGATTTCTATCTGGTTGCCTTGTTCTACATCATCATGACCATTGTTGCCAAG
GCGGCCATCAACTTCTTTTACCTGTCCATCTTTCCGGGGGAGCGGACGAGGCTGCTTCTCTGGTGCACGGCCGTC
TTCATCCTCAGCTTTGGCATGGCCTCTCTCTTGGTGGGCATCTTTCAGTGTCGGCCCGTGGCGTTTTACTGGAAG
ATGTATCGCCCGAAACAAGACGCCAAGGCCGGATCATGCGTCAACATCCACGTCGCCACCTATGTCAACGGCGGC
ATCAACATCGCACTCAACATCTGGCTCATCATGGTCCCGCTCGTCATCATCGGCAAGCTGGAACTCCACTGGAAG
AAGAAGCTGGGCGTAATCATCATGTTCCTAATAGGCGTCTTCGACACCGTCGTCTCCATCCTGCGACTGCGATCC
ATCGTCCACTTTGGCAACTCGTGGAATCCGACCTGGGATCAGTTTGATATCGCCTGGTGGTCCGTCATCGAGACC
AATGTCGCCCTCATCTGCTCCAGTCTTCCCACCATGCGTCTCATCCTCGTCCTCGTCTTCCCGCGTGTGTTTAGC
ACCATTCGCAACAAGACGGCTTCGACGACTTCGTCTTCTACCGTTCCTCGAAAGAATGGCTCCGTCGATAAGAAT
GCTCCTCGCATGACGACGATGAGCCTTGACATCATCGAAGCTCAAAACGTACCGCGAGACGAATATGAAGACGAC
GACCAGGCAACCAACAACAACCATGAAAAAGCAAGCCAAGCCGAAGACGGACGAAACTCTTTATCCATTGAAATT
GCCAACACGAGGTAA
Transcript >Ophun1|1695
ATGAGGTTGGCAATGCTGGCCGTCGTCGGATTGGCGGCCGCCACGGACGAGTCGCTGTGGCCGAGGGCCTCCAAC
GACAGCAATGCCATTGCCGCGATGCTGCCCATGTATCCGGCCTGCGCGCAACCGTGTATTGCGACGGCATTGGCG
AATAGCCCCTGTTTGGACACGCGGTGTATCTGTATGGATCAGGAGTATCGACGTCAGGTGCGGACTTGCGTCAAG
GCTTCGTGCCGGATTCGCGAGGCTATGCAATCCAAGAACAGGACCGAACACGCCTGCCAACGCCCCCGTCGCGAC
AAAACCTCGAGCTTCACAGCCATGAGCATCTCCATCGCGGCCGTCGCCTACGTCATCGTGGCCGCCCGCCTCATC
TTCAAGCAATTCTTCAGCCAGGGGCGAAGACTCGGTGTCGACGACTGGCTCGTTCTCGCCGGAGCCGTGGCGGGA
ATCTGCTGTACCGTCATCAACGTCCGGGGCCTGAGTCGCCATGGCCTCGGAAAGGACGTGTGGACGCTCGAGGCT
GAGACGATATCGGACTTTAAGCTGGATTTCTATCTGGTTGCCTTGTTCTACATCATCATGACCATTGTTGCCAAG
GCGGCCATCAACTTCTTTTACCTGTCCATCTTTCCGGGGGAGCGGACGAGGCTGCTTCTCTGGTGCACGGCCGTC
TTCATCCTCAGCTTTGGCATGGCCTCTCTCTTGGTGGGCATCTTTCAGTGTCGGCCCGTGGCGTTTTACTGGAAG
ATGTATCGCCCGAAACAAGACGCCAAGGCCGGATCATGCGTCAACATCCACGTCGCCACCTATGTCAACGGCGGC
ATCAACATCGCACTCAACATCTGGCTCATCATGGTCCCGCTCGTCATCATCGGCAAGCTGGAACTCCACTGGAAG
AAGAAGCTGGGCGTAATCATCATGTTCCTAATAGGCGTCTTCGACACCGTCGTCTCCATCCTGCGACTGCGATCC
ATCGTCCACTTTGGCAACTCGTGGAATCCGACCTGGGATCAGTTTGATATCGCCTGGTGGTCCGTCATCGAGACC
AATGTCGCCCTCATCTGCTCCAGTCTTCCCACCATGCGTCTCATCCTCGTCCTCGTCTTCCCGCGTGTGTTTAGC
ACCATTCGCAACAAGACGGCTTCGACGACTTCGTCTTCTACCGTTCCTCGAAAGAATGGCTCCGTCGATAAGAAT
GCTCCTCGCATGACGACGATGAGCCTTGACATCATCGAAGCTCAAAACGTACCGCGAGACGAATATGAAGACGAC
GACCAGGCAACCAACAACAACCATGAAAAAGCAAGCCAAGCCGAAGACGGACGAAACTCTTTATCCATTGAAATT
GCCAACACGAGGTAA
Gene >Ophun1|1695
ATGAGGTTGGCAATGCTGGCCGTCGTCGGATTGGCGGCCGCCACGGACGAGTCGCTGTGGCCGAGGGCCTCCAAC
GACAGCAATGCCATTGCCGCGATGCTGCCCATGTATCCGGCCTGCGCGGTGAGTCGAGGACTGGGCATCCATCCA
AGAGGGGATTTGTTGCTGACGGGGGTTTGTTGCCAGCAACCGTGTATTGCGACGGCATTGGCGAATAGCCCCTGT
TTGGACACGCGGTGTATCTGTATGGATCAGGAGTATCGACGTCAGGTGCGGACTTGCGTCAAGGCTTCGTGCCGG
ATTCGCGAGGCTATGCGTGAGTTGGATGGCTTCTTCGGTCTGCGAATACACCAAGAGTCAATGGCTAAACATCAA
GATGGGATACAGAATCCAAGAACAGGACCGAACACGCCTGCCAACGCCCCCGTCGCGACAAAACCTCGAGCTTCA
CAGCCATGAGCATCTCCATCGCGGCCGTCGCCTACGTCATCGTGGCCGCCCGCCTCATCTTCAAGCAATTCTTCA
GCCAGGGGCGAAGACTCGGTGTCGACGACTGGCTCGTTCTCGCCGGAGCCGTGGCGGGAATCTGCTGTACCGTCA
TCAACGTCCGGGGCCTGAGTCGCCATGGCCTCGGAAAGGACGTGTGGACGCTCGAGGCTGAGACGATATCGGACT
TTAAGCTGGATTTCTATCTGGTTGCCTTGTTCTACATCATCATGACCATTGTTGCCAAGGCGGCCATCAACTTCT
TTTACCTGTCCATCTTTCCGGGGGAGCGGACGAGGCTGCTTCTCTGGTGCACGGCCGTCTTCATCCTCAGCTTTG
GCATGGCCTCTCTCTTGGTGGGCATCTTTCAGTGTCGGCCCGTGGCGTTTTACTGGAAGATGTATCGCCCGAAAC
AAGACGCCAAGGCCGGATCATGCGTCAACATCCACGTCGCCACCTATGTCAACGGCGGCATCAACATCGCACTCA
ACATCTGGCTCATCATGGTCCCGCTCGTCATCATCGGCAAGCTGGAACTCCACTGGAAGAAGAAGCTGGGCGTAA
TCATCATGTTCCTAATAGGCGTCTTCGACACCGTCGTCTCCATCCTGCGACTGCGATCCATCGTCCACTTTGGCA
ACTCGTGGAATCCGACCTGGGATCAGTTTGATATCGCCTGGTGGTCCGTCATCGAGACCAATGTCGCCCTCATCT
GCTCCAGTCTTCCCACCATGCGTCTCATCCTCGTCCTCGTCTTCCCGCGTGTGTTTAGCACCATTCGCAACAAGA
CGGCTTCGACGACTTCGTCTTCTACCGTTCCTCGAAAGAATGGCTCCGTCGATAAGAATGCTCCTCGCATGACGA
CGATGAGCCTTGACATCATCGAAGCTCAAAACGTACCGCGAGACGAATATGAAGACGACGACCAGGCAACCAACA
ACAACCATGAAAAAGCAAGCCAAGCCGAAGACGGACGAAACTCTTTATCCATTGAAATTGCCAACACGAGGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail