Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|1695
Gene name
LocationContig_173:18088..19587
Strand+
Gene length (bp)1499
Transcript length (bp)1365
Coding sequence length (bp)1365
Protein length (aa) 455

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05730 CFEM CFEM domain 4.6E-11 35 95

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

SignalP signal predicted Location Score
Yes 1 - 14 0.999704

Transmembrane Domains

Domain # Start End Length
1 104 126 22
2 141 158 17
3 186 208 22
4 218 240 22
5 271 293 22
6 303 321 18

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup253
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2781
Ophiocordyceps australis 1348a (Ghana) OphauG2|5755
Ophiocordyceps australis map64 (Brazil) OphauB2|3449
Ophiocordyceps australis map64 (Brazil) OphauB2|7166
Ophiocordyceps camponoti-floridani Ophcf2|02691
Ophiocordyceps camponoti-floridani Ophcf2|05917
Ophiocordyceps camponoti-rufipedis Ophun1|1695 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|4829
Ophiocordyceps kimflemingae Ophio5|1104
Ophiocordyceps kimflemingae Ophio5|5232
Ophiocordyceps subramaniannii Hirsu2|815
Ophiocordyceps subramaniannii Hirsu2|8476

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|1695
MRLAMLAVVGLAAATDESLWPRASNDSNAIAAMLPMYPACAQPCIATALANSPCLDTRCICMDQEYRRQVRTCVK
ASCRIREAMQSKNRTEHACQRPRRDKTSSFTAMSISIAAVAYVIVAARLIFKQFFSQGRRLGVDDWLVLAGAVAG
ICCTVINVRGLSRHGLGKDVWTLEAETISDFKLDFYLVALFYIIMTIVAKAAINFFYLSIFPGERTRLLLWCTAV
FILSFGMASLLVGIFQCRPVAFYWKMYRPKQDAKAGSCVNIHVATYVNGGINIALNIWLIMVPLVIIGKLELHWK
KKLGVIIMFLIGVFDTVVSILRLRSIVHFGNSWNPTWDQFDIAWWSVIETNVALICSSLPTMRLILVLVFPRVFS
TIRNKTASTTSSSTVPRKNGSVDKNAPRMTTMSLDIIEAQNVPRDEYEDDDQATNNNHEKASQAEDGRNSLSIEI
ANTR*
Coding >Ophun1|1695
ATGAGGTTGGCAATGCTGGCCGTCGTCGGATTGGCGGCCGCCACGGACGAGTCGCTGTGGCCGAGGGCCTCCAAC
GACAGCAATGCCATTGCCGCGATGCTGCCCATGTATCCGGCCTGCGCGCAACCGTGTATTGCGACGGCATTGGCG
AATAGCCCCTGTTTGGACACGCGGTGTATCTGTATGGATCAGGAGTATCGACGTCAGGTGCGGACTTGCGTCAAG
GCTTCGTGCCGGATTCGCGAGGCTATGCAATCCAAGAACAGGACCGAACACGCCTGCCAACGCCCCCGTCGCGAC
AAAACCTCGAGCTTCACAGCCATGAGCATCTCCATCGCGGCCGTCGCCTACGTCATCGTGGCCGCCCGCCTCATC
TTCAAGCAATTCTTCAGCCAGGGGCGAAGACTCGGTGTCGACGACTGGCTCGTTCTCGCCGGAGCCGTGGCGGGA
ATCTGCTGTACCGTCATCAACGTCCGGGGCCTGAGTCGCCATGGCCTCGGAAAGGACGTGTGGACGCTCGAGGCT
GAGACGATATCGGACTTTAAGCTGGATTTCTATCTGGTTGCCTTGTTCTACATCATCATGACCATTGTTGCCAAG
GCGGCCATCAACTTCTTTTACCTGTCCATCTTTCCGGGGGAGCGGACGAGGCTGCTTCTCTGGTGCACGGCCGTC
TTCATCCTCAGCTTTGGCATGGCCTCTCTCTTGGTGGGCATCTTTCAGTGTCGGCCCGTGGCGTTTTACTGGAAG
ATGTATCGCCCGAAACAAGACGCCAAGGCCGGATCATGCGTCAACATCCACGTCGCCACCTATGTCAACGGCGGC
ATCAACATCGCACTCAACATCTGGCTCATCATGGTCCCGCTCGTCATCATCGGCAAGCTGGAACTCCACTGGAAG
AAGAAGCTGGGCGTAATCATCATGTTCCTAATAGGCGTCTTCGACACCGTCGTCTCCATCCTGCGACTGCGATCC
ATCGTCCACTTTGGCAACTCGTGGAATCCGACCTGGGATCAGTTTGATATCGCCTGGTGGTCCGTCATCGAGACC
AATGTCGCCCTCATCTGCTCCAGTCTTCCCACCATGCGTCTCATCCTCGTCCTCGTCTTCCCGCGTGTGTTTAGC
ACCATTCGCAACAAGACGGCTTCGACGACTTCGTCTTCTACCGTTCCTCGAAAGAATGGCTCCGTCGATAAGAAT
GCTCCTCGCATGACGACGATGAGCCTTGACATCATCGAAGCTCAAAACGTACCGCGAGACGAATATGAAGACGAC
GACCAGGCAACCAACAACAACCATGAAAAAGCAAGCCAAGCCGAAGACGGACGAAACTCTTTATCCATTGAAATT
GCCAACACGAGGTAA
Transcript >Ophun1|1695
ATGAGGTTGGCAATGCTGGCCGTCGTCGGATTGGCGGCCGCCACGGACGAGTCGCTGTGGCCGAGGGCCTCCAAC
GACAGCAATGCCATTGCCGCGATGCTGCCCATGTATCCGGCCTGCGCGCAACCGTGTATTGCGACGGCATTGGCG
AATAGCCCCTGTTTGGACACGCGGTGTATCTGTATGGATCAGGAGTATCGACGTCAGGTGCGGACTTGCGTCAAG
GCTTCGTGCCGGATTCGCGAGGCTATGCAATCCAAGAACAGGACCGAACACGCCTGCCAACGCCCCCGTCGCGAC
AAAACCTCGAGCTTCACAGCCATGAGCATCTCCATCGCGGCCGTCGCCTACGTCATCGTGGCCGCCCGCCTCATC
TTCAAGCAATTCTTCAGCCAGGGGCGAAGACTCGGTGTCGACGACTGGCTCGTTCTCGCCGGAGCCGTGGCGGGA
ATCTGCTGTACCGTCATCAACGTCCGGGGCCTGAGTCGCCATGGCCTCGGAAAGGACGTGTGGACGCTCGAGGCT
GAGACGATATCGGACTTTAAGCTGGATTTCTATCTGGTTGCCTTGTTCTACATCATCATGACCATTGTTGCCAAG
GCGGCCATCAACTTCTTTTACCTGTCCATCTTTCCGGGGGAGCGGACGAGGCTGCTTCTCTGGTGCACGGCCGTC
TTCATCCTCAGCTTTGGCATGGCCTCTCTCTTGGTGGGCATCTTTCAGTGTCGGCCCGTGGCGTTTTACTGGAAG
ATGTATCGCCCGAAACAAGACGCCAAGGCCGGATCATGCGTCAACATCCACGTCGCCACCTATGTCAACGGCGGC
ATCAACATCGCACTCAACATCTGGCTCATCATGGTCCCGCTCGTCATCATCGGCAAGCTGGAACTCCACTGGAAG
AAGAAGCTGGGCGTAATCATCATGTTCCTAATAGGCGTCTTCGACACCGTCGTCTCCATCCTGCGACTGCGATCC
ATCGTCCACTTTGGCAACTCGTGGAATCCGACCTGGGATCAGTTTGATATCGCCTGGTGGTCCGTCATCGAGACC
AATGTCGCCCTCATCTGCTCCAGTCTTCCCACCATGCGTCTCATCCTCGTCCTCGTCTTCCCGCGTGTGTTTAGC
ACCATTCGCAACAAGACGGCTTCGACGACTTCGTCTTCTACCGTTCCTCGAAAGAATGGCTCCGTCGATAAGAAT
GCTCCTCGCATGACGACGATGAGCCTTGACATCATCGAAGCTCAAAACGTACCGCGAGACGAATATGAAGACGAC
GACCAGGCAACCAACAACAACCATGAAAAAGCAAGCCAAGCCGAAGACGGACGAAACTCTTTATCCATTGAAATT
GCCAACACGAGGTAA
Gene >Ophun1|1695
ATGAGGTTGGCAATGCTGGCCGTCGTCGGATTGGCGGCCGCCACGGACGAGTCGCTGTGGCCGAGGGCCTCCAAC
GACAGCAATGCCATTGCCGCGATGCTGCCCATGTATCCGGCCTGCGCGGTGAGTCGAGGACTGGGCATCCATCCA
AGAGGGGATTTGTTGCTGACGGGGGTTTGTTGCCAGCAACCGTGTATTGCGACGGCATTGGCGAATAGCCCCTGT
TTGGACACGCGGTGTATCTGTATGGATCAGGAGTATCGACGTCAGGTGCGGACTTGCGTCAAGGCTTCGTGCCGG
ATTCGCGAGGCTATGCGTGAGTTGGATGGCTTCTTCGGTCTGCGAATACACCAAGAGTCAATGGCTAAACATCAA
GATGGGATACAGAATCCAAGAACAGGACCGAACACGCCTGCCAACGCCCCCGTCGCGACAAAACCTCGAGCTTCA
CAGCCATGAGCATCTCCATCGCGGCCGTCGCCTACGTCATCGTGGCCGCCCGCCTCATCTTCAAGCAATTCTTCA
GCCAGGGGCGAAGACTCGGTGTCGACGACTGGCTCGTTCTCGCCGGAGCCGTGGCGGGAATCTGCTGTACCGTCA
TCAACGTCCGGGGCCTGAGTCGCCATGGCCTCGGAAAGGACGTGTGGACGCTCGAGGCTGAGACGATATCGGACT
TTAAGCTGGATTTCTATCTGGTTGCCTTGTTCTACATCATCATGACCATTGTTGCCAAGGCGGCCATCAACTTCT
TTTACCTGTCCATCTTTCCGGGGGAGCGGACGAGGCTGCTTCTCTGGTGCACGGCCGTCTTCATCCTCAGCTTTG
GCATGGCCTCTCTCTTGGTGGGCATCTTTCAGTGTCGGCCCGTGGCGTTTTACTGGAAGATGTATCGCCCGAAAC
AAGACGCCAAGGCCGGATCATGCGTCAACATCCACGTCGCCACCTATGTCAACGGCGGCATCAACATCGCACTCA
ACATCTGGCTCATCATGGTCCCGCTCGTCATCATCGGCAAGCTGGAACTCCACTGGAAGAAGAAGCTGGGCGTAA
TCATCATGTTCCTAATAGGCGTCTTCGACACCGTCGTCTCCATCCTGCGACTGCGATCCATCGTCCACTTTGGCA
ACTCGTGGAATCCGACCTGGGATCAGTTTGATATCGCCTGGTGGTCCGTCATCGAGACCAATGTCGCCCTCATCT
GCTCCAGTCTTCCCACCATGCGTCTCATCCTCGTCCTCGTCTTCCCGCGTGTGTTTAGCACCATTCGCAACAAGA
CGGCTTCGACGACTTCGTCTTCTACCGTTCCTCGAAAGAATGGCTCCGTCGATAAGAATGCTCCTCGCATGACGA
CGATGAGCCTTGACATCATCGAAGCTCAAAACGTACCGCGAGACGAATATGAAGACGACGACCAGGCAACCAACA
ACAACCATGAAAAAGCAAGCCAAGCCGAAGACGGACGAAACTCTTTATCCATTGAAATTGCCAACACGAGGTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail