Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|1687
Gene name
LocationContig_1727:310..1050
Strand+
Gene length (bp)740
Transcript length (bp)309
Coding sequence length (bp)309
Protein length (aa) 103

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05336 rhaM L-rhamnose mutarotase 1.3E-30 7 93

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|B1YMY7|RHAM_BURA4 L-rhamnose mutarotase OS=Burkholderia ambifaria (strain MC40-6) GN=rhaM PE=3 SV=1 14 84 1.0E-10
sp|C3MFZ6|RHAM_RHISN L-rhamnose mutarotase OS=Rhizobium sp. (strain NGR234) GN=rhaM PE=3 SV=1 5 93 1.0E-10
sp|A6KWR4|RHAM_BACV8 L-rhamnose mutarotase OS=Bacteroides vulgatus (strain ATCC 8482 / DSM 1447 / NCTC 11154) GN=rhaM PE=3 SV=1 5 85 2.0E-10
sp|Q8A044|RHAM_BACTN L-rhamnose mutarotase OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=rhaM PE=3 SV=1 5 85 6.0E-10
sp|Q1WRE3|RHAM_LACS1 L-rhamnose mutarotase OS=Lactobacillus salivarius (strain UCC118) GN=rhaM PE=3 SV=1 7 84 5.0E-09
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|B1YMY7|RHAM_BURA4 L-rhamnose mutarotase OS=Burkholderia ambifaria (strain MC40-6) GN=rhaM PE=3 SV=1 14 84 1.0E-10
sp|C3MFZ6|RHAM_RHISN L-rhamnose mutarotase OS=Rhizobium sp. (strain NGR234) GN=rhaM PE=3 SV=1 5 93 1.0E-10
sp|A6KWR4|RHAM_BACV8 L-rhamnose mutarotase OS=Bacteroides vulgatus (strain ATCC 8482 / DSM 1447 / NCTC 11154) GN=rhaM PE=3 SV=1 5 85 2.0E-10
sp|Q8A044|RHAM_BACTN L-rhamnose mutarotase OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=rhaM PE=3 SV=1 5 85 6.0E-10
sp|Q1WRE3|RHAM_LACS1 L-rhamnose mutarotase OS=Lactobacillus salivarius (strain UCC118) GN=rhaM PE=3 SV=1 7 84 5.0E-09
sp|B1Y3E6|RHAM_LEPCP L-rhamnose mutarotase OS=Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6) GN=rhaM PE=3 SV=1 4 85 5.0E-09
sp|A5FC30|RHAM_FLAJ1 L-rhamnose mutarotase OS=Flavobacterium johnsoniae (strain ATCC 17061 / DSM 2064 / UW101) GN=rhaM PE=3 SV=1 7 84 6.0E-09
sp|A5G2T9|RHAM_ACICJ L-rhamnose mutarotase OS=Acidiphilium cryptum (strain JF-5) GN=rhaM PE=3 SV=1 12 86 6.0E-09
sp|B1KAV4|RHAM_BURCC L-rhamnose mutarotase OS=Burkholderia cenocepacia (strain MC0-3) GN=rhaM PE=3 SV=1 12 84 7.0E-09
sp|Q0BA68|RHAM_BURCM L-rhamnose mutarotase OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=rhaM PE=3 SV=2 12 84 8.0E-09
sp|Q92S07|RHAM_RHIME L-rhamnose mutarotase OS=Rhizobium meliloti (strain 1021) GN=rhaM PE=3 SV=1 5 84 1.0E-08
sp|Q88S50|RHAM_LACPL L-rhamnose mutarotase OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=rhaM PE=3 SV=1 7 93 2.0E-08
sp|Q8ESX3|RHAM_OCEIH L-rhamnose mutarotase OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=rhaM PE=3 SV=1 5 85 2.0E-08
sp|A0KDV0|RHAM_BURCH L-rhamnose mutarotase OS=Burkholderia cenocepacia (strain HI2424) GN=rhaM PE=3 SV=1 12 84 2.0E-08
sp|Q1BGJ2|RHAM_BURCA L-rhamnose mutarotase OS=Burkholderia cenocepacia (strain AU 1054) GN=rhaM PE=3 SV=1 12 84 2.0E-08
sp|B2JLI5|RHAM_BURP8 L-rhamnose mutarotase OS=Burkholderia phymatum (strain DSM 17167 / STM815) GN=rhaM PE=3 SV=1 20 85 5.0E-08
sp|A4WGA0|RHAM_ENT38 L-rhamnose mutarotase OS=Enterobacter sp. (strain 638) GN=rhaM PE=3 SV=1 7 85 9.0E-08
sp|O05263|RHAM_BACSU L-rhamnose mutarotase OS=Bacillus subtilis (strain 168) GN=rhaM PE=3 SV=1 5 98 1.0E-07
sp|B7M6V3|RHAM_ECO8A L-rhamnose mutarotase OS=Escherichia coli O8 (strain IAI1) GN=rhaM PE=3 SV=1 7 85 1.0E-07
sp|B2TFM4|RHAM_BURPP L-rhamnose mutarotase OS=Burkholderia phytofirmans (strain DSM 17436 / PsJN) GN=rhaM PE=3 SV=1 14 85 3.0E-07
sp|A6U608|RHAM_SINMW L-rhamnose mutarotase OS=Sinorhizobium medicae (strain WSM419) GN=rhaM PE=3 SV=1 5 84 3.0E-07
sp|Q6DA26|RHAM_PECAS L-rhamnose mutarotase OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=rhaM PE=3 SV=1 7 85 3.0E-07
sp|Q13LW8|RHAM_BURXL L-rhamnose mutarotase OS=Burkholderia xenovorans (strain LB400) GN=rhaM PE=3 SV=1 14 85 4.0E-07
sp|Q83IU5|RHAM_SHIFL L-rhamnose mutarotase OS=Shigella flexneri GN=rhaM PE=3 SV=1 7 85 4.0E-07
sp|Q0SZ91|RHAM_SHIF8 L-rhamnose mutarotase OS=Shigella flexneri serotype 5b (strain 8401) GN=rhaM PE=3 SV=1 7 85 4.0E-07
sp|A1WJR4|RHAM_VEREI L-rhamnose mutarotase OS=Verminephrobacter eiseniae (strain EF01-2) GN=rhaM PE=3 SV=1 14 84 5.0E-07
sp|C4LCV3|RHAM_TOLAT L-rhamnose mutarotase OS=Tolumonas auensis (strain DSM 9187 / TA4) GN=rhaM PE=3 SV=1 7 84 5.0E-07
sp|Q98B72|RHAM_RHILO L-rhamnose mutarotase OS=Rhizobium loti (strain MAFF303099) GN=rhaM PE=3 SV=1 7 84 6.0E-07
sp|A7ZUB2|RHAM_ECO24 L-rhamnose mutarotase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=rhaM PE=3 SV=1 7 85 7.0E-07
sp|B7L9F7|RHAM_ECO55 L-rhamnose mutarotase OS=Escherichia coli (strain 55989 / EAEC) GN=rhaM PE=3 SV=1 7 85 7.0E-07
sp|B6I4P3|RHAM_ECOSE L-rhamnose mutarotase OS=Escherichia coli (strain SE11) GN=rhaM PE=3 SV=1 7 85 7.0E-07
sp|A1AI78|RHAM_ECOK1 L-rhamnose mutarotase OS=Escherichia coli O1:K1 / APEC GN=rhaM PE=3 SV=1 7 85 7.0E-07
sp|B1LMU1|RHAM_ECOSM L-rhamnose mutarotase OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=rhaM PE=3 SV=1 7 85 7.0E-07
sp|Q3YV75|RHAM_SHISS L-rhamnose mutarotase OS=Shigella sonnei (strain Ss046) GN=rhaM PE=3 SV=1 7 85 7.0E-07
sp|A7ML65|RHAM_CROS8 L-rhamnose mutarotase OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=rhaM PE=3 SV=1 7 85 7.0E-07
sp|B7MI33|RHAM_ECO45 L-rhamnose mutarotase OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=rhaM PE=3 SV=1 7 85 7.0E-07
sp|B7MQZ1|RHAM_ECO81 L-rhamnose mutarotase OS=Escherichia coli O81 (strain ED1a) GN=rhaM PE=3 SV=1 7 85 7.0E-07
sp|Q0TAG2|RHAM_ECOL5 L-rhamnose mutarotase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=rhaM PE=3 SV=1 7 85 7.0E-07
sp|Q8FBE2|RHAM_ECOL6 L-rhamnose mutarotase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=rhaM PE=3 SV=1 7 85 7.0E-07
sp|Q1R418|RHAM_ECOUT L-rhamnose mutarotase OS=Escherichia coli (strain UTI89 / UPEC) GN=rhaM PE=3 SV=1 7 85 7.0E-07
sp|Q8Y3I9|RHAM_LISMO L-rhamnose mutarotase OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=rhaM PE=3 SV=1 5 85 7.0E-07
sp|Q71VR6|RHAM_LISMF L-rhamnose mutarotase OS=Listeria monocytogenes serotype 4b (strain F2365) GN=rhaM PE=3 SV=1 5 85 8.0E-07
sp|B2TVP4|RHAM_SHIB3 L-rhamnose mutarotase OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=rhaM PE=3 SV=1 7 85 9.0E-07
sp|B7UNM2|RHAM_ECO27 L-rhamnose mutarotase OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=rhaM PE=3 SV=1 7 85 9.0E-07
sp|Q31U88|RHAM_SHIBS L-rhamnose mutarotase OS=Shigella boydii serotype 4 (strain Sb227) GN=rhaM PE=3 SV=1 7 85 9.0E-07
sp|B7LVE3|RHAM_ESCF3 L-rhamnose mutarotase OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=rhaM PE=3 SV=1 7 85 1.0E-06
sp|Q5WL37|RHAM_BACSK L-rhamnose mutarotase OS=Bacillus clausii (strain KSM-K16) GN=rhaM PE=3 SV=1 7 84 1.0E-06
sp|B1IVH7|RHAM_ECOLC L-rhamnose mutarotase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=rhaM PE=3 SV=1 7 85 2.0E-06
sp|Q8X8A2|RHAM_ECO57 L-rhamnose mutarotase OS=Escherichia coli O157:H7 GN=rhaM PE=3 SV=1 7 85 2.0E-06
sp|B5YZ38|RHAM_ECO5E L-rhamnose mutarotase OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=rhaM PE=3 SV=1 7 85 2.0E-06
sp|B7NFJ9|RHAM_ECOLU L-rhamnose mutarotase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=rhaM PE=3 SV=1 7 85 2.0E-06
sp|B5XZ60|RHAM_KLEP3 L-rhamnose mutarotase OS=Klebsiella pneumoniae (strain 342) GN=rhaM PE=3 SV=1 7 85 2.0E-06
sp|Q926R3|RHAM_LISIN L-rhamnose mutarotase OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=rhaM PE=3 SV=1 5 85 2.0E-06
sp|C5A069|RHAM_ECOBW L-rhamnose mutarotase OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=rhaM PE=3 SV=1 7 85 2.0E-06
sp|B1XB68|RHAM_ECODH L-rhamnose mutarotase OS=Escherichia coli (strain K12 / DH10B) GN=rhaM PE=3 SV=1 7 85 2.0E-06
sp|A8A704|RHAM_ECOHS L-rhamnose mutarotase OS=Escherichia coli O9:H4 (strain HS) GN=rhaM PE=3 SV=1 7 85 2.0E-06
sp|P32156|RHAM_ECOLI L-rhamnose mutarotase OS=Escherichia coli (strain K12) GN=rhaM PE=1 SV=1 7 85 2.0E-06
sp|A6LQL0|RHAM_CLOB8 L-rhamnose mutarotase OS=Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052) GN=rhaM PE=3 SV=1 20 93 3.0E-06
sp|A6X4W8|RHAM_OCHA4 L-rhamnose mutarotase OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=rhaM PE=3 SV=1 4 58 4.0E-06
sp|Q28P47|RHAM_JANSC L-rhamnose mutarotase OS=Jannaschia sp. (strain CCS1) GN=rhaM PE=3 SV=1 5 58 5.0E-06
sp|C6DJR0|RHAM_PECCP L-rhamnose mutarotase OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=rhaM PE=3 SV=1 7 85 6.0E-06
sp|Q32A67|RHAM_SHIDS L-rhamnose mutarotase OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=rhaM PE=3 SV=1 7 85 6.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016857 racemase and epimerase activity, acting on carbohydrates and derivatives Yes
GO:0016854 racemase and epimerase activity No
GO:0003674 molecular_function No
GO:0003824 catalytic activity No
GO:0016853 isomerase activity No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup2871
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5896
Ophiocordyceps australis map64 (Brazil) OphauB2|1055
Ophiocordyceps camponoti-floridani Ophcf2|03477
Ophiocordyceps camponoti-rufipedis Ophun1|1687 (this protein)
Ophiocordyceps kimflemingae Ophio5|3647
Ophiocordyceps subramaniannii Hirsu2|4758

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|1687
MAHTVRRFGQVVRLKPEHADEYRACHARIWPEVASRIKDCGIEDYSIWYDDGTGLLFASFKYVGGDYEGDMRRMA
ADDKVREWWEVTDRCQESLHPLLINDL*
Coding >Ophun1|1687
ATGGCGCATACCGTCCGGCGATTCGGACAGGTTGTGCGACTGAAGCCGGAGCATGCCGACGAGTACCGGGCTTGC
CATGCGCGGATCTGGCCCGAGGTGGCGAGCAGGATCAAGGACTGCGGTATCGAGGATTATAGCATCTGGTACGAC
GATGGGACGGGCCTGCTGTTCGCGTCGTTCAAGTATGTTGGCGGCGACTACGAGGGTGACATGCGGCGGATGGCG
GCGGACGACAAGGTGCGGGAGTGGTGGGAGGTGACGGATCGGTGTCAGGAGAGTTTGCATCCGCTGCTCATCAAC
GACCTGTAA
Transcript >Ophun1|1687
ATGGCGCATACCGTCCGGCGATTCGGACAGGTTGTGCGACTGAAGCCGGAGCATGCCGACGAGTACCGGGCTTGC
CATGCGCGGATCTGGCCCGAGGTGGCGAGCAGGATCAAGGACTGCGGTATCGAGGATTATAGCATCTGGTACGAC
GATGGGACGGGCCTGCTGTTCGCGTCGTTCAAGTATGTTGGCGGCGACTACGAGGGTGACATGCGGCGGATGGCG
GCGGACGACAAGGTGCGGGAGTGGTGGGAGGTGACGGATCGGTGTCAGGAGAGTTTGCATCCGCTGCTCATCAAC
GACCTGTAA
Gene >Ophun1|1687
ATGGCGCATACCGTCCGGCGATTCGGACAGGTTGTGCGACTGAAGCCGGAGCATGCCGACGAGTACCGGGCTTGC
CATGCGCGGATCTGGCCCGAGGTGGCGAGCAGGATCAAGGACTGCGGTATCGAGGATTGTGAGATTGACCTTTTG
CTTCTGACATGTTCCTACGCTTGTGTTGTTTTCCTAAGATGATGGCTAGATAGCATCTGGTACGACGATGGGACG
GGCCTGCTGTTCGCGTCGTTCAAGTATGTTGGCGGCGACTACGAGGGTGACATGCGGCGGATGGCGGCGGACGAC
AAGGTGCGGGAGTGGTGGGAGGTGACGGATCGGTGTCAGGAGAGTTTGGTGGAGGGGGCGGTTGGGTCGGGGGGG
GGTAAGGGGGGGGTGGGGGGGGAGTAAGGGGTGGTGGAAGGGGATGGAGGAGGTCTTTTACCTTGCGTAGGCTGG
TGATGGATGGGCTTGGGTTTGTTGGTTGTGAAGGGAGGATTCGTGATGTTGCTAGAAGATGTGAGCGGATATAAG
ATGACCATGTCAGCATTGGAGTACAGAGATGGAGGATGTGAACGCGCGTTCTTTGTAGATTCATCGATCTAGATG
CTTACACAGACTGTGACAGACACAAGACGGGAGATTGCCGGAACTGTTTCGTGCATCCTCTTCATTCCCCTACGG
AACCTTGAAGCAACGACGAGAGGTCACAAGCTTATTAGCATCCGCTGCTCATCAACGACCTGTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail