Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|1678
Gene name
LocationContig_172:13234..13782
Strand-
Gene length (bp)548
Transcript length (bp)411
Coding sequence length (bp)411
Protein length (aa) 137

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF16906 Ribosomal_L26 Ribosomal proteins L26 eukaryotic, L24P archaeal 9.2E-38 9 121
PF00467 KOW KOW motif 7.3E-08 52 83

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P78946|RL26_SCHPO 60S ribosomal protein L26 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rpl26 PE=3 SV=1 3 121 1.0E-53
sp|P51414|RL261_ARATH 60S ribosomal protein L26-1 OS=Arabidopsis thaliana GN=RPL26A PE=2 SV=2 3 135 1.0E-53
sp|Q9FJX2|RL262_ARATH 60S ribosomal protein L26-2 OS=Arabidopsis thaliana GN=RPL26B PE=2 SV=1 3 135 4.0E-53
sp|P05743|RL26A_YEAST 60S ribosomal protein L26-A OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPL26A PE=1 SV=3 1 121 6.0E-50
sp|P53221|RL26B_YEAST 60S ribosomal protein L26-B OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPL26B PE=1 SV=2 1 121 2.0E-49
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P78946|RL26_SCHPO 60S ribosomal protein L26 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rpl26 PE=3 SV=1 3 121 1.0E-53
sp|P51414|RL261_ARATH 60S ribosomal protein L26-1 OS=Arabidopsis thaliana GN=RPL26A PE=2 SV=2 3 135 1.0E-53
sp|Q9FJX2|RL262_ARATH 60S ribosomal protein L26-2 OS=Arabidopsis thaliana GN=RPL26B PE=2 SV=1 3 135 4.0E-53
sp|P05743|RL26A_YEAST 60S ribosomal protein L26-A OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPL26A PE=1 SV=3 1 121 6.0E-50
sp|P53221|RL26B_YEAST 60S ribosomal protein L26-B OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPL26B PE=1 SV=2 1 121 2.0E-49
sp|Q39411|RL26_BRACM 60S ribosomal protein L26 OS=Brassica campestris GN=RPL26 PE=2 SV=1 3 135 2.0E-48
sp|Q9UNX3|RL26L_HUMAN 60S ribosomal protein L26-like 1 OS=Homo sapiens GN=RPL26L1 PE=1 SV=1 3 128 8.0E-48
sp|P61255|RL26_MOUSE 60S ribosomal protein L26 OS=Mus musculus GN=Rpl26 PE=1 SV=1 3 128 9.0E-48
sp|P61256|RL26_MACFA 60S ribosomal protein L26 OS=Macaca fascicularis GN=RPL26 PE=2 SV=1 3 128 9.0E-48
sp|P61254|RL26_HUMAN 60S ribosomal protein L26 OS=Homo sapiens GN=RPL26 PE=1 SV=1 3 128 9.0E-48
sp|P61257|RL26_BOVIN 60S ribosomal protein L26 OS=Bos taurus GN=RPL26 PE=2 SV=1 3 128 9.0E-48
sp|P12749|RL26_RAT 60S ribosomal protein L26 OS=Rattus norvegicus GN=Rpl26 PE=1 SV=1 3 128 3.0E-46
sp|Q2I0I6|RL26_AILME 60S ribosomal protein L26 OS=Ailuropoda melanoleuca GN=RPL26 PE=2 SV=1 8 128 6.0E-46
sp|Q95WA0|RL26_LITLI 60S ribosomal protein L26 OS=Littorina littorea GN=RPL26 PE=2 SV=1 3 119 2.0E-45
sp|Q19869|RL26_CAEEL 60S ribosomal protein L26 OS=Caenorhabditis elegans GN=rpl-26 PE=3 SV=1 3 126 3.0E-45
sp|P47832|RL26_CHICK 60S ribosomal protein L26 (Fragment) OS=Gallus gallus GN=RPL26 PE=2 SV=1 19 128 8.0E-45
sp|Q54QM8|RL26_DICDI 60S ribosomal protein L26 OS=Dictyostelium discoideum GN=rpl26 PE=3 SV=1 3 121 9.0E-45
sp|Q23F79|RL26_TETTS 60S ribosomal protein L26 OS=Tetrahymena thermophila (strain SB210) GN=RPL26 PE=1 SV=2 8 121 2.0E-40
sp|Q5JJF9|RL24_THEKO 50S ribosomal protein L24P OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=rpl24p PE=3 SV=1 13 121 2.0E-26
sp|O59429|RL24_PYRHO 50S ribosomal protein L24P OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=rpl24p PE=3 SV=2 9 121 7.0E-26
sp|B1L777|RL24_KORCO 50S ribosomal protein L24P OS=Korarchaeum cryptofilum (strain OPF8) GN=rpl24p PE=3 SV=1 14 121 2.0E-25
sp|Q9V1U7|RL24_PYRAB 50S ribosomal protein L24P OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=rpl24p PE=3 SV=1 9 125 3.0E-25
sp|A2BMD0|RL24_HYPBU 50S ribosomal protein L24P OS=Hyperthermus butylicus (strain DSM 5456 / JCM 9403 / PLM1-5) GN=rpl24p PE=3 SV=1 9 129 8.0E-25
sp|Q8U010|RL24_PYRFU 50S ribosomal protein L24P OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=rpl24p PE=1 SV=2 9 121 1.0E-24
sp|A0B9V9|RL24_METTP 50S ribosomal protein L24P OS=Methanosaeta thermophila (strain DSM 6194 / JCM 14653 / NBRC 101360 / PT) GN=rpl24p PE=3 SV=1 8 121 7.0E-24
sp|P54038|RL24_METJA 50S ribosomal protein L24P OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=rpl24p PE=3 SV=1 4 114 8.0E-23
sp|Q8TW19|RL24_METKA 50S ribosomal protein L24P OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=rpl24p PE=3 SV=1 9 130 8.0E-23
sp|Q9YF83|RL24_AERPE 50S ribosomal protein L24P OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=rpl24p PE=3 SV=1 13 111 4.0E-22
sp|O26122|RL24_METTH 50S ribosomal protein L24P OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=rpl24p PE=3 SV=1 8 115 5.0E-22
sp|A3DNB8|RL24_STAMF 50S ribosomal protein L24P OS=Staphylothermus marinus (strain ATCC 43588 / DSM 3639 / JCM 9404 / F1) GN=rpl24p PE=3 SV=1 4 123 7.0E-22
sp|A6VGZ6|RL24_METM7 50S ribosomal protein L24P OS=Methanococcus maripaludis (strain C7 / ATCC BAA-1331) GN=rpl24p PE=3 SV=1 9 109 3.0E-21
sp|A4FWB0|RL24_METM5 50S ribosomal protein L24P OS=Methanococcus maripaludis (strain C5 / ATCC BAA-1333) GN=rpl24p PE=3 SV=1 9 109 3.0E-21
sp|A6UQ55|RL24_METVS 50S ribosomal protein L24P OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=rpl24p PE=3 SV=1 9 114 4.0E-21
sp|P14034|RL24_METVA 50S ribosomal protein L24P OS=Methanococcus vannielii GN=rpl24p PE=3 SV=1 9 114 4.0E-21
sp|A8ACD3|RL24_IGNH4 50S ribosomal protein L24P OS=Ignicoccus hospitalis (strain KIN4/I / DSM 18386 / JCM 14125) GN=rpl24p PE=3 SV=1 14 123 7.0E-21
sp|Q6LXE2|RL24_METMP 50S ribosomal protein L24P OS=Methanococcus maripaludis (strain S2 / LL) GN=rpl24p PE=3 SV=1 9 109 1.0E-20
sp|A6UWU9|RL24_META3 50S ribosomal protein L24P OS=Methanococcus aeolicus (strain Nankai-3 / ATCC BAA-1280) GN=rpl24p PE=3 SV=1 7 115 2.0E-20
sp|A1RWS4|RL24_THEPD 50S ribosomal protein L24P OS=Thermofilum pendens (strain Hrk 5) GN=rpl24p PE=3 SV=1 1 123 2.0E-20
sp|Q2NFW8|RL24_METST 50S ribosomal protein L24P OS=Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3) GN=rpl24p PE=3 SV=1 8 115 2.0E-19
sp|Q8ZTD4|RL24_PYRAE 50S ribosomal protein L24P OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=rpl24p PE=3 SV=1 4 123 8.0E-19
sp|A8MB21|RL24_CALMQ 50S ribosomal protein L24P OS=Caldivirga maquilingensis (strain ATCC 700844 / DSM 13496 / JCM 10307 / IC-167) GN=rpl24p PE=3 SV=1 9 130 1.0E-18
sp|A4WLL3|RL24_PYRAR 50S ribosomal protein L24P OS=Pyrobaculum arsenaticum (strain DSM 13514 / JCM 11321) GN=rpl24p PE=3 SV=1 7 123 2.0E-18
sp|A3MWZ8|RL24_PYRCJ 50S ribosomal protein L24P OS=Pyrobaculum calidifontis (strain JCM 11548 / VA1) GN=rpl24p PE=3 SV=1 7 127 2.0E-18
sp|Q8PV39|RL24_METMA 50S ribosomal protein L24P OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=rpl24p PE=3 SV=1 1 115 6.0E-18
sp|Q12ZU0|RL24_METBU 50S ribosomal protein L24P OS=Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M) GN=rpl24p PE=3 SV=1 8 123 1.0E-17
sp|Q975J1|RL24_SULTO 50S ribosomal protein L24P OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=rpl24p PE=3 SV=2 8 135 3.0E-17
sp|O05633|RL24_SULAC 50S ribosomal protein L24P OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=rpl24p PE=3 SV=2 8 127 5.0E-17
sp|A5UL77|RL24_METS3 50S ribosomal protein L24P OS=Methanobrevibacter smithii (strain PS / ATCC 35061 / DSM 861) GN=rpl24p PE=3 SV=1 8 104 7.0E-17
sp|Q2FT34|RL24_METHJ 50S ribosomal protein L24P OS=Methanospirillum hungatei JF-1 (strain ATCC 27890 / DSM 864 / NBRC 100397 / JF-1) GN=rpl24p PE=3 SV=1 8 120 1.0E-16
sp|Q46GA6|RL24_METBF 50S ribosomal protein L24P OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=rpl24p PE=3 SV=1 8 115 1.0E-16
sp|A4YCX7|RL24_METS5 50S ribosomal protein L24P OS=Metallosphaera sedula (strain ATCC 51363 / DSM 5348) GN=rpl24p PE=3 SV=1 31 121 1.0E-16
sp|Q8TRT6|RL24_METAC 50S ribosomal protein L24P OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=rpl24p PE=3 SV=1 8 115 3.0E-16
sp|A3CT08|RL24_METMJ 50S ribosomal protein L24P OS=Methanoculleus marisnigri (strain ATCC 35101 / DSM 1498 / JR1) GN=rpl24p PE=3 SV=1 8 120 5.0E-16
sp|O28365|RL24_ARCFU 50S ribosomal protein L24P OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=rpl24p PE=3 SV=1 12 121 7.0E-16
sp|Q18GG0|RL24_HALWD 50S ribosomal protein L24P OS=Haloquadratum walsbyi (strain DSM 16790 / HBSQ001) GN=rpl24p PE=3 SV=1 8 127 1.0E-15
sp|P10972|RL24_HALMA 50S ribosomal protein L24P OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=rpl24p PE=1 SV=3 14 115 6.0E-15
sp|P41960|RL26_BRUPA 60S ribosomal protein L26 (Fragment) OS=Brugia pahangi PE=2 SV=1 3 61 1.0E-14
sp|A7I5Q0|RL24_METB6 50S ribosomal protein L24P OS=Methanoregula boonei (strain 6A8) GN=rpl24p PE=3 SV=1 9 115 1.0E-14
sp|Q9UX95|RL24_SULSO 50S ribosomal protein L24P OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=rpl24p PE=3 SV=1 14 123 2.0E-14
sp|A1RS05|RL24_PYRIL 50S ribosomal protein L24P OS=Pyrobaculum islandicum (strain DSM 4184 / JCM 9189 / GEO3) GN=rpl24p PE=3 SV=1 7 123 2.0E-13
sp|A2SPL3|RL24_METLZ 50S ribosomal protein L24P OS=Methanocorpusculum labreanum (strain ATCC 43576 / DSM 4855 / Z) GN=rpl24p PE=3 SV=1 1 109 5.0E-13
sp|Q6L1B6|RL24_PICTO 50S ribosomal protein L24P OS=Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828) GN=rpl24p PE=3 SV=1 35 111 6.0E-13
sp|Q3IMX7|RL24_NATPD 50S ribosomal protein L24P OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=rpl24p PE=3 SV=1 14 114 8.0E-13
sp|P60663|RL24_NANEQ 50S ribosomal protein L24P OS=Nanoarchaeum equitans (strain Kin4-M) GN=rpl24p PE=3 SV=1 9 119 1.0E-12
sp|Q0W1X7|RL24_METAR 50S ribosomal protein L24P OS=Methanocella arvoryzae (strain DSM 22066 / NBRC 105507 / MRE50) GN=rpl24p PE=3 SV=1 1 112 1.0E-11
sp|Q9HPC3|RL24_HALSA 50S ribosomal protein L24P OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=rpl24p PE=3 SV=1 33 114 2.0E-11
sp|P60746|RL24_THEAC 50S ribosomal protein L24P OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=rpl24p PE=3 SV=1 31 117 3.0E-11
sp|A9A5I4|RL24_NITMS 50S ribosomal protein L24P OS=Nitrosopumilus maritimus (strain SCM1) GN=rpl24p PE=3 SV=1 31 109 4.0E-11
sp|Q97BW5|RL24_THEVO 50S ribosomal protein L24P OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=rpl24p PE=3 SV=1 31 111 2.0E-10
sp|A0RVY4|RL24_CENSY 50S ribosomal protein L24P OS=Cenarchaeum symbiosum (strain A) GN=rpl24p PE=3 SV=1 20 109 6.0E-10
sp|P49629|RL26_XENLA 60S ribosomal protein L26 (Fragment) OS=Xenopus laevis GN=rpl26 PE=2 SV=1 23 55 2.0E-09
[Show less]

GO

GO Term Description Terminal node
GO:0003735 structural constituent of ribosome Yes
GO:0006412 translation Yes
GO:0015934 large ribosomal subunit Yes
GO:0044391 ribosomal subunit No
GO:1901576 organic substance biosynthetic process No
GO:0044271 cellular nitrogen compound biosynthetic process No
GO:0044260 cellular macromolecule metabolic process No
GO:0032991 protein-containing complex No
GO:0043043 peptide biosynthetic process No
GO:0006518 peptide metabolic process No
GO:0019538 protein metabolic process No
GO:0008152 metabolic process No
GO:0009058 biosynthetic process No
GO:0009987 cellular process No
GO:0005198 structural molecule activity No
GO:0044238 primary metabolic process No
GO:0044237 cellular metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0005575 cellular_component No
GO:0044249 cellular biosynthetic process No
GO:0003674 molecular_function No
GO:1990904 ribonucleoprotein complex No
GO:0034641 cellular nitrogen compound metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:1901566 organonitrogen compound biosynthetic process No
GO:0008150 biological_process No
GO:0009059 macromolecule biosynthetic process No
GO:0071704 organic substance metabolic process No
GO:0034645 cellular macromolecule biosynthetic process No
GO:0043604 amide biosynthetic process No
GO:0043603 cellular amide metabolic process No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup5505
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4360
Ophiocordyceps australis map64 (Brazil) OphauB2|6117
Ophiocordyceps camponoti-floridani Ophcf2|05826
Ophiocordyceps camponoti-rufipedis Ophun1|1678 (this protein)
Ophiocordyceps kimflemingae Ophio5|4925
Ophiocordyceps subramaniannii Hirsu2|6669

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|1678
MAKVSSSVSSSRRKSRAAHFKAPSSQRRVIMSAPLSKELREKYNVRSIPVRKDDEVTIVRGTNKGREGKVTSVYR
LKYVIHIERVTRDKATGQSVPLGIHPSNVVITKLKLDKDREDILARSKTGRELRAKNKVTA*
Coding >Ophun1|1678
ATGGCCAAGGTCAGCAGCAGCGTCTCATCGTCCCGGCGCAAGAGCCGGGCCGCTCACTTCAAGGCCCCCTCCAGC
CAGCGGCGCGTCATCATGAGCGCACCGCTCAGCAAGGAACTCCGCGAAAAATACAACGTCCGCAGCATCCCCGTC
CGCAAGGACGACGAAGTCACCATCGTCCGCGGCACCAACAAGGGCCGCGAGGGAAAAGTCACCTCGGTCTACCGC
CTCAAATACGTCATCCACATCGAGCGCGTCACCCGCGATAAAGCCACCGGCCAAAGCGTCCCCCTCGGCATCCAC
CCTTCCAACGTCGTCATCACCAAGCTCAAGCTCGACAAGGACCGCGAGGACATCCTGGCCCGCTCCAAGACGGGC
CGCGAGCTGCGCGCCAAGAACAAGGTCACCGCCTGA
Transcript >Ophun1|1678
ATGGCCAAGGTCAGCAGCAGCGTCTCATCGTCCCGGCGCAAGAGCCGGGCCGCTCACTTCAAGGCCCCCTCCAGC
CAGCGGCGCGTCATCATGAGCGCACCGCTCAGCAAGGAACTCCGCGAAAAATACAACGTCCGCAGCATCCCCGTC
CGCAAGGACGACGAAGTCACCATCGTCCGCGGCACCAACAAGGGCCGCGAGGGAAAAGTCACCTCGGTCTACCGC
CTCAAATACGTCATCCACATCGAGCGCGTCACCCGCGATAAAGCCACCGGCCAAAGCGTCCCCCTCGGCATCCAC
CCTTCCAACGTCGTCATCACCAAGCTCAAGCTCGACAAGGACCGCGAGGACATCCTGGCCCGCTCCAAGACGGGC
CGCGAGCTGCGCGCCAAGAACAAGGTCACCGCCTGA
Gene >Ophun1|1678
ATGGCCAAGGTCAGCAGCAGTGAGTGAAACGCAATCACCGTAACAGCCAGCTCTCGACAGTATCTAACAACCCCC
CCCCCCCCCCTCATTCCAGGCGTCTCATCGTCCCGGCGCAAGAGCCGGGCCGCTCACTTCAAGGCCCCCTCCAGC
CAGCGGCGCGTCATCATGAGCGCACCGCTCAGCAAGGAACTCCGCGAAAAATACAACGTCCGTCAATCCTCCCGC
TTTCCCTCTCTCTGCTCCCCCGTCAAACGCTCACCCCTCCACAGGTCCGCAGCATCCCCGTCCGCAAGGACGACG
AAGTCACCATCGTCCGCGGCACCAACAAGGGCCGCGAGGGAAAAGTCACCTCGGTCTACCGCCTCAAATACGTCA
TCCACATCGAGCGCGTCACCCGCGATAAAGCCACCGGCCAAAGCGTCCCCCTCGGCATCCACCCTTCCAACGTCG
TCATCACCAAGCTCAAGCTCGACAAGGACCGCGAGGACATCCTGGCCCGCTCCAAGACGGGCCGCGAGCTGCGCG
CCAAGAACAAGGTCACCGCCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail