Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|1671
Gene name
LocationContig_171:24364..30533
Strand+
Gene length (bp)6169
Transcript length (bp)4521
Coding sequence length (bp)4521
Protein length (aa) 1507

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00450 Peptidase_S10 Serine carboxypeptidase 3.4E-102 595 942
PF01569 PAP2 PAP2 superfamily 5.8E-19 98 218
PF00004 AAA ATPase family associated with various cellular activities (AAA) 1.7E-14 1038 1167
PF08542 Rep_fac_C Replication factor C C-terminal domain 1.0E-13 1254 1340
PF13177 DNA_pol3_delta2 DNA polymerase III, delta subunit 2.2E-09 1021 1170
PF03215 Rad17 Rad17 P-loop domain 6.5E-07 1001 1085

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|C7YQJ2|CBPYA_NECH7 Carboxypeptidase Y homolog A OS=Nectria haematococca (strain 77-13-4 / ATCC MYA-4622 / FGSC 9596 / MPVI) GN=CPYA PE=3 SV=1 544 959 9.0E-172
sp|B2AWD5|CBPYA_PODAN Carboxypeptidase Y homolog A OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) GN=CPYA PE=3 SV=1 559 959 3.0E-168
sp|E3QR43|CBPYA_COLGM Carboxypeptidase Y homolog A OS=Colletotrichum graminicola (strain M1.001 / M2 / FGSC 10212) GN=CPYA PE=3 SV=1 543 959 8.0E-167
sp|E5A7I6|CBPYA_LEPMJ Carboxypeptidase Y homolog A OS=Leptosphaeria maculans (strain JN3 / isolate v23.1.3 / race Av1-4-5-6-7-8) GN=CPYA PE=3 SV=1 531 959 1.0E-166
sp|B8M044|CBPYA_TALSN Carboxypeptidase Y homolog A OS=Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006) GN=cpyA PE=3 SV=1 546 943 6.0E-166
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|C7YQJ2|CBPYA_NECH7 Carboxypeptidase Y homolog A OS=Nectria haematococca (strain 77-13-4 / ATCC MYA-4622 / FGSC 9596 / MPVI) GN=CPYA PE=3 SV=1 544 959 9.0E-172
sp|B2AWD5|CBPYA_PODAN Carboxypeptidase Y homolog A OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) GN=CPYA PE=3 SV=1 559 959 3.0E-168
sp|E3QR43|CBPYA_COLGM Carboxypeptidase Y homolog A OS=Colletotrichum graminicola (strain M1.001 / M2 / FGSC 10212) GN=CPYA PE=3 SV=1 543 959 8.0E-167
sp|E5A7I6|CBPYA_LEPMJ Carboxypeptidase Y homolog A OS=Leptosphaeria maculans (strain JN3 / isolate v23.1.3 / race Av1-4-5-6-7-8) GN=CPYA PE=3 SV=1 531 959 1.0E-166
sp|B8M044|CBPYA_TALSN Carboxypeptidase Y homolog A OS=Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006) GN=cpyA PE=3 SV=1 546 943 6.0E-166
sp|D1ZG13|CBPYA_SORMK Carboxypeptidase Y homolog A OS=Sordaria macrospora (strain ATCC MYA-333 / DSM 997 / K(L3346) / K-hell) GN=CPYA PE=3 SV=1 559 959 2.0E-165
sp|A4RPY8|CBPYA_MAGO7 Carboxypeptidase Y homolog A OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=CPYA PE=3 SV=1 554 938 1.0E-164
sp|Q7RXW8|CBPYA_NEUCR Carboxypeptidase Y homolog A OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=cpyA PE=3 SV=1 559 959 4.0E-164
sp|Q96VC4|CBPYA_EMENI Carboxypeptidase Y homolog A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=cpyA PE=3 SV=1 544 943 1.0E-163
sp|C4JNM2|CBPYA_UNCRE Carboxypeptidase Y homolog A OS=Uncinocarpus reesii (strain UAMH 1704) GN=cpyA PE=3 SV=1 546 944 1.0E-163
sp|A5AB21|CBPYA_ASPNC Carboxypeptidase Y homolog A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=cpyA PE=3 SV=1 549 944 1.0E-163
sp|C5P212|CBPYA_COCP7 Carboxypeptidase Y homolog A OS=Coccidioides posadasii (strain C735) GN=cpyA PE=3 SV=1 546 944 4.0E-163
sp|Q2H9G6|CBPYA_CHAGB Carboxypeptidase Y homolog A OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=CPYA PE=3 SV=1 559 959 8.0E-163
sp|A7F4H5|CBPYA_SCLS1 Carboxypeptidase Y homolog A OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=cpyA PE=3 SV=1 554 959 9.0E-163
sp|Q0CSD3|CBPYA_ASPTN Carboxypeptidase Y homolog A OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=cpyA PE=3 SV=1 544 944 1.0E-162
sp|Q5VJG9|CBPYA_ASPFU Carboxypeptidase Y homolog A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=cpyA PE=3 SV=1 498 953 2.0E-162
sp|A1CUJ5|CBPYA_ASPCL Carboxypeptidase Y homolog A OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=cpyA PE=3 SV=1 498 953 6.0E-162
sp|A1DP75|CBPYA_NEOFI Carboxypeptidase Y homolog A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=cpyA PE=3 SV=1 498 953 8.0E-162
sp|B6QAN5|CBPYA_TALMQ Carboxypeptidase Y homolog A OS=Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333) GN=cpyA PE=3 SV=1 546 943 1.0E-161
sp|B6HPP6|CBPYA_PENRW Carboxypeptidase Y homolog A OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) GN=cpyA PE=3 SV=1 549 943 3.0E-161
sp|B8NXS9|CBPYA_ASPFN Carboxypeptidase Y homolog A OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=cpyA PE=3 SV=1 549 943 1.0E-160
sp|Q2TYA1|CBPYA_ASPOR Carboxypeptidase Y homolog A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=cpyA PE=3 SV=1 549 943 2.0E-160
sp|B2WKF1|CBPYA_PYRTR Carboxypeptidase Y homolog A OS=Pyrenophora tritici-repentis (strain Pt-1C-BFP) GN=cpyA PE=3 SV=1 531 959 1.0E-159
sp|C1GXD8|CBPYA_PARBA Carboxypeptidase Y homolog A OS=Paracoccidioides lutzii (strain ATCC MYA-826 / Pb01) GN=CPYA PE=3 SV=1 549 959 1.0E-158
sp|A6RUD7|CBPYA_BOTFB Carboxypeptidase Y homolog A OS=Botryotinia fuckeliana (strain B05.10) GN=CPYA PE=3 SV=1 531 959 1.0E-158
sp|B8XGR4|CBPYA_TRIEQ Carboxypeptidase Y homolog A OS=Trichophyton equinum GN=CPYA PE=3 SV=1 549 943 1.0E-157
sp|C0SGX7|CBPYA_PARBP Carboxypeptidase Y homolog A OS=Paracoccidioides brasiliensis (strain Pb03) GN=CPYA PE=3 SV=1 548 959 1.0E-157
sp|C1GG77|CBPYA_PARBD Carboxypeptidase Y homolog A OS=Paracoccidioides brasiliensis (strain Pb18) GN=CPYA PE=3 SV=1 548 959 1.0E-157
sp|A5YCB8|CBPYA_TRITO Carboxypeptidase Y homolog A OS=Trichophyton tonsurans GN=CPYA PE=3 SV=1 549 943 2.0E-157
sp|C5GEU5|CBPYA_AJEDR Carboxypeptidase Y homolog A OS=Ajellomyces dermatitidis (strain ER-3 / ATCC MYA-2586) GN=CPYA PE=3 SV=1 549 944 3.0E-157
sp|C5K1Y9|CBPYA_AJEDS Carboxypeptidase Y homolog A OS=Ajellomyces dermatitidis (strain SLH14081) GN=CPYA PE=3 SV=1 549 944 4.0E-157
sp|E4USS9|CBPYA_ARTGP Carboxypeptidase Y homolog A OS=Arthroderma gypseum (strain ATCC MYA-4604 / CBS 118893) GN=CPYA PE=3 SV=1 549 943 5.0E-157
sp|D4DLI1|CBPYA_TRIVH Carboxypeptidase Y homolog A OS=Trichophyton verrucosum (strain HKI 0517) GN=cpyA PE=3 SV=1 549 943 1.0E-156
sp|D4AZ71|CBPYA_ARTBC Carboxypeptidase Y homolog A OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=CPYA PE=3 SV=1 549 943 2.0E-156
sp|C5FWJ1|CBPYA_ARTOC Carboxypeptidase Y homolog A OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=CPYA PE=3 SV=1 542 943 1.0E-154
sp|C0NX46|CBPYA_AJECG Carboxypeptidase Y homolog A OS=Ajellomyces capsulatus (strain G186AR / H82 / ATCC MYA-2454 / RMSCC 2432) GN=CPYA PE=3 SV=1 549 944 2.0E-154
sp|A6RGA0|CBPYA_AJECN Carboxypeptidase Y homolog A OS=Ajellomyces capsulatus (strain NAm1 / WU24) GN=CPYA PE=3 SV=1 549 944 2.0E-154
sp|Q0V1R1|CBPYA_PHANO Carboxypeptidase Y homolog A OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=CPYA PE=3 SV=1 552 959 6.0E-154
sp|Q5J6J0|CBPYA_TRIRU Carboxypeptidase Y homolog A OS=Trichophyton rubrum GN=cpyA PE=3 SV=1 549 943 1.0E-152
sp|P30574|CBPY_CANAX Carboxypeptidase Y OS=Candida albicans GN=CPY1 PE=2 SV=2 570 950 3.0E-142
sp|P52710|CBPY_PICPG Carboxypeptidase Y OS=Komagataella pastoris (strain GS115 / ATCC 20864) GN=PRC1 PE=1 SV=1 513 949 7.0E-137
sp|P00729|CBPY_YEAST Carboxypeptidase Y OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRC1 PE=1 SV=1 576 956 7.0E-132
sp|O74111|RFC3_BLAAD Replication factor C subunit 3 OS=Blastobotrys adeninivorans GN=RFC3 PE=3 SV=1 985 1344 1.0E-118
sp|P38109|YBY9_YEAST Putative serine carboxypeptidase YBR139W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YBR139W PE=1 SV=1 579 955 3.0E-117
sp|D4ASE6|SCPF_ARTBC Carboxypeptidase Y homolog ARB_07161 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07161 PE=3 SV=2 554 935 8.0E-114
sp|O13849|CBPY_SCHPO Carboxypeptidase Y OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cpy1 PE=1 SV=1 562 950 3.0E-112
sp|O14003|RFC3_SCHPO Replication factor C subunit 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rfc3 PE=1 SV=2 980 1345 7.0E-110
sp|P38629|RFC3_YEAST Replication factor C subunit 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RFC3 PE=1 SV=1 998 1343 8.0E-108
sp|Q9CAQ8|RFC5_ARATH Replication factor C subunit 5 OS=Arabidopsis thaliana GN=RFC5 PE=1 SV=1 960 1350 3.0E-95
sp|Q54ST4|RFC5_DICDI Probable replication factor C subunit 5 OS=Dictyostelium discoideum GN=rfc5 PE=3 SV=1 984 1340 7.0E-94
sp|P40937|RFC5_HUMAN Replication factor C subunit 5 OS=Homo sapiens GN=RFC5 PE=1 SV=1 1001 1343 1.0E-93
sp|Q9D0F6|RFC5_MOUSE Replication factor C subunit 5 OS=Mus musculus GN=Rfc5 PE=1 SV=1 1001 1343 6.0E-91
sp|Q6YZ54|RFC3_ORYSJ Replication factor C subunit 3 OS=Oryza sativa subsp. japonica GN=RFC3 PE=2 SV=1 1003 1339 3.0E-85
sp|P34429|RFC5_CAEEL Probable replication factor C subunit 5 OS=Caenorhabditis elegans GN=F44B9.8 PE=3 SV=3 1001 1332 1.0E-82
sp|Q9HN27|RFCS_HALSA Replication factor C small subunit OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=rfcS PE=3 SV=1 1004 1342 4.0E-65
sp|B0R7H7|RFCS_HALS3 Replication factor C small subunit OS=Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1) GN=rfcS PE=3 SV=1 1004 1342 4.0E-65
sp|P34946|CPS1_PENJA Carboxypeptidase S1 OS=Penicillium janthinellum PE=1 SV=1 596 937 6.0E-65
sp|A6VJ61|RFCS_METM7 Replication factor C small subunit OS=Methanococcus maripaludis (strain C7 / ATCC BAA-1331) GN=rfcS PE=3 SV=1 1003 1342 1.0E-64
sp|A3DNV9|RFCS_STAMF Replication factor C small subunit OS=Staphylothermus marinus (strain ATCC 43588 / DSM 3639 / JCM 9404 / F1) GN=rfcS PE=3 SV=1 1001 1340 2.0E-64
sp|A6US36|RFCS_METVS Replication factor C small subunit OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=rfcS PE=3 SV=1 1003 1340 5.0E-64
sp|Q6M044|RFCS_METMP Replication factor C small subunit OS=Methanococcus maripaludis (strain S2 / LL) GN=rfcS PE=3 SV=1 1003 1342 2.0E-63
sp|A4FZ74|RFCS_METM5 Replication factor C small subunit OS=Methanococcus maripaludis (strain C5 / ATCC BAA-1333) GN=rfcS PE=3 SV=1 1003 1342 2.0E-63
sp|Q5UZE5|RFCS_HALMA Replication factor C small subunit OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=rfcS PE=3 SV=2 1004 1345 2.0E-63
sp|A9A6K6|RFCS_METM6 Replication factor C small subunit OS=Methanococcus maripaludis (strain C6 / ATCC BAA-1332) GN=rfcS PE=3 SV=1 1003 1342 3.0E-63
sp|Q9P6N5|DS1PP_SCHPO Dihydrosphingosine 1-phosphate phosphatase C823.11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC823.11 PE=3 SV=1 13 340 4.0E-63
sp|Q9YBS7|RFCS_AERPE Replication factor C small subunit OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=rfcS PE=3 SV=3 1004 1340 1.0E-62
sp|O28219|RFCS_ARCFU Replication factor C small subunit OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=rfcS PE=1 SV=1 1004 1337 1.0E-61
sp|Q4JAB0|RFCS_SULAC Replication factor C small subunit OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=rfcS PE=3 SV=1 999 1342 3.0E-61
sp|Q0W037|RFCS_METAR Replication factor C small subunit OS=Methanocella arvoryzae (strain DSM 22066 / NBRC 105507 / MRE50) GN=rfcS PE=3 SV=1 998 1340 5.0E-61
sp|Q975D3|RFCS_SULTO Replication factor C small subunit OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=rfcS PE=3 SV=1 999 1351 2.0E-60
sp|A4WGV2|RFCS1_PYRAR Replication factor C small subunit 1 OS=Pyrobaculum arsenaticum (strain DSM 13514 / JCM 11321) GN=rfcS1 PE=3 SV=1 1001 1331 3.0E-60
sp|P52712|CBPX_ORYSJ Serine carboxypeptidase-like OS=Oryza sativa subsp. japonica GN=CBP31 PE=2 SV=2 608 935 5.0E-60
sp|P37891|CBP3_ORYSJ Serine carboxypeptidase 3 OS=Oryza sativa subsp. japonica GN=CBP3 PE=2 SV=1 592 950 5.0E-60
sp|Q09843|RFC2_SCHPO Replication factor C subunit 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rfc2 PE=1 SV=1 997 1334 5.0E-60
sp|Q99J62|RFC4_MOUSE Replication factor C subunit 4 OS=Mus musculus GN=Rfc4 PE=1 SV=1 1002 1215 6.0E-60
sp|Q54MD4|RFC4_DICDI Probable replication factor C subunit 4 OS=Dictyostelium discoideum GN=rfc4 PE=3 SV=1 996 1263 1.0E-59
sp|A1RSA2|RFCS1_PYRIL Replication factor C small subunit 1 OS=Pyrobaculum islandicum (strain DSM 4184 / JCM 9189 / GEO3) GN=rfcS1 PE=3 SV=1 1001 1347 1.0E-59
sp|Q8ZYK4|RFCS1_PYRAE Replication factor C small subunit 1 OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=rfcS1 PE=3 SV=1 1002 1334 2.0E-59
sp|P21529|CBP3_HORVU Serine carboxypeptidase 3 OS=Hordeum vulgare GN=CBP3 PE=1 SV=2 592 944 3.0E-59
sp|P32826|SCP49_ARATH Serine carboxypeptidase-like 49 OS=Arabidopsis thaliana GN=SCPL49 PE=2 SV=2 593 938 8.0E-59
sp|P60374|RFCS_NANEQ Replication factor C small subunit OS=Nanoarchaeum equitans (strain Kin4-M) GN=rfcS PE=3 SV=1 1004 1340 9.0E-59
sp|P35249|RFC4_HUMAN Replication factor C subunit 4 OS=Homo sapiens GN=RFC4 PE=1 SV=2 1002 1215 2.0E-58
sp|Q3ITJ2|RFCS_NATPD Replication factor C small subunit OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=rfcS PE=3 SV=1 1004 1330 2.0E-58
sp|Q46C63|RFCS_METBF Replication factor C small subunit OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=rfcS PE=3 SV=1 1004 1340 6.0E-58
sp|P11515|CBP3_WHEAT Serine carboxypeptidase 3 OS=Triticum aestivum GN=CBP3 PE=2 SV=1 592 944 9.0E-58
sp|A3MS28|RFCS_PYRCJ Replication factor C small subunit OS=Pyrobaculum calidifontis (strain JCM 11548 / VA1) GN=rfcS PE=3 SV=1 1001 1334 9.0E-58
sp|Q8PVY4|RFCS_METMA Replication factor C small subunit OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=rfcS PE=3 SV=1 1004 1340 2.0E-57
sp|Q9UXF5|RFCS_SULSO Replication factor C small subunit OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=rfcS PE=1 SV=1 1000 1350 2.0E-57
sp|P0C7N7|RFC2_PHANO Replication factor C subunit 2 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=RFC2 PE=3 SV=1 1003 1331 9.0E-57
sp|Q56WF8|SCP48_ARATH Serine carboxypeptidase-like 48 OS=Arabidopsis thaliana GN=SCPL48 PE=2 SV=2 612 940 1.0E-56
sp|O26343|RFCS_METTH Replication factor C small subunit OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=rfcS PE=1 SV=1 1003 1340 7.0E-56
sp|Q5UP47|RFCS3_MIMIV Putative replication factor C small subunit L499 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L499 PE=3 SV=1 997 1214 7.0E-56
sp|Q6L1I0|RFCS_PICTO Replication factor C small subunit OS=Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828) GN=rfcS PE=3 SV=1 1004 1342 1.0E-55
sp|D4ANB6|CBPYB_ARTBC Carboxypeptidase Y homolog ARB_05721 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_05721 PE=1 SV=1 579 949 2.0E-55
sp|Q9FFB0|SCP47_ARATH Serine carboxypeptidase-like 47 OS=Arabidopsis thaliana GN=SCPL47 PE=2 SV=1 565 946 3.0E-55
sp|Q8TSX5|RFCS_METAC Replication factor C small subunit OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=rfcS PE=3 SV=1 1004 1340 4.0E-55
sp|Q8ZWS2|RFCS2_PYRAE Replication factor C small subunit 2 OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=rfcS2 PE=3 SV=1 1001 1343 2.0E-54
sp|A7I8Y0|RFCS_METB6 Replication factor C small subunit OS=Methanoregula boonei (strain 6A8) GN=rfcS PE=3 SV=1 1004 1340 6.0E-54
sp|A1RWU7|RFCS_THEPD Replication factor C small subunit OS=Thermofilum pendens (strain Hrk 5) GN=rfcS PE=3 SV=1 1004 1342 7.0E-54
sp|P40348|RFC2_YEAST Replication factor C subunit 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RFC2 PE=1 SV=1 988 1334 8.0E-54
sp|A1RV38|RFCS2_PYRIL Replication factor C small subunit 2 OS=Pyrobaculum islandicum (strain DSM 4184 / JCM 9189 / GEO3) GN=rfcS2 PE=3 SV=1 1002 1343 8.0E-54
sp|A4WLY0|RFCS2_PYRAR Replication factor C small subunit 2 OS=Pyrobaculum arsenaticum (strain DSM 13514 / JCM 11321) GN=rfcS2 PE=3 SV=1 1001 1230 1.0E-52
sp|Q93ZX1|RFC4_ARATH Replication factor C subunit 4 OS=Arabidopsis thaliana GN=RFC4 PE=2 SV=1 999 1215 1.0E-52
sp|A2SQT3|RFCS_METLZ Replication factor C small subunit OS=Methanocorpusculum labreanum (strain ATCC 43576 / DSM 4855 / Z) GN=rfcS PE=3 SV=1 1004 1345 1.0E-52
sp|P47013|DS1P1_YEAST Dihydrosphingosine 1-phosphate phosphatase LCB3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LCB3 PE=1 SV=1 11 336 2.0E-52
sp|Q9FXM3|RFC2_ORYSJ Replication factor C subunit 2 OS=Oryza sativa subsp. japonica GN=RFC2 PE=2 SV=1 1001 1215 2.0E-52
sp|Q977Z9|RFCS_THEVO Replication factor C small subunit OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=rfcS PE=3 SV=2 1004 1342 3.0E-52
sp|Q9HI47|RFCS_THEAC Replication factor C small subunit OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=rfcS PE=3 SV=2 1004 1342 3.0E-52
sp|Q05B83|RFC2_BOVIN Replication factor C subunit 2 OS=Bos taurus GN=RFC2 PE=2 SV=1 1002 1260 6.0E-51
sp|P35250|RFC2_HUMAN Replication factor C subunit 2 OS=Homo sapiens GN=RFC2 PE=1 SV=3 1001 1260 2.0E-50
sp|A3CUX9|RFCS_METMJ Replication factor C small subunit OS=Methanoculleus marisnigri (strain ATCC 35101 / DSM 1498 / JR1) GN=rfcS PE=3 SV=1 1004 1340 2.0E-50
sp|Q2FQT9|RFCS_METHJ Replication factor C small subunit OS=Methanospirillum hungatei JF-1 (strain ATCC 27890 / DSM 864 / NBRC 100397 / JF-1) GN=rfcS PE=3 SV=1 1004 1340 4.0E-50
sp|Q641W4|RFC2_RAT Replication factor C subunit 2 OS=Rattus norvegicus GN=Rfc2 PE=2 SV=1 1002 1260 4.0E-50
sp|Q9WUK4|RFC2_MOUSE Replication factor C subunit 2 OS=Mus musculus GN=Rfc2 PE=1 SV=1 1001 1260 5.0E-50
sp|Q2NH89|RFCS_METST Replication factor C small subunit OS=Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3) GN=rfcS PE=3 SV=1 1003 1339 8.0E-50
sp|P53033|RFC2_CHICK Replication factor C subunit 2 OS=Gallus gallus GN=RFC2 PE=2 SV=1 1001 1260 1.0E-49
sp|Q54DY7|SCPL1_DICDI Serine carboxypeptidase S10 family member 1 OS=Dictyostelium discoideum GN=DDB_G0291912 PE=3 SV=1 598 943 5.0E-49
sp|Q7XRX1|RFC4_ORYSJ Replication factor C subunit 4 OS=Oryza sativa subsp. japonica GN=RFC4 PE=2 SV=2 1002 1340 6.0E-49
sp|Q9CAM7|RFC2_ARATH Replication factor C subunit 2 OS=Arabidopsis thaliana GN=RFC2 PE=1 SV=1 1003 1334 6.0E-49
sp|Q54E21|RFC2_DICDI Probable replication factor C subunit 2 OS=Dictyostelium discoideum GN=rfc2 PE=3 SV=1 1002 1218 2.0E-48
sp|A5UMF3|RFCS_METS3 Replication factor C small subunit OS=Methanobrevibacter smithii (strain PS / ATCC 35061 / DSM 861) GN=rfcS PE=3 SV=1 1003 1339 8.0E-48
sp|Q8SQM0|RFC4_ENCCU Replication factor C subunit 4 OS=Encephalitozoon cuniculi (strain GB-M1) GN=RFC4 PE=1 SV=1 1005 1268 1.0E-46
sp|P23501|DS1P2_YEAST Dihydrosphingosine 1-phosphate phosphatase YSR3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YSR3 PE=3 SV=2 16 334 2.0E-46
sp|P53034|RFC2_DROME Replication factor C subunit 2 OS=Drosophila melanogaster GN=RfC4 PE=2 SV=1 1002 1342 3.0E-46
sp|P40339|RFC4_YEAST Replication factor C subunit 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RFC4 PE=1 SV=1 1001 1342 1.0E-45
sp|P53016|RFC4_CAEEL Replication factor C subunit 4 OS=Caenorhabditis elegans GN=rfc-4 PE=1 SV=1 995 1215 8.0E-45
sp|O94449|RFC4_SCHPO Replication factor C subunit 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rfc4 PE=1 SV=1 1002 1233 4.0E-44
sp|Q0USX0|KEX1_PHANO Pheromone-processing carboxypeptidase KEX1 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=KEX1 PE=3 SV=1 596 931 5.0E-44
sp|D5G4B1|KEX1_TUBMM Pheromone-processing carboxypeptidase KEX1 OS=Tuber melanosporum (strain Mel28) GN=KEX1 PE=3 SV=1 577 935 2.0E-43
sp|Q5UQ72|RFCS4_MIMIV Putative replication factor C small subunit L510 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R510 PE=3 SV=1 999 1214 2.0E-43
sp|B2W340|KEX1_PYRTR Pheromone-processing carboxypeptidase kex1 OS=Pyrenophora tritici-repentis (strain Pt-1C-BFP) GN=kex1 PE=3 SV=1 596 938 3.0E-43
sp|Q4WTK9|KEX1_ASPFU Pheromone-processing carboxypeptidase kex1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=kex1 PE=3 SV=1 596 935 1.0E-42
sp|B0XQ16|KEX1_ASPFC Pheromone-processing carboxypeptidase kex1 OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=kex1 PE=3 SV=1 596 935 1.0E-42
sp|A1D3I1|KEX1_NEOFI Pheromone-processing carboxypeptidase kex1 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=kex1 PE=3 SV=1 596 935 1.0E-42
sp|Q5JHP2|RFCS_THEKO Replication factor C small subunit OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=rfcS PE=1 SV=1 1043 1340 2.0E-42
sp|Q2UPI1|KEX1_ASPOR Pheromone-processing carboxypeptidase kex1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=kex1 PE=3 SV=1 596 935 7.0E-42
sp|Q8U4J3|RFCS_PYRFU Replication factor C small subunit OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=rfcS PE=1 SV=1 1043 1340 1.0E-41
sp|O57852|RFCS_PYRHO Replication factor C small subunit OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=rfcS PE=3 SV=1 1043 1340 3.0E-41
sp|Q54VW1|SCPL2_DICDI Serine carboxypeptidase S10 family member 2 OS=Dictyostelium discoideum GN=DDB_G0280105 PE=3 SV=1 592 938 3.0E-41
sp|P55748|CBP22_HORVU Serine carboxypeptidase II-2 (Fragment) OS=Hordeum vulgare GN=CXP;2-2 PE=1 SV=1 598 936 8.0E-41
sp|Q18E75|RFCS_HALWD Replication factor C small subunit OS=Haloquadratum walsbyi (strain DSM 16790 / HBSQ001) GN=rfcS PE=3 SV=1 1059 1342 1.0E-40
sp|E5R540|KEX1_LEPMJ Pheromone-processing carboxypeptidase KEX1 OS=Leptosphaeria maculans (strain JN3 / isolate v23.1.3 / race Av1-4-5-6-7-8) GN=KEX1 PE=3 SV=1 596 935 1.0E-40
sp|Q8L7B2|SCP20_ARATH Serine carboxypeptidase-like 20 OS=Arabidopsis thaliana GN=SCPL20 PE=2 SV=2 588 951 3.0E-40
sp|Q0CCR9|KEX1_ASPTN Pheromone-processing carboxypeptidase kex1 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=kex1 PE=3 SV=1 596 935 4.0E-40
sp|B6QQZ9|KEX1_TALMQ Pheromone-processing carboxypeptidase kex1 OS=Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333) GN=kex1 PE=3 SV=1 585 935 5.0E-40
sp|C9S688|KEX1_VERA1 Pheromone-processing carboxypeptidase KEX1 OS=Verticillium alfalfae (strain VaMs.102 / ATCC MYA-4576 / FGSC 10136) GN=KEX1 PE=3 SV=1 585 935 7.0E-40
sp|B6K7U7|KEX1_SCHJY Pheromone-processing carboxypeptidase kex1 OS=Schizosaccharomyces japonicus (strain yFS275 / FY16936) GN=kex1 PE=3 SV=1 599 939 8.0E-40
sp|P52715|YUA6_CAEEL Uncharacterized serine carboxypeptidase F13S12.6 OS=Caenorhabditis elegans GN=F13D12.6 PE=3 SV=1 593 986 3.0E-39
sp|C5FTV7|KEX1_ARTOC Pheromone-processing carboxypeptidase KEX1 OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=KEX1 PE=3 SV=1 595 935 4.0E-39
sp|C7YRS6|KEX1_NECH7 Pheromone-processing carboxypeptidase KEX1 OS=Nectria haematococca (strain 77-13-4 / ATCC MYA-4622 / FGSC 9596 / MPVI) GN=KEX1 PE=3 SV=1 595 935 4.0E-39
sp|Q6CFP3|KEX1_YARLI Pheromone-processing carboxypeptidase KEX1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=KEX1 PE=3 SV=1 592 932 6.0E-39
sp|Q9M099|SCP24_ARATH Serine carboxypeptidase 24 OS=Arabidopsis thaliana GN=SCPL24 PE=1 SV=1 598 951 8.0E-39
sp|Q9MAR8|SCP44_ARATH Serine carboxypeptidase-like 44 OS=Arabidopsis thaliana GN=SCPL44 PE=2 SV=1 597 927 9.0E-39
sp|P52711|CBP23_HORVU Serine carboxypeptidase II-3 OS=Hordeum vulgare GN=CXP;2-3 PE=2 SV=1 592 912 1.0E-38
sp|B6H7A4|KEX1_PENRW Pheromone-processing carboxypeptidase kex1 OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) GN=kex1 PE=3 SV=1 596 935 1.0E-38
sp|C5P635|KEX1_COCP7 Pheromone-processing carboxypeptidase KEX1 OS=Coccidioides posadasii (strain C735) GN=KEX1 PE=3 SV=1 596 935 2.0E-38
sp|E3L8A5|KEX1_PUCGT Pheromone-processing carboxypeptidase KEX1 OS=Puccinia graminis f. sp. tritici (strain CRL 75-36-700-3 / race SCCL) GN=KEX1 PE=3 SV=2 609 941 3.0E-38
sp|P42661|NF314_NAEFO Virulence-related protein Nf314 OS=Naegleria fowleri PE=2 SV=1 588 946 3.0E-38
sp|Q5BDJ6|KEX1_EMENI Pheromone-processing carboxypeptidase kex1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=kex1 PE=3 SV=2 596 935 7.0E-38
sp|Q8L9Y0|SCP25_ARATH Serine carboxypeptidase-like 25 OS=Arabidopsis thaliana GN=SCPL25 PE=2 SV=2 595 951 7.0E-38
sp|E9CS37|KEX1_COCPS Pheromone-processing carboxypeptidase KEX1 OS=Coccidioides posadasii (strain RMSCC 757 / Silveira) GN=KEX1 PE=3 SV=1 596 935 8.0E-38
sp|O23364|SCP30_ARATH Putative serine carboxypeptidase-like 30 OS=Arabidopsis thaliana GN=SCPL30 PE=2 SV=2 595 951 1.0E-37
sp|B8M719|KEX1_TALSN Pheromone-processing carboxypeptidase kex1 OS=Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006) GN=kex1 PE=3 SV=1 585 935 1.0E-37
sp|A4RE47|KEX1_MAGO7 Pheromone-processing carboxypeptidase KEX1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=KEX1 PE=3 SV=2 596 935 1.0E-37
sp|O04084|SCP31_ARATH Serine carboxypeptidase-like 31 OS=Arabidopsis thaliana GN=SCPL31 PE=2 SV=2 595 951 1.0E-37
sp|B2B762|KEX1_PODAN Pheromone-processing carboxypeptidase KEX1 OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) GN=KEX1 PE=3 SV=1 611 935 3.0E-37
sp|A2QPW5|KEX1_ASPNC Pheromone-processing carboxypeptidase kex1 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=kex1 PE=3 SV=1 596 935 3.0E-37
sp|A7EYY7|KEX1_SCLS1 Pheromone-processing carboxypeptidase kex1 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=kex1 PE=3 SV=1 596 935 3.0E-37
sp|C5JN54|KEX1_AJEDS Pheromone-processing carboxypeptidase KEX1 OS=Ajellomyces dermatitidis (strain SLH14081) GN=KEX1 PE=3 SV=1 596 935 4.0E-37
sp|C5GC75|KEX1_AJEDR Pheromone-processing carboxypeptidase KEX1 OS=Ajellomyces dermatitidis (strain ER-3 / ATCC MYA-2586) GN=KEX1 PE=3 SV=1 596 935 4.0E-37
sp|O82229|SCP23_ARATH Putative serine carboxypeptidase-like 23 OS=Arabidopsis thaliana GN=SCPL23 PE=2 SV=2 598 951 4.0E-37
sp|P16675|PPGB_MOUSE Lysosomal protective protein OS=Mus musculus GN=Ctsa PE=1 SV=1 595 928 8.0E-37
sp|P10619|PPGB_HUMAN Lysosomal protective protein OS=Homo sapiens GN=CTSA PE=1 SV=2 595 928 1.0E-36
sp|A1CQL5|KEX1_ASPCL Pheromone-processing carboxypeptidase kex1 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=kex1 PE=3 SV=1 596 935 1.0E-36
sp|Q9ZQQ0|SCP26_ARATH Serine carboxypeptidase-like 26 OS=Arabidopsis thaliana GN=SCPL26 PE=2 SV=1 595 951 1.0E-36
sp|Q3MI05|PPGB_BOVIN Lysosomal protective protein OS=Bos taurus GN=CTSA PE=2 SV=1 595 928 1.0E-36
sp|Q0WPR4|SCP34_ARATH Serine carboxypeptidase-like 34 OS=Arabidopsis thaliana GN=SCPL34 PE=2 SV=2 597 912 1.0E-36
sp|Q8S8K6|SCP28_ARATH Serine carboxypeptidase-like 28 OS=Arabidopsis thaliana GN=SCPL28 PE=2 SV=2 598 951 1.0E-36
sp|E7R7R2|KEX1_OGAPD Pheromone-processing carboxypeptidase KEX1 OS=Ogataea parapolymorpha (strain DL-1 / ATCC 26012 / NRRL Y-7560) GN=KEX1 PE=3 SV=1 599 916 1.0E-36
sp|E3QDT3|KEX1_COLGM Pheromone-processing carboxypeptidase KEX1 OS=Colletotrichum graminicola (strain M1.001 / M2 / FGSC 10212) GN=KEX1 PE=3 SV=1 596 935 1.0E-36
sp|Q93Y09|SCP45_ARATH Serine carboxypeptidase-like 45 OS=Arabidopsis thaliana GN=SCPL45 PE=2 SV=1 597 952 1.0E-36
sp|Q9SFB5|SCP27_ARATH Serine carboxypeptidase-like 27 OS=Arabidopsis thaliana GN=SCPL27 PE=2 SV=1 581 951 2.0E-36
sp|C5FGX1|SCPB_ARTOC Carboxypeptidase S1 homolog B OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=SCPB PE=3 SV=1 594 952 3.0E-36
sp|D1ZEM2|KEX1_SORMK Pheromone-processing carboxypeptidase KEX1 OS=Sordaria macrospora (strain ATCC MYA-333 / DSM 997 / K(L3346) / K-hell) GN=KEX1 PE=3 SV=2 596 935 3.0E-36
sp|E9ESM3|KEX1_METRA Pheromone-processing carboxypeptidase KEX1 OS=Metarhizium robertsii (strain ARSEF 23 / ATCC MYA-3075) GN=KEX1 PE=3 SV=1 596 929 4.0E-36
sp|E9E1Z2|KEX1_METAQ Pheromone-processing carboxypeptidase KEX1 OS=Metarhizium acridum (strain CQMa 102) GN=KEX1 PE=3 SV=1 596 929 8.0E-36
sp|Q84WF0|SCP37_ARATH Serine carboxypeptidase-like 37 OS=Arabidopsis thaliana GN=SCPL37 PE=2 SV=2 573 951 9.0E-36
sp|Q9FH05|SCP42_ARATH Serine carboxypeptidase-like 42 OS=Arabidopsis thaliana GN=SCPL42 PE=2 SV=1 597 953 9.0E-36
sp|Q9SV02|SCP39_ARATH Serine carboxypeptidase-like 39 OS=Arabidopsis thaliana GN=SCPL39 PE=2 SV=1 595 756 1.0E-35
sp|B5RUL7|KEX1_DEBHA Pheromone-processing carboxypeptidase KEX1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=KEX1 PE=3 SV=1 608 935 1.0E-35
sp|C9WMM5|VCP_APIME Venom serine carboxypeptidase OS=Apis mellifera PE=2 SV=1 593 953 2.0E-35
sp|C4JTD3|KEX1_UNCRE Pheromone-processing carboxypeptidase KEX1 OS=Uncinocarpus reesii (strain UAMH 1704) GN=KEX1 PE=3 SV=1 596 935 2.0E-35
sp|Q9LEY1|SCP35_ARATH Serine carboxypeptidase-like 35 OS=Arabidopsis thaliana GN=SCPL35 PE=2 SV=1 597 912 2.0E-35
sp|Q2GYB7|KEX1_CHAGB Pheromone-processing carboxypeptidase KEX1 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=KEX1 PE=3 SV=1 596 935 2.0E-35
sp|A5DAT0|KEX1_PICGU Pheromone-processing carboxypeptidase KEX1 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=KEX1 PE=3 SV=2 608 932 3.0E-35
sp|Q9LSV8|SCP21_ARATH Serine carboxypeptidase-like 21 OS=Arabidopsis thaliana GN=SCPL21 PE=2 SV=2 588 951 4.0E-35
sp|Q5J6J2|SCPB_TRIRU Carboxypeptidase S1 homolog B OS=Trichophyton rubrum GN=SCPB PE=1 SV=1 594 953 5.0E-35
sp|Q9SV04|SCP36_ARATH Serine carboxypeptidase-like 36 OS=Arabidopsis thaliana GN=SCPL36 PE=2 SV=1 595 951 5.0E-35
sp|Q1K722|KEX1_NEUCR Pheromone-processing carboxypeptidase kex1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=kex1 PE=3 SV=2 596 935 7.0E-35
sp|Q1PF08|SCP22_ARATH Serine carboxypeptidase-like 22 OS=Arabidopsis thaliana GN=SCPL22 PE=2 SV=1 598 951 7.0E-35
sp|Q4PSY2|SCP32_ARATH Serine carboxypeptidase-like 32 OS=Arabidopsis thaliana GN=SCPL32 PE=2 SV=1 595 951 9.0E-35
sp|Q9M9Q6|SCP50_ARATH Serine carboxypeptidase-like 50 OS=Arabidopsis thaliana GN=SCPL50 PE=2 SV=1 600 938 2.0E-34
sp|Q09991|YSS2_CAEEL Uncharacterized serine carboxypeptidase K10B2.2 OS=Caenorhabditis elegans GN=K10B2.2 PE=3 SV=1 598 928 2.0E-34
sp|Q0WRX3|SCP40_ARATH Serine carboxypeptidase-like 40 OS=Arabidopsis thaliana GN=SCPL40 PE=2 SV=2 563 951 3.0E-34
sp|Q9FH06|SCP41_ARATH Serine carboxypeptidase-like 41 OS=Arabidopsis thaliana GN=SCPL41 PE=2 SV=1 597 921 4.0E-34
sp|Q8VY01|SCP46_ARATH Serine carboxypeptidase-like 46 OS=Arabidopsis thaliana GN=SCPL46 PE=2 SV=1 597 956 4.0E-34
sp|C5FW30|SPCA_ARTOC Carboxypeptidase S1 homolog A OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=SCPA PE=3 SV=1 613 952 4.0E-34
sp|Q949Q7|SCP29_ARATH Serine carboxypeptidase-like 29 OS=Arabidopsis thaliana GN=SCPL29 PE=2 SV=1 569 951 5.0E-34
sp|Q9D3S9|CPVL_MOUSE Probable serine carboxypeptidase CPVL OS=Mus musculus GN=Cpvl PE=2 SV=2 597 977 6.0E-34
sp|A6QX86|KEX1_AJECN Pheromone-processing carboxypeptidase KEX1 OS=Ajellomyces capsulatus (strain NAm1 / WU24) GN=KEX1 PE=3 SV=1 596 935 6.0E-34
sp|Q6FTM9|KEX1_CANGA Pheromone-processing carboxypeptidase KEX1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=KEX1 PE=3 SV=1 597 935 6.0E-34
sp|Q9LSM9|SCP33_ARATH Serine carboxypeptidase-like 33 OS=Arabidopsis thaliana GN=SCPL33 PE=2 SV=2 596 946 7.0E-34
sp|O60123|KEX1_SCHPO Pheromone-processing carboxypeptidase kex1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=kex1 PE=3 SV=1 597 941 7.0E-34
sp|Q9ZUG3|SCP38_ARATH Serine carboxypeptidase-like 38 OS=Arabidopsis thaliana GN=SCPL38 PE=2 SV=1 566 912 7.0E-34
sp|C4Y8B4|KEX1_CLAL4 Pheromone-processing carboxypeptidase KEX1 OS=Clavispora lusitaniae (strain ATCC 42720) GN=KEX1 PE=3 SV=1 608 937 9.0E-34
sp|A8NYP0|KEX1_COPC7 Pheromone-processing carboxypeptidase KEX1 OS=Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003) GN=KEX1 PE=3 SV=1 606 933 1.0E-33
sp|P08819|CBP2_WHEAT Serine carboxypeptidase 2 OS=Triticum aestivum GN=CBP2 PE=1 SV=2 588 951 2.0E-33
sp|Q9LXY6|SCP53_ARATH Putative serine carboxypeptidase-like 53 OS=Arabidopsis thaliana GN=SCPL53 PE=5 SV=1 571 732 2.0E-33
sp|A7UKV5|SPCA_TRIEQ Carboxypeptidase S1 homolog A OS=Trichophyton equinum GN=SCPA PE=3 SV=1 611 939 2.0E-33
sp|B6V867|SCPA_TRITO Carboxypeptidase S1 homolog A OS=Trichophyton tonsurans GN=SCPA PE=3 SV=1 611 939 3.0E-33
sp|C4QZV7|KEX1_PICPG Pheromone-processing carboxypeptidase KEX1 OS=Komagataella pastoris (strain GS115 / ATCC 20864) GN=KEX1 PE=3 SV=1 606 935 3.0E-33
sp|O74702|KEX1_PICPA Pheromone-processing carboxypeptidase KEX1 OS=Komagataella pastoris GN=KEX1 PE=3 SV=1 606 935 3.0E-33
sp|Q9H3G5|CPVL_HUMAN Probable serine carboxypeptidase CPVL OS=Homo sapiens GN=CPVL PE=1 SV=2 595 942 4.0E-33
sp|P52717|YUW5_CAEEL Uncharacterized serine carboxypeptidase F41C3.5 OS=Caenorhabditis elegans GN=F41C3.5 PE=1 SV=1 595 946 5.0E-33
sp|P08818|CBP2_HORVU Serine carboxypeptidase 2 OS=Hordeum vulgare GN=CBP2 PE=1 SV=2 599 914 7.0E-33
sp|Q8TZC4|RFCS_METKA Replication factor C small subunit OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=rfcS PE=3 SV=1 1072 1342 8.0E-33
sp|C5DLM9|KEX1_LACTC Pheromone-processing carboxypeptidase KEX1 OS=Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284) GN=KEX1 PE=3 SV=1 605 935 9.0E-33
sp|A7TLB3|KEX1_VANPO Pheromone-processing carboxypeptidase KEX1 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=KEX1 PE=3 SV=1 605 941 9.0E-33
sp|Q4P8U8|KEX1_USTMA Pheromone-processing carboxypeptidase KEX1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=KEX1 PE=3 SV=1 608 936 2.0E-32
sp|D0MVS1|KEX1_PHYIT Pheromone-processing carboxypeptidase KEX1 OS=Phytophthora infestans (strain T30-4) GN=KEX1 PE=3 SV=1 596 938 2.0E-32
sp|Q4QR71|CPVL_RAT Probable serine carboxypeptidase CPVL OS=Rattus norvegicus GN=CPVL PE=2 SV=1 597 915 3.0E-32
sp|Q5RFE4|CPVL_PONAB Probable serine carboxypeptidase CPVL OS=Pongo abelii GN=CPVL PE=2 SV=1 591 959 3.0E-32
sp|Q5AFP8|KEX1_CANAL Pheromone-processing carboxypeptidase KEX1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=KEX1 PE=3 SV=1 609 935 4.0E-32
sp|C4YTG0|KEX1_CANAW Pheromone-processing carboxypeptidase KEX1 OS=Candida albicans (strain WO-1) GN=KEX1 PE=3 SV=1 609 935 5.0E-32
sp|D4DD24|SCPA_TRIVH Carboxypeptidase S1 homolog A OS=Trichophyton verrucosum (strain HKI 0517) GN=SCPA PE=3 SV=1 611 939 9.0E-32
sp|D4AIF1|SCPA_ARTBC Carboxypeptidase S1 homolog A OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=SCPA PE=3 SV=1 611 939 1.0E-31
sp|Q8VXX4|RFC3_ARATH Replication factor C subunit 3 OS=Arabidopsis thaliana GN=RFC3 PE=2 SV=1 1004 1271 1.0E-31
sp|Q5J6J1|SPCA_TRIRU Carboxypeptidase S1 homolog A OS=Trichophyton rubrum GN=SCPA PE=1 SV=1 611 953 1.0E-31
sp|B9WJJ7|KEX1_CANDC Pheromone-processing carboxypeptidase KEX1 OS=Candida dubliniensis (strain CD36 / ATCC MYA-646 / CBS 7987 / NCPF 3949 / NRRL Y-17841) GN=KEX1 PE=3 SV=1 609 935 2.0E-31
sp|C1GP85|KEX1_PARBA Pheromone-processing carboxypeptidase KEX1 OS=Paracoccidioides lutzii (strain ATCC MYA-826 / Pb01) GN=KEX1 PE=3 SV=1 596 935 3.0E-31
sp|D4AQ54|SCPC_ARTBC Carboxypeptidase Y homolog ARB_06361 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_06361 PE=1 SV=1 566 939 3.0E-31
sp|D4AP52|SCPB_ARTBC Carboxypeptidase S1 homolog B OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=SCPB PE=3 SV=1 594 953 4.0E-31
sp|Q84W27|SCP43_ARATH Serine carboxypeptidase-like 43 OS=Arabidopsis thaliana GN=SCPL43 PE=2 SV=1 597 912 5.0E-31
sp|C0SGJ2|KEX1_PARBP Pheromone-processing carboxypeptidase KEX1 OS=Paracoccidioides brasiliensis (strain Pb03) GN=KEX1 PE=3 SV=1 596 935 8.0E-31
sp|C1G2I2|KEX1_PARBD Pheromone-processing carboxypeptidase KEX1 OS=Paracoccidioides brasiliensis (strain Pb18) GN=KEX1 PE=3 SV=1 596 935 9.0E-31
sp|C5DT72|KEX1_ZYGRC Pheromone-processing carboxypeptidase KEX1 OS=Zygosaccharomyces rouxii (strain ATCC 2623 / CBS 732 / NBRC 1130 / NCYC 568 / NRRL Y-229) GN=KEX1 PE=3 SV=1 599 935 1.0E-30
sp|O81009|SCP12_ARATH Serine carboxypeptidase-like 12 OS=Arabidopsis thaliana GN=SCPL12 PE=2 SV=1 609 951 2.0E-30
sp|Q41005|CBPX_PEA Serine carboxypeptidase-like (Fragment) OS=Pisum sativum PE=2 SV=1 723 935 2.0E-30
sp|P37890|CBP1_ORYSJ Serine carboxypeptidase 1 OS=Oryza sativa subsp. japonica GN=CBP1 PE=2 SV=1 585 927 3.0E-30
sp|Q9CAU2|SCP5_ARATH Serine carboxypeptidase-like 5 OS=Arabidopsis thaliana GN=SCPL5 PE=2 SV=2 600 951 4.0E-30
sp|Q8RWJ6|SCP1_ARATH Serine carboxypeptidase-like 1 OS=Arabidopsis thaliana GN=SCPL1 PE=2 SV=1 585 951 4.0E-30
sp|Q9CAU1|SCP3_ARATH Serine carboxypeptidase-like 3 OS=Arabidopsis thaliana GN=SCPL3 PE=2 SV=1 585 951 5.0E-30
sp|Q5UQ47|RFCS1_MIMIV Putative replication factor C small subunit R395 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R395 PE=3 SV=1 1000 1269 6.0E-30
sp|Q8H780|SCP13_ARATH Serine carboxypeptidase-like 13 OS=Arabidopsis thaliana GN=SCPL13 PE=2 SV=2 600 951 9.0E-30
sp|P09620|KEX1_YEAST Pheromone-processing carboxypeptidase KEX1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KEX1 PE=1 SV=1 607 940 9.0E-30
sp|C5MFP8|KEX1_CANTT Pheromone-processing carboxypeptidase KEX1 OS=Candida tropicalis (strain ATCC MYA-3404 / T1) GN=KEX1 PE=3 SV=1 608 935 1.0E-29
sp|E7NHF8|KEX1_YEASO Pheromone-processing carboxypeptidase KEX1 OS=Saccharomyces cerevisiae (strain FostersO) GN=KEX1 PE=3 SV=1 607 940 1.0E-29
sp|C8Z852|KEX1_YEAS8 Pheromone-processing carboxypeptidase KEX1 OS=Saccharomyces cerevisiae (strain Lalvin EC1118 / Prise de mousse) GN=KEX1 PE=3 SV=1 607 940 1.0E-29
sp|D4B5L8|KEX1_ARTBC Pheromone-processing carboxypeptidase KEX1 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=KEX1 PE=3 SV=1 640 935 1.0E-29
sp|E6R6G5|KEX1_CRYGW Pheromone-processing carboxypeptidase KEX1 OS=Cryptococcus gattii serotype B (strain WM276 / ATCC MYA-4071) GN=KEX1 PE=3 SV=1 608 990 1.0E-29
sp|P07519|CBP1_HORVU Serine carboxypeptidase 1 OS=Hordeum vulgare GN=CBP1 PE=1 SV=4 597 862 1.0E-29
sp|C7GWZ2|KEX1_YEAS2 Pheromone-processing carboxypeptidase KEX1 OS=Saccharomyces cerevisiae (strain JAY291) GN=KEX1 PE=3 SV=1 609 940 1.0E-29
sp|P42660|VCP_AEDAE Vitellogenic carboxypeptidase OS=Aedes aegypti GN=VCP PE=1 SV=3 593 938 2.0E-29
sp|Q852K3|RFC5_ORYSJ Replication factor C subunit 5 OS=Oryza sativa subsp. japonica GN=RFC5 PE=2 SV=1 1004 1259 3.0E-29
sp|P52716|YPP3_CAEEL Uncharacterized serine carboxypeptidase F32A5.3 OS=Caenorhabditis elegans GN=F32A5.3 PE=1 SV=1 588 760 4.0E-29
sp|Q6CKK4|KEX1_KLULA Pheromone-processing carboxypeptidase KEX1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=KEX1 PE=3 SV=1 609 939 5.0E-29
sp|Q752M5|KEX1_ASHGO Pheromone-processing carboxypeptidase KEX1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=KEX1 PE=3 SV=1 603 938 6.0E-29
sp|P52719|PEPS_ASPPH Carboxypeptidase cpdS OS=Aspergillus phoenicis GN=cpdS PE=1 SV=1 565 943 1.0E-28
sp|Q8RUW5|SCP8_ARATH Serine carboxypeptidase-like 8 OS=Arabidopsis thaliana GN=SCPL8 PE=1 SV=2 600 951 1.0E-28
sp|Q9C7D6|SCP17_ARATH Serine carboxypeptidase-like 17 OS=Arabidopsis thaliana GN=SCPL17 PE=2 SV=1 600 952 1.0E-28
sp|Q2TBV1|RFC3_BOVIN Replication factor C subunit 3 OS=Bos taurus GN=RFC3 PE=2 SV=1 1004 1271 2.0E-28
sp|Q9SQX6|SCP7_ARATH Serine carboxypeptidase-like 7 OS=Arabidopsis thaliana GN=SCPL7 PE=2 SV=1 600 929 2.0E-28
sp|Q9CAU3|SCP2_ARATH Serine carboxypeptidase-like 2 OS=Arabidopsis thaliana GN=SCPL2 PE=2 SV=1 600 951 2.0E-28
sp|Q9C7D4|SCP16_ARATH Serine carboxypeptidase-like 16 OS=Arabidopsis thaliana GN=SCPL16 PE=2 SV=1 600 929 2.0E-28
sp|D4AZG9|SCPE_ARTBC Carboxypeptidase Y homolog ARB_06361 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_01587 PE=3 SV=1 594 935 2.0E-28
sp|P40938|RFC3_HUMAN Replication factor C subunit 3 OS=Homo sapiens GN=RFC3 PE=1 SV=2 1004 1271 1.0E-27
sp|Q8R323|RFC3_MOUSE Replication factor C subunit 3 OS=Mus musculus GN=Rfc3 PE=1 SV=1 1004 1271 2.0E-27
sp|Q9C7Z9|SCP18_ARATH Serine carboxypeptidase-like 18 OS=Arabidopsis thaliana GN=SCPL18 PE=2 SV=2 600 951 2.0E-27
sp|Q2V465|SCP11_ARATH Serine carboxypeptidase-like 11 OS=Arabidopsis thaliana GN=SCPL11 PE=2 SV=2 600 951 3.0E-27
sp|Q9C7D2|SCP15_ARATH Serine carboxypeptidase-like 15 OS=Arabidopsis thaliana GN=SCPL15 PE=2 SV=2 600 951 6.0E-27
sp|Q54BN3|RFC3_DICDI Probable replication factor C subunit 3 OS=Dictyostelium discoideum GN=rfc3 PE=3 SV=1 1004 1229 9.0E-27
sp|Q869Q8|CPVL_DICDI Probable serine carboxypeptidase CPVL OS=Dictyostelium discoideum GN=cpvl PE=3 SV=1 599 935 1.0E-26
sp|P52708|HNLS_SORBI P-(S)-hydroxymandelonitrile lyase OS=Sorghum bicolor PE=1 SV=2 599 935 1.0E-26
sp|Q9CAU4|SCP4_ARATH Serine carboxypeptidase-like 4 OS=Arabidopsis thaliana GN=SCPL4 PE=2 SV=1 600 951 3.0E-26
sp|O64811|SCP9_ARATH Serine carboxypeptidase-like 9 OS=Arabidopsis thaliana GN=SCPL9 PE=2 SV=1 611 951 3.0E-26
sp|A5E751|KEX1_LODEL Pheromone-processing carboxypeptidase KEX1 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=KEX1 PE=3 SV=1 608 941 3.0E-26
sp|Q9CAU0|SCP6_ARATH Serine carboxypeptidase-like 6 OS=Arabidopsis thaliana GN=SCPL6 PE=2 SV=2 585 951 8.0E-26
sp|D4AQA7|PEPS_ARTBC Probable serine carboxypeptidase ARB_06414 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_06414 PE=1 SV=1 610 943 1.0E-25
sp|O64810|SCP10_ARATH Serine carboxypeptidase-like 10 OS=Arabidopsis thaliana GN=SCPL10 PE=2 SV=1 609 951 3.0E-25
sp|P32825|SXA2_SCHPO Carboxypeptidase sxa2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sxa2 PE=2 SV=1 599 942 7.0E-25
sp|P38251|RFC5_YEAST Replication factor C subunit 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RFC5 PE=1 SV=1 1004 1215 3.0E-24
sp|Q9C7D3|SCP14_ARATH Serine carboxypeptidase-like 14 OS=Arabidopsis thaliana GN=SCPL14 PE=2 SV=1 600 951 2.0E-23
sp|Q8VZU3|SCP19_ARATH Serine carboxypeptidase-like 19 OS=Arabidopsis thaliana GN=SCPL19 PE=1 SV=1 585 929 5.0E-23
sp|D4B0Q6|SCPD_ARTBC Carboxypeptidase Y homolog ARB_02032 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_02032 PE=3 SV=2 571 745 7.0E-23
sp|A5UMF4|RFCL_METS3 Replication factor C large subunit OS=Methanobrevibacter smithii (strain PS / ATCC 35061 / DSM 861) GN=rfcL PE=3 SV=1 1004 1215 2.0E-22
sp|O94697|RFC5_SCHPO Replication factor C subunit 5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rfc5 PE=1 SV=1 1004 1220 1.0E-21
sp|Q8X082|RFC5_NEUCR Replication factor C subunit 5 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=B14D6.460 PE=3 SV=1 1005 1284 2.0E-21
sp|Q9M2G7|LPPD_ARATH Lipid phosphate phosphatase delta OS=Arabidopsis thaliana GN=LPPD PE=2 SV=1 57 275 3.0E-21
sp|Q9FFB2|SCP54_ARATH Putative serine carboxypeptidase-like 54 OS=Arabidopsis thaliana GN=SCPL54 PE=5 SV=1 581 739 5.0E-21
sp|O29072|RFCL_ARCFU Replication factor C large subunit OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=rfcL PE=1 SV=1 1004 1215 9.0E-21
sp|Q920A5|RISC_MOUSE Retinoid-inducible serine carboxypeptidase OS=Mus musculus GN=Scpep1 PE=1 SV=2 608 962 2.0E-20
sp|P52714|YXD2_CAEEL Uncharacterized serine carboxypeptidase C08H9.1 OS=Caenorhabditis elegans GN=C08H9.1 PE=1 SV=1 588 924 2.0E-20
sp|Q9HB40|RISC_HUMAN Retinoid-inducible serine carboxypeptidase OS=Homo sapiens GN=SCPEP1 PE=1 SV=1 608 962 3.0E-20
sp|Q5V1F7|RFCL_HALMA Replication factor C large subunit OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=rfcL PE=3 SV=1 1002 1251 2.0E-19
sp|Q8Q084|RFCL_METMA Replication factor C large subunit OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=rfcL PE=3 SV=1 1001 1226 6.0E-19
sp|Q920A6|RISC_RAT Retinoid-inducible serine carboxypeptidase OS=Rattus norvegicus GN=Scpep1 PE=2 SV=1 609 962 2.0E-18
sp|P52718|PEPF_ASPNG Serine-type carboxypeptidase F OS=Aspergillus niger GN=pepF PE=1 SV=3 568 938 2.0E-18
sp|A7I781|RFCL_METB6 Replication factor C large subunit OS=Methanoregula boonei (strain 6A8) GN=rfcL PE=3 SV=1 1002 1235 3.0E-18
sp|Q46AT6|RFCL_METBF Replication factor C large subunit OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=rfcL PE=3 SV=1 1001 1216 5.0E-18
sp|Q9V2G4|RFCS_PYRAB Replication factor C small subunit OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=rfcS PE=1 SV=1 1043 1146 6.0E-18
sp|Q2FQR4|RFCL_METHJ Replication factor C large subunit OS=Methanospirillum hungatei JF-1 (strain ATCC 27890 / DSM 864 / NBRC 100397 / JF-1) GN=rfcL PE=3 SV=1 1002 1215 1.0E-17
sp|Q8TPU4|RFCL_METAC Replication factor C large subunit OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=rfcL PE=3 SV=1 1001 1223 1.0E-17
sp|Q975D4|RFCL_SULTO Replication factor C large subunit OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=rfcL PE=3 SV=2 1002 1215 4.0E-17
sp|Q9V2G3|RFCL_PYRAB Replication factor C large subunit OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=rfcL PE=1 SV=3 1002 1214 5.0E-17
sp|A9A6N2|RFCL_METM6 Replication factor C large subunit OS=Methanococcus maripaludis (strain C6 / ATCC BAA-1332) GN=rfcL PE=3 SV=1 1004 1268 2.0E-16
sp|Q58817|RFCS_METJA Replication factor C small subunit OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=rfcS PE=3 SV=1 1149 1342 2.0E-16
sp|Q2NH88|RFCL_METST Replication factor C large subunit OS=Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3) GN=rfcL PE=3 SV=1 1002 1216 2.0E-16
sp|A0B6D7|RFCL_METTP Replication factor C large subunit OS=Methanosaeta thermophila (strain DSM 6194 / JCM 14653 / NBRC 101360 / PT) GN=rfcL PE=3 SV=1 1004 1224 2.0E-16
sp|O57853|RFCL_PYRHO Replication factor C large subunit OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=rfcL PE=3 SV=1 1002 1214 2.0E-16
sp|Q9UWR2|RFCL_PYRFU Replication factor C large subunit OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=rfcL PE=1 SV=1 1002 1214 2.0E-16
sp|Q4JAB1|RFCL_SULAC Replication factor C large subunit OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=rfcL PE=3 SV=1 1002 1214 3.0E-16
sp|Q5JHP1|RFCL_THEKO Replication factor C large subunit OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=rfcL PE=1 SV=1 1002 1214 3.0E-16
sp|A1RWU6|RFCL_THEPD Replication factor C large subunit OS=Thermofilum pendens (strain Hrk 5) GN=rfcL PE=3 SV=1 1002 1215 4.0E-16
sp|Q12TX1|RFCL_METBU Replication factor C large subunit OS=Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M) GN=rfcL PE=3 SV=1 1000 1216 5.0E-16
sp|A6VIW1|RFCL_METM7 Replication factor C large subunit OS=Methanococcus maripaludis (strain C7 / ATCC BAA-1331) GN=rfcL PE=3 SV=1 1004 1268 1.0E-15
sp|A6URV8|RFCL_METVS Replication factor C large subunit OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=rfcL PE=3 SV=1 1004 1215 2.0E-15
sp|A2SQR6|RFCL_METLZ Replication factor C large subunit OS=Methanocorpusculum labreanum (strain ATCC 43576 / DSM 4855 / Z) GN=rfcL PE=3 SV=1 1002 1213 2.0E-15
sp|Q3ISA5|RFCL_NATPD Replication factor C large subunit OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=rfcL PE=3 SV=1 1004 1215 2.0E-15
sp|A3CTR4|RFCL_METMJ Replication factor C large subunit OS=Methanoculleus marisnigri (strain ATCC 35101 / DSM 1498 / JR1) GN=rfcL PE=3 SV=1 1002 1253 2.0E-15
sp|A4FZL6|RFCL_METM5 Replication factor C large subunit OS=Methanococcus maripaludis (strain C5 / ATCC BAA-1333) GN=rfcL PE=3 SV=1 1004 1216 4.0E-15
sp|A6UWR5|RFCL_META3 Replication factor C large subunit OS=Methanococcus aeolicus (strain Nankai-3 / ATCC BAA-1280) GN=rfcL PE=3 SV=1 1004 1221 5.0E-15
sp|Q55A00|SSPA_DICDI Probable sphingosine-1-phosphate phosphatase OS=Dictyostelium discoideum GN=sppA PE=3 SV=1 33 282 1.0E-14
sp|O26342|RFCL_METTH Replication factor C large subunit OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=rfcL PE=1 SV=1 1002 1215 1.0E-14
sp|Q6M0E9|RFCL_METMP Replication factor C large subunit OS=Methanococcus maripaludis (strain S2 / LL) GN=rfcL PE=3 SV=1 1004 1268 1.0E-14
sp|Q9UXF6|RFCL_SULSO Replication factor C large subunit OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=rfcL PE=1 SV=1 1002 1215 2.0E-14
sp|Q9HPI4|RFCL_HALSA Replication factor C large subunit OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=rfcL PE=3 SV=2 1002 1292 2.0E-14
sp|B0R601|RFCL_HALS3 Replication factor C large subunit OS=Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1) GN=rfcL PE=3 SV=1 1002 1292 2.0E-14
sp|Q58294|RFCL_METJA Replication factor C large subunit OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=rfcL PE=1 SV=1 1002 1219 2.0E-14
sp|Q18GQ9|RFCL_HALWD Replication factor C large subunit OS=Haloquadratum walsbyi (strain DSM 16790 / HBSQ001) GN=rfcL PE=3 SV=1 1004 1214 3.0E-14
sp|C4KHA7|RFCL_SULIK Replication factor C large subunit OS=Sulfolobus islandicus (strain M.16.4 / Kamchatka #3) GN=rfcL PE=3 SV=1 1002 1215 4.0E-14
sp|A3DNV8|RFCL_STAMF Replication factor C large subunit OS=Staphylothermus marinus (strain ATCC 43588 / DSM 3639 / JCM 9404 / F1) GN=rfcL PE=3 SV=1 1002 1216 6.0E-14
sp|C3MVD2|RFCL_SULIM Replication factor C large subunit OS=Sulfolobus islandicus (strain M.14.25 / Kamchatka #1) GN=rfcL PE=3 SV=1 1002 1215 9.0E-14
sp|C3N5N1|RFCL_SULIA Replication factor C large subunit OS=Sulfolobus islandicus (strain M.16.27) GN=rfcL PE=3 SV=1 1002 1215 9.0E-14
sp|Q9V2G4|RFCS_PYRAB Replication factor C small subunit OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=rfcS PE=1 SV=1 1149 1340 1.0E-13
sp|C3NE95|RFCL_SULIY Replication factor C large subunit OS=Sulfolobus islandicus (strain Y.G.57.14 / Yellowstone #1) GN=rfcL PE=3 SV=1 1002 1215 1.0E-13
sp|C3MQ13|RFCL_SULIL Replication factor C large subunit OS=Sulfolobus islandicus (strain L.S.2.15 / Lassen #1) GN=rfcL PE=3 SV=1 1002 1215 1.0E-13
sp|Q8IWX5|SGPP2_HUMAN Sphingosine-1-phosphate phosphatase 2 OS=Homo sapiens GN=SGPP2 PE=2 SV=1 67 341 2.0E-13
sp|C3NHF4|RFCL_SULIN Replication factor C large subunit OS=Sulfolobus islandicus (strain Y.N.15.51 / Yellowstone #2) GN=rfcL PE=3 SV=1 1002 1215 2.0E-13
sp|Q8TZC5|RFCL_METKA Replication factor C large subunit OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=rfcL PE=3 SV=1 1002 1216 1.0E-12
sp|Q03900|YD132_YEAST Uncharacterized protein YDR132C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YDR132C PE=1 SV=1 1406 1504 1.0E-12
sp|P9WQN1|Y2559_MYCTU Uncharacterized AAA domain-containing protein Rv2559c OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv2559c PE=1 SV=1 1003 1211 1.0E-12
sp|P9WQN0|Y2559_MYCTO Uncharacterized AAA domain-containing protein MT2636 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT2636 PE=3 SV=1 1003 1211 1.0E-12
sp|Q67Y83|SCP51_ARATH Serine carboxypeptidase-like 51 OS=Arabidopsis thaliana GN=SCPL51 PE=2 SV=2 611 756 2.0E-12
sp|O64301|DPA44_BPR69 DNA polymerase accessory protein 44 OS=Enterobacteria phage RB69 GN=44 PE=4 SV=1 1006 1213 4.0E-12
sp|Q0W3P4|RFCL_METAR Replication factor C large subunit OS=Methanocella arvoryzae (strain DSM 22066 / NBRC 105507 / MRE50) GN=rfcL PE=3 SV=1 1000 1220 5.0E-12
sp|Q810K3|SGPP2_MOUSE Sphingosine-1-phosphate phosphatase 2 OS=Mus musculus GN=Sgpp2 PE=2 SV=1 67 332 6.0E-12
sp|B9LPV1|RFCL_HALLT Replication factor C large subunit OS=Halorubrum lacusprofundi (strain ATCC 49239 / DSM 5036 / JCM 8891 / ACAM 34) GN=rfcL PE=3 SV=1 1004 1216 6.0E-12
sp|Q8TZC4|RFCS_METKA Replication factor C small subunit OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=rfcS PE=3 SV=1 1001 1075 7.0E-12
sp|P60373|RFCL_NANEQ Replication factor C large subunit OS=Nanoarchaeum equitans (strain Kin4-M) GN=rfcL PE=3 SV=1 1002 1214 8.0E-12
sp|P04526|DPA44_BPT4 Sliding-clamp-loader gp44 subunit OS=Enterobacteria phage T4 GN=44 PE=1 SV=1 1006 1215 1.0E-11
sp|A1RSA3|RFCL_PYRIL Replication factor C large subunit OS=Pyrobaculum islandicum (strain DSM 4184 / JCM 9189 / GEO3) GN=rfcL PE=3 SV=1 1001 1223 1.0E-11
sp|Q75JU2|WRIP1_DICDI ATPase WRNIP1 OS=Dictyostelium discoideum GN=wrnip1 PE=3 SV=1 1003 1213 2.0E-11
sp|O34528|YRVN_BACSU Uncharacterized AAA domain-containing protein YrvN OS=Bacillus subtilis (strain 168) GN=yrvN PE=3 SV=1 1003 1251 2.0E-11
sp|Q5UQE8|RFCS2_MIMIV Putative replication factor C small subunit L478 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L478 PE=3 SV=1 1004 1223 2.0E-11
sp|P09122|DPO3X_BACSU DNA polymerase III subunit gamma/tau OS=Bacillus subtilis (strain 168) GN=dnaX PE=3 SV=3 1008 1228 3.0E-11
sp|A2BL93|RFCL_HYPBU Replication factor C large subunit OS=Hyperthermus butylicus (strain DSM 5456 / JCM 9403 / PLM1-5) GN=rfcL PE=3 SV=1 1000 1216 3.0E-11
sp|Q9YBS5|RFCL_AERPE Replication factor C large subunit OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=rfcL PE=3 SV=2 994 1216 3.0E-11
sp|Q8ZYK3|RFCL_PYRAE Replication factor C large subunit OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=rfcL PE=3 SV=1 1001 1214 4.0E-11
sp|O60182|RFC1_SCHPO Replication factor C subunit 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rfc1 PE=1 SV=1 997 1223 6.0E-11
sp|P0AAZ4|RARA_ECOLI Replication-associated recombination protein A OS=Escherichia coli (strain K12) GN=rarA PE=1 SV=1 992 1214 7.0E-11
sp|P0AAZ5|RARA_ECOL6 Replication-associated recombination protein A OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=rarA PE=3 SV=1 992 1214 7.0E-11
sp|P0AAZ6|RARA_ECO57 Replication-associated recombination protein A OS=Escherichia coli O157:H7 GN=rarA PE=3 SV=1 992 1214 7.0E-11
sp|B1YC69|RFCL_PYRNV Replication factor C large subunit OS=Pyrobaculum neutrophilum (strain DSM 2338 / JCM 9278 / V24Sta) GN=rfcL PE=3 SV=1 1002 1214 1.0E-10
sp|Q12259|YL108_YEAST BTB/POZ domain-containing protein YLR108C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YLR108C PE=1 SV=1 1407 1491 2.0E-10
sp|O13984|WRIP1_SCHPO ATPase WRNIP1 homolog C26H5.02c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC26H5.02c PE=3 SV=2 1000 1214 5.0E-10
sp|A4WGV3|RFCL_PYRAR Replication factor C large subunit OS=Pyrobaculum arsenaticum (strain DSM 13514 / JCM 11321) GN=rfcL PE=3 SV=1 1001 1214 7.0E-10
sp|Q9WYX8|Y508_THEMA Uncharacterized protein TM_0508 OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=TM_0508 PE=3 SV=1 1003 1219 8.0E-10
sp|A3MS27|RFCL_PYRCJ Replication factor C large subunit OS=Pyrobaculum calidifontis (strain JCM 11548 / VA1) GN=rfcL PE=3 SV=1 1002 1214 1.0E-09
sp|O64728|STI_ARATH Protein STICHEL OS=Arabidopsis thaliana GN=STI PE=1 SV=2 997 1214 1.0E-09
sp|F4HW65|STIL1_ARATH Protein STICHEL-like 1 OS=Arabidopsis thaliana GN=At1g14460 PE=1 SV=1 1006 1214 1.0E-09
sp|P75177|DPO3X_MYCPN DNA polymerase III subunit gamma/tau OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=dnaX PE=3 SV=1 1006 1213 1.0E-09
sp|Q58817|RFCS_METJA Replication factor C small subunit OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=rfcS PE=3 SV=1 1003 1051 2.0E-09
sp|P40151|WRIP1_YEAST DNA-dependent ATPase MGS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MGS1 PE=1 SV=2 1002 1220 2.0E-09
sp|Q9BX95|SGPP1_HUMAN Sphingosine-1-phosphate phosphatase 1 OS=Homo sapiens GN=SGPP1 PE=1 SV=2 63 239 2.0E-09
sp|A8AC24|RFCL_IGNH4 Replication factor C large subunit OS=Ignicoccus hospitalis (strain KIN4/I / DSM 18386 / JCM 14125) GN=rfcL PE=3 SV=1 1001 1216 3.0E-09
sp|Q99P55|SGPP1_RAT Sphingosine-1-phosphate phosphatase 1 OS=Rattus norvegicus GN=Sgpp1 PE=1 SV=2 56 206 3.0E-09
sp|P9WNT9|DPO3X_MYCTU DNA polymerase III subunit gamma/tau OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=dnaX PE=1 SV=1 1007 1213 3.0E-09
sp|P9WNT8|DPO3X_MYCTO DNA polymerase III subunit gamma/tau OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=dnaX PE=3 SV=1 1007 1213 3.0E-09
sp|P63976|DPO3X_MYCBO DNA polymerase III subunit gamma/tau OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=dnaX PE=3 SV=1 1007 1213 3.0E-09
sp|F4JRP8|STIL2_ARATH Protein STICHEL-like 2 OS=Arabidopsis thaliana GN=At4g24790 PE=2 SV=1 1006 1209 4.0E-09
sp|Q9JI99|SGPP1_MOUSE Sphingosine-1-phosphate phosphatase 1 OS=Mus musculus GN=Sgpp1 PE=1 SV=1 67 206 5.0E-09
sp|Q58817|RFCS_METJA Replication factor C small subunit OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=rfcS PE=3 SV=1 1072 1146 6.0E-09
sp|P39918|RARA_COXBU Replication-associated recombination protein A OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=rarA PE=3 SV=3 1000 1214 3.0E-08
sp|P45262|RARA_HAEIN Replication-associated recombination protein A OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=rarA PE=3 SV=1 993 1214 5.0E-08
sp|Q8K983|DPO3X_BUCAP DNA polymerase III subunit gamma OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=dnaX PE=3 SV=1 1007 1226 6.0E-08
sp|O57852|RFCS_PYRHO Replication factor C small subunit OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=rfcS PE=3 SV=1 1003 1051 9.0E-08
sp|Q2R2B4|RFC1_ORYSJ Replication factor C subunit 1 OS=Oryza sativa subsp. japonica GN=RFC1 PE=2 SV=2 970 1214 1.0E-07
sp|Q8U4J3|RFCS_PYRFU Replication factor C small subunit OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=rfcS PE=1 SV=1 1003 1051 2.0E-07
sp|P35601|RFC1_MOUSE Replication factor C subunit 1 OS=Mus musculus GN=Rfc1 PE=1 SV=2 988 1223 2.0E-07
sp|Q9V2G4|RFCS_PYRAB Replication factor C small subunit OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=rfcS PE=1 SV=1 1003 1051 3.0E-07
sp|Q5JHP2|RFCS_THEKO Replication factor C small subunit OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=rfcS PE=1 SV=1 1003 1051 5.0E-07
sp|Q8CG07|WRIP1_RAT ATPase WRNIP1 OS=Rattus norvegicus GN=Wrnip1 PE=1 SV=1 1003 1214 5.0E-07
sp|P38630|RFC1_YEAST Replication factor C subunit 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RFC1 PE=1 SV=1 996 1213 5.0E-07
sp|Q91XU0|WRIP1_MOUSE ATPase WRNIP1 OS=Mus musculus GN=Wrnip1 PE=1 SV=2 1003 1214 6.0E-07
sp|Q18E75|RFCS_HALWD Replication factor C small subunit OS=Haloquadratum walsbyi (strain DSM 16790 / HBSQ001) GN=rfcS PE=3 SV=1 997 1051 1.0E-06
sp|Q97BC2|RFCL_THEVO Replication factor C large subunit OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=rfcL PE=3 SV=1 1002 1223 2.0E-06
sp|P43746|DPO3X_HAEIN DNA polymerase III subunit tau/gamma OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=dnaX PE=3 SV=1 1007 1212 3.0E-06
sp|F4KEM0|STIL4_ARATH Protein STICHEL-like 4 OS=Arabidopsis thaliana GN=At5g45720 PE=2 SV=1 1004 1214 4.0E-06
sp|P35251|RFC1_HUMAN Replication factor C subunit 1 OS=Homo sapiens GN=RFC1 PE=1 SV=4 1000 1223 5.0E-06
sp|Q96S55|WRIP1_HUMAN ATPase WRNIP1 OS=Homo sapiens GN=WRNIP1 PE=1 SV=2 1003 1214 7.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0004185 serine-type carboxypeptidase activity Yes
GO:0016887 ATP hydrolysis activity Yes
GO:0005524 ATP binding Yes
GO:0006508 proteolysis Yes
GO:0004180 carboxypeptidase activity No
GO:0030554 adenyl nucleotide binding No
GO:0008236 serine-type peptidase activity No
GO:0043170 macromolecule metabolic process No
GO:0140096 catalytic activity, acting on a protein No
GO:0032559 adenyl ribonucleotide binding No
GO:0016817 hydrolase activity, acting on acid anhydrides No
GO:0097159 organic cyclic compound binding No
GO:0019538 protein metabolic process No
GO:0008238 exopeptidase activity No
GO:0008152 metabolic process No
GO:0016818 hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides No
GO:0097367 carbohydrate derivative binding No
GO:0003824 catalytic activity No
GO:0036094 small molecule binding No
GO:1901363 heterocyclic compound binding No
GO:0044238 primary metabolic process No
GO:0017171 serine hydrolase activity No
GO:1901564 organonitrogen compound metabolic process No
GO:0008233 peptidase activity No
GO:0006807 nitrogen compound metabolic process No
GO:0000166 nucleotide binding No
GO:0071704 organic substance metabolic process No
GO:0016787 hydrolase activity No
GO:0016462 pyrophosphatase activity No
GO:0032555 purine ribonucleotide binding No
GO:0008150 biological_process No
GO:0005488 binding No
GO:0070008 serine-type exopeptidase activity No
GO:0043168 anion binding No
GO:1901265 nucleoside phosphate binding No
GO:0017111 nucleoside-triphosphatase activity No
GO:0003674 molecular_function No
GO:0032553 ribonucleotide binding No
GO:0043167 ion binding No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0017076 purine nucleotide binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 60 0.45

Transmembrane Domains

Domain # Start End Length
1 66 88 22
2 90 112 22
3 167 189 22
4 194 216 22
5 231 248 17
6 261 278 17
7 298 320 22
8 492 514 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|1671
MSVAESLPSRPQDVPDAGLRSLDHYKRALPHWRYALRQRLLPIIRWETPYVAWMQSKMRTPALDSYFAITANLGT
HTFFMIGLPLLFWCGYASFGKGLVHILALGVFWTGFTKDLLSLPRPLSPPLHRITMSGSAALEYGFPSTHSANAV
SVAVYALLILHSPDNTLSATTKVLFEVLSYFYAASIVFGRLYCGMHGFLDVIVGSLMGAAISWLEFNYGPPLDAY
MHASSWTAPLLAGLVIVILVRIHPEPADDCPCFDDSVAFAGVLIGLELGTWTFGKMPGDPWKTHAYGDNAIDVSP
LGWGTNLARLGFGILVIFLWRETMKPTLLRLLPYLFRSLEQVGWDLPRRFFMPASEYKSVPPGSRLDTLFPKASD
FPRMVESIRHPTTRGRAVSIGPQSAADAYETLAYRERRRRESIGSNSQAKRPSLDSVDEDRSGKAAQASGAEQSP
SPEKAWVNGSGMPPAVQLGDTEMFLQLVRPRVRYDVEVVTKLVVYAGIAGLATACIPIMLEIVGLGTNQLQQVPR
PSSTFVAMRLSALVVGLAVGSEAKKLVPRPDSFWDHVSHSEDVAHLSRRDLSGYTLRSKKSDPARLGIDTVKQYS
GYLDDAANDKHLFYWFFESRNKPESDPVVLWLNGGPGCSSMIGLFTELGPARIPTPDLKPERNPYSWNNNASMIF
LDQPINTGFSYSRGNVDTTAAASRDVLALLSLFFHQFPQYGARQFHVSGESYAGHYIPIIADEILSHPDSGIKLS
SVLIGNGLTDQLTQYRYYRPMACGEGGYPSVLNESTCRAMDEVLPRCEEMIQSCYETGDREKCSAATRECNDSLL
SPYDASGRSMYDVRKASNDEAPDYSDRYLNQPDVMEALGSEVERFSSCSYRINGDFVSSGDWMLPIHRTVPKLLE
RIPVLIYAGDADFICNWLGNRAWTSALEWPGKTEFNGAAVKTLVGGAGEAYGEPRATSDSAMDDDMDVDDGPAPS
NNIVFSSDANKGKRTAANLPVEAEDSLPWVEKYRPTTLDQVSGHGDILATINKFVDSNRLPHLLLYGPPGTGKTS
TILALARRIYGTANMRQMVLELNASDDRGIDVVREQIKTFASTKQIFAMGASGGGRSSAAGFKLIILDEADAMTN
TAQMALRRIMEKYTANTRFCIIANYSHKLSPALLSRCTRFRFSPLSEADIRVLVDRVVEEERVKIGGEAVDALVG
LSKGDMRRALNVLQACHASSTPLRSKTAPKPAADDETKRETITTETIYNCIAAPPPDAIKQMMATLLETTDVTSC
LTTVNSLKTTRGLALADIITALAEQLTRLEVKAEVRIGWLDALAEIEHRVAGGGNETVQTGAVVGAVRNGSLIYG
QSVSNDDGMQGRQPKVVAAVMEEKPLLSSNTDGATLAMASTTPSDGHDLTSAGSRHVLPPDHLFAIQVGHQMFKL
TGASLSSDSPSFFTRHFSQTTDIHRPLYIDRDPDTFRDMELHLQGYHVSARDGTHLVRLLSDAHFYSRACLANCR
QEEEDV*
Coding >Ophun1|1671
ATGAGCGTCGCCGAGTCGCTTCCGTCTCGGCCTCAGGACGTGCCCGATGCCGGTCTTCGGAGCCTCGACCACTAC
AAGCGGGCGCTGCCTCACTGGCGATATGCCCTGCGCCAGCGTCTGCTCCCCATCATTCGCTGGGAGACGCCCTAC
GTCGCTTGGATGCAGAGCAAGATGCGCACCCCGGCCCTCGACAGCTACTTTGCCATCACGGCCAACCTCGGCACC
CATACCTTTTTCATGATCGGACTGCCTCTCCTCTTCTGGTGTGGTTACGCATCGTTTGGCAAGGGACTCGTCCAC
ATCCTCGCCCTCGGCGTCTTCTGGACCGGCTTCACGAAGGACCTCTTGTCGCTGCCACGCCCACTGTCGCCGCCG
CTACACCGCATCACCATGTCCGGATCAGCGGCGCTCGAGTACGGGTTCCCATCGACGCACAGCGCAAATGCCGTC
TCCGTCGCCGTCTACGCCCTCCTCATCCTCCACAGTCCCGACAACACGCTCTCAGCCACGACCAAAGTTCTATTC
GAGGTGCTGTCGTACTTTTACGCCGCCTCCATCGTCTTTGGCCGCCTCTACTGCGGTATGCACGGATTCCTCGAC
GTCATCGTCGGCTCCCTCATGGGCGCCGCCATTAGCTGGCTCGAGTTCAACTATGGCCCGCCCCTCGATGCCTAC
ATGCACGCCAGCTCGTGGACAGCGCCTCTCCTGGCGGGGCTCGTCATCGTCATTCTGGTGCGCATACATCCGGAA
CCGGCAGACGATTGCCCGTGCTTCGACGACAGTGTCGCCTTTGCCGGCGTCCTCATCGGCCTCGAGCTCGGCACA
TGGACCTTTGGCAAGATGCCCGGCGATCCGTGGAAGACGCACGCCTACGGTGACAATGCCATCGACGTCTCCCCG
CTTGGCTGGGGTACAAATCTGGCCAGACTCGGCTTCGGCATCTTGGTCATCTTCCTGTGGCGCGAGACGATGAAG
CCGACGCTTTTGCGGCTGCTGCCCTACCTGTTCCGTAGCCTGGAGCAGGTCGGCTGGGATCTCCCGCGTCGCTTC
TTCATGCCGGCGTCCGAGTACAAGTCGGTCCCTCCCGGGTCCCGGCTCGACACGTTGTTCCCCAAGGCGTCCGAC
TTTCCGCGCATGGTGGAGAGCATCCGGCATCCGACGACACGGGGTAGGGCCGTGTCCATCGGGCCGCAGAGCGCC
GCCGACGCGTACGAGACGCTGGCCTACCGCGAGCGACGCCGGCGCGAGAGCATAGGCAGCAACAGCCAGGCGAAG
CGGCCGTCTCTGGACAGCGTCGACGAGGACCGGTCCGGCAAGGCGGCTCAGGCGTCGGGCGCGGAGCAGTCGCCG
TCCCCCGAAAAGGCGTGGGTCAACGGTTCCGGCATGCCGCCGGCTGTCCAGTTGGGCGATACCGAGATGTTTCTG
CAATTGGTGAGGCCGCGGGTGCGATACGACGTCGAGGTGGTGACGAAGCTGGTCGTCTATGCGGGCATAGCAGGC
CTTGCCACGGCTTGCATCCCCATCATGCTCGAGATTGTCGGCCTCGGCACGAACCAGCTCCAGCAAGTCCCTCGT
CCATCTTCAACGTTCGTCGCCATGCGGCTGTCTGCCCTCGTTGTCGGCTTAGCTGTCGGTTCGGAAGCTAAGAAG
CTGGTTCCCCGGCCGGATAGCTTCTGGGACCACGTCTCTCACAGCGAGGATGTTGCCCATCTGAGCAGAAGGGAC
TTGAGCGGCTACACGCTGCGGAGCAAGAAGAGCGATCCCGCGAGGCTGGGCATCGATACGGTGAAGCAGTATAGC
GGCTATCTCGATGACGCGGCCAACGACAAGCACCTCTTTTACTGGTTCTTTGAGTCCCGCAACAAGCCCGAGTCA
GACCCGGTCGTGCTCTGGCTCAATGGCGGACCCGGCTGCTCTTCCATGATCGGCCTCTTCACCGAGCTGGGACCG
GCGCGGATTCCGACGCCGGATCTAAAGCCAGAGCGGAACCCGTACTCTTGGAACAATAACGCTTCAATGATCTTC
CTCGACCAGCCCATCAACACGGGCTTCTCGTATAGTCGTGGGAACGTGGACACGACGGCGGCGGCGAGTCGAGAT
GTTTTGGCGCTGCTGTCGTTGTTCTTTCATCAGTTTCCGCAGTATGGGGCGAGGCAGTTTCATGTTTCGGGCGAG
TCGTATGCTGGGCATTACATTCCCATCATCGCGGACGAAATCCTCTCCCACCCGGACAGCGGCATCAAGCTTAGC
AGCGTGCTCATCGGCAACGGACTCACCGACCAGCTGACGCAGTATCGTTACTACCGGCCCATGGCCTGCGGGGAG
GGAGGCTATCCTTCCGTCCTGAATGAGAGCACATGCCGGGCCATGGACGAGGTGCTTCCGCGGTGTGAGGAAATG
ATCCAGTCGTGCTACGAGACGGGTGATCGGGAAAAGTGTTCGGCTGCTACGCGCGAATGCAACGACTCCCTGCTG
AGCCCATACGACGCATCGGGCCGGAGCATGTACGATGTCCGCAAGGCGAGTAATGACGAGGCGCCCGACTACAGC
GATCGCTACCTCAACCAGCCAGACGTTATGGAAGCGCTCGGCTCCGAAGTCGAAAGGTTCAGCAGCTGCAGCTAT
CGCATCAACGGCGACTTCGTCTCGTCGGGCGACTGGATGCTGCCCATCCACCGGACGGTCCCCAAGCTCCTGGAG
CGCATCCCCGTGCTCATCTACGCCGGAGACGCCGACTTCATCTGCAACTGGCTGGGGAACAGGGCCTGGACCAGC
GCGCTGGAATGGCCTGGCAAGACGGAGTTTAACGGTGCGGCGGTGAAGACGCTGGTTGGGGGTGCGGGTGAAGCG
TATGGTGAGCCTCGCGCAACCTCGGATTCAGCCATGGATGACGATATGGATGTCGACGACGGGCCTGCGCCTTCC
AATAACATTGTCTTTTCGTCTGATGCGAATAAGGGGAAGCGCACGGCTGCGAACCTCCCCGTCGAGGCTGAAGAT
AGCCTGCCATGGGTTGAGAAATACCGTCCAACGACGCTGGATCAGGTCTCGGGTCATGGCGATATCCTGGCGACG
ATTAACAAGTTTGTCGACTCGAATCGGCTTCCTCATCTGCTTCTCTACGGACCGCCTGGGACGGGCAAGACGTCG
ACGATACTGGCGCTCGCGCGGCGCATCTACGGCACGGCCAACATGCGGCAGATGGTCCTCGAGCTGAACGCTTCC
GACGATCGTGGCATCGACGTGGTGCGCGAGCAAATCAAGACATTTGCCAGCACCAAGCAGATCTTCGCCATGGGA
GCTTCAGGCGGTGGTCGGTCCTCGGCAGCGGGCTTCAAGCTCATCATCCTCGACGAGGCCGACGCCATGACGAAC
ACGGCGCAGATGGCGCTGCGGCGCATCATGGAAAAGTACACGGCCAACACGAGGTTCTGCATCATTGCAAACTAC
TCGCACAAGCTGAGCCCGGCGCTGCTGAGCCGCTGTACGCGCTTTCGCTTCAGTCCCTTGTCTGAGGCAGATATT
CGCGTCCTGGTCGACAGGGTGGTGGAGGAGGAAAGGGTCAAGATTGGGGGGGAGGCTGTTGATGCCCTCGTCGGG
CTGAGTAAGGGGGATATGAGGAGGGCGCTCAACGTGCTGCAGGCTTGCCACGCGTCGAGCACCCCCCTGCGATCC
AAGACGGCGCCCAAACCGGCAGCGGACGACGAGACAAAGCGGGAGACGATCACGACGGAGACCATCTACAACTGC
ATCGCAGCGCCACCGCCCGACGCCATCAAGCAGATGATGGCGACGCTTCTGGAGACGACGGACGTGACGAGCTGC
CTGACGACGGTCAACTCGCTCAAGACGACGCGGGGGCTCGCGCTGGCGGATATCATCACGGCGTTGGCGGAGCAG
CTGACTCGGCTCGAGGTCAAGGCTGAGGTGCGTATCGGCTGGTTGGATGCGCTGGCTGAGATTGAGCATCGGGTT
GCGGGGGGGGGGAATGAGACGGTTCAGACGGGGGCTGTGGTGGGAGCTGTGCGGAACGGGTCGCTGATATACGGC
CAATCTGTCAGCAATGATGACGGGATGCAGGGTAGGCAGCCAAAGGTGGTAGCCGCCGTCATGGAGGAGAAACCA
CTCCTCTCTTCCAACACAGACGGAGCAACTCTCGCCATGGCTTCGACGACCCCCAGTGATGGTCACGACTTGACG
TCAGCCGGGTCCAGACACGTGCTGCCTCCCGACCACCTGTTCGCCATCCAGGTCGGACACCAGATGTTCAAGTTG
ACGGGCGCCTCACTATCCTCCGACTCTCCATCGTTCTTCACGCGACACTTCTCGCAAACGACAGACATCCATCGC
CCGCTCTACATCGACCGCGACCCGGACACGTTCCGTGACATGGAGCTGCATCTTCAAGGCTACCACGTCAGCGCC
AGGGATGGAACGCACCTGGTGCGACTCCTGTCCGATGCGCATTTCTACAGCCGTGCGTGCCTCGCAAACTGCAGA
CAAGAAGAGGAAGATGTCTAG
Transcript >Ophun1|1671
ATGAGCGTCGCCGAGTCGCTTCCGTCTCGGCCTCAGGACGTGCCCGATGCCGGTCTTCGGAGCCTCGACCACTAC
AAGCGGGCGCTGCCTCACTGGCGATATGCCCTGCGCCAGCGTCTGCTCCCCATCATTCGCTGGGAGACGCCCTAC
GTCGCTTGGATGCAGAGCAAGATGCGCACCCCGGCCCTCGACAGCTACTTTGCCATCACGGCCAACCTCGGCACC
CATACCTTTTTCATGATCGGACTGCCTCTCCTCTTCTGGTGTGGTTACGCATCGTTTGGCAAGGGACTCGTCCAC
ATCCTCGCCCTCGGCGTCTTCTGGACCGGCTTCACGAAGGACCTCTTGTCGCTGCCACGCCCACTGTCGCCGCCG
CTACACCGCATCACCATGTCCGGATCAGCGGCGCTCGAGTACGGGTTCCCATCGACGCACAGCGCAAATGCCGTC
TCCGTCGCCGTCTACGCCCTCCTCATCCTCCACAGTCCCGACAACACGCTCTCAGCCACGACCAAAGTTCTATTC
GAGGTGCTGTCGTACTTTTACGCCGCCTCCATCGTCTTTGGCCGCCTCTACTGCGGTATGCACGGATTCCTCGAC
GTCATCGTCGGCTCCCTCATGGGCGCCGCCATTAGCTGGCTCGAGTTCAACTATGGCCCGCCCCTCGATGCCTAC
ATGCACGCCAGCTCGTGGACAGCGCCTCTCCTGGCGGGGCTCGTCATCGTCATTCTGGTGCGCATACATCCGGAA
CCGGCAGACGATTGCCCGTGCTTCGACGACAGTGTCGCCTTTGCCGGCGTCCTCATCGGCCTCGAGCTCGGCACA
TGGACCTTTGGCAAGATGCCCGGCGATCCGTGGAAGACGCACGCCTACGGTGACAATGCCATCGACGTCTCCCCG
CTTGGCTGGGGTACAAATCTGGCCAGACTCGGCTTCGGCATCTTGGTCATCTTCCTGTGGCGCGAGACGATGAAG
CCGACGCTTTTGCGGCTGCTGCCCTACCTGTTCCGTAGCCTGGAGCAGGTCGGCTGGGATCTCCCGCGTCGCTTC
TTCATGCCGGCGTCCGAGTACAAGTCGGTCCCTCCCGGGTCCCGGCTCGACACGTTGTTCCCCAAGGCGTCCGAC
TTTCCGCGCATGGTGGAGAGCATCCGGCATCCGACGACACGGGGTAGGGCCGTGTCCATCGGGCCGCAGAGCGCC
GCCGACGCGTACGAGACGCTGGCCTACCGCGAGCGACGCCGGCGCGAGAGCATAGGCAGCAACAGCCAGGCGAAG
CGGCCGTCTCTGGACAGCGTCGACGAGGACCGGTCCGGCAAGGCGGCTCAGGCGTCGGGCGCGGAGCAGTCGCCG
TCCCCCGAAAAGGCGTGGGTCAACGGTTCCGGCATGCCGCCGGCTGTCCAGTTGGGCGATACCGAGATGTTTCTG
CAATTGGTGAGGCCGCGGGTGCGATACGACGTCGAGGTGGTGACGAAGCTGGTCGTCTATGCGGGCATAGCAGGC
CTTGCCACGGCTTGCATCCCCATCATGCTCGAGATTGTCGGCCTCGGCACGAACCAGCTCCAGCAAGTCCCTCGT
CCATCTTCAACGTTCGTCGCCATGCGGCTGTCTGCCCTCGTTGTCGGCTTAGCTGTCGGTTCGGAAGCTAAGAAG
CTGGTTCCCCGGCCGGATAGCTTCTGGGACCACGTCTCTCACAGCGAGGATGTTGCCCATCTGAGCAGAAGGGAC
TTGAGCGGCTACACGCTGCGGAGCAAGAAGAGCGATCCCGCGAGGCTGGGCATCGATACGGTGAAGCAGTATAGC
GGCTATCTCGATGACGCGGCCAACGACAAGCACCTCTTTTACTGGTTCTTTGAGTCCCGCAACAAGCCCGAGTCA
GACCCGGTCGTGCTCTGGCTCAATGGCGGACCCGGCTGCTCTTCCATGATCGGCCTCTTCACCGAGCTGGGACCG
GCGCGGATTCCGACGCCGGATCTAAAGCCAGAGCGGAACCCGTACTCTTGGAACAATAACGCTTCAATGATCTTC
CTCGACCAGCCCATCAACACGGGCTTCTCGTATAGTCGTGGGAACGTGGACACGACGGCGGCGGCGAGTCGAGAT
GTTTTGGCGCTGCTGTCGTTGTTCTTTCATCAGTTTCCGCAGTATGGGGCGAGGCAGTTTCATGTTTCGGGCGAG
TCGTATGCTGGGCATTACATTCCCATCATCGCGGACGAAATCCTCTCCCACCCGGACAGCGGCATCAAGCTTAGC
AGCGTGCTCATCGGCAACGGACTCACCGACCAGCTGACGCAGTATCGTTACTACCGGCCCATGGCCTGCGGGGAG
GGAGGCTATCCTTCCGTCCTGAATGAGAGCACATGCCGGGCCATGGACGAGGTGCTTCCGCGGTGTGAGGAAATG
ATCCAGTCGTGCTACGAGACGGGTGATCGGGAAAAGTGTTCGGCTGCTACGCGCGAATGCAACGACTCCCTGCTG
AGCCCATACGACGCATCGGGCCGGAGCATGTACGATGTCCGCAAGGCGAGTAATGACGAGGCGCCCGACTACAGC
GATCGCTACCTCAACCAGCCAGACGTTATGGAAGCGCTCGGCTCCGAAGTCGAAAGGTTCAGCAGCTGCAGCTAT
CGCATCAACGGCGACTTCGTCTCGTCGGGCGACTGGATGCTGCCCATCCACCGGACGGTCCCCAAGCTCCTGGAG
CGCATCCCCGTGCTCATCTACGCCGGAGACGCCGACTTCATCTGCAACTGGCTGGGGAACAGGGCCTGGACCAGC
GCGCTGGAATGGCCTGGCAAGACGGAGTTTAACGGTGCGGCGGTGAAGACGCTGGTTGGGGGTGCGGGTGAAGCG
TATGGTGAGCCTCGCGCAACCTCGGATTCAGCCATGGATGACGATATGGATGTCGACGACGGGCCTGCGCCTTCC
AATAACATTGTCTTTTCGTCTGATGCGAATAAGGGGAAGCGCACGGCTGCGAACCTCCCCGTCGAGGCTGAAGAT
AGCCTGCCATGGGTTGAGAAATACCGTCCAACGACGCTGGATCAGGTCTCGGGTCATGGCGATATCCTGGCGACG
ATTAACAAGTTTGTCGACTCGAATCGGCTTCCTCATCTGCTTCTCTACGGACCGCCTGGGACGGGCAAGACGTCG
ACGATACTGGCGCTCGCGCGGCGCATCTACGGCACGGCCAACATGCGGCAGATGGTCCTCGAGCTGAACGCTTCC
GACGATCGTGGCATCGACGTGGTGCGCGAGCAAATCAAGACATTTGCCAGCACCAAGCAGATCTTCGCCATGGGA
GCTTCAGGCGGTGGTCGGTCCTCGGCAGCGGGCTTCAAGCTCATCATCCTCGACGAGGCCGACGCCATGACGAAC
ACGGCGCAGATGGCGCTGCGGCGCATCATGGAAAAGTACACGGCCAACACGAGGTTCTGCATCATTGCAAACTAC
TCGCACAAGCTGAGCCCGGCGCTGCTGAGCCGCTGTACGCGCTTTCGCTTCAGTCCCTTGTCTGAGGCAGATATT
CGCGTCCTGGTCGACAGGGTGGTGGAGGAGGAAAGGGTCAAGATTGGGGGGGAGGCTGTTGATGCCCTCGTCGGG
CTGAGTAAGGGGGATATGAGGAGGGCGCTCAACGTGCTGCAGGCTTGCCACGCGTCGAGCACCCCCCTGCGATCC
AAGACGGCGCCCAAACCGGCAGCGGACGACGAGACAAAGCGGGAGACGATCACGACGGAGACCATCTACAACTGC
ATCGCAGCGCCACCGCCCGACGCCATCAAGCAGATGATGGCGACGCTTCTGGAGACGACGGACGTGACGAGCTGC
CTGACGACGGTCAACTCGCTCAAGACGACGCGGGGGCTCGCGCTGGCGGATATCATCACGGCGTTGGCGGAGCAG
CTGACTCGGCTCGAGGTCAAGGCTGAGGTGCGTATCGGCTGGTTGGATGCGCTGGCTGAGATTGAGCATCGGGTT
GCGGGGGGGGGGAATGAGACGGTTCAGACGGGGGCTGTGGTGGGAGCTGTGCGGAACGGGTCGCTGATATACGGC
CAATCTGTCAGCAATGATGACGGGATGCAGGGTAGGCAGCCAAAGGTGGTAGCCGCCGTCATGGAGGAGAAACCA
CTCCTCTCTTCCAACACAGACGGAGCAACTCTCGCCATGGCTTCGACGACCCCCAGTGATGGTCACGACTTGACG
TCAGCCGGGTCCAGACACGTGCTGCCTCCCGACCACCTGTTCGCCATCCAGGTCGGACACCAGATGTTCAAGTTG
ACGGGCGCCTCACTATCCTCCGACTCTCCATCGTTCTTCACGCGACACTTCTCGCAAACGACAGACATCCATCGC
CCGCTCTACATCGACCGCGACCCGGACACGTTCCGTGACATGGAGCTGCATCTTCAAGGCTACCACGTCAGCGCC
AGGGATGGAACGCACCTGGTGCGACTCCTGTCCGATGCGCATTTCTACAGCCGTGCGTGCCTCGCAAACTGCAGA
CAAGAAGAGGAAGATGTCTAG
Gene >Ophun1|1671
ATGAGCGTCGCCGAGTCGCTTCCGTCTCGGCCTCAGGACGTGCCCGATGCCGGTCTTCGGAGCCTCGACCACTGT
GAGGAGCTCCGTCCTCTCCGCTGTCGACGACGGCTCGCTGACGACGGCCGATAGACAAGCGGGCGCTGCCTCACT
GGCGATATGCCCTGCGCCAGCGTCTGCTCCCCATCATTCGCTGGGAGACGCCCTACGTCGCTTGGATGCAGAGCA
AGATGCGCACCCCGGCCCTCGACAGCTACTTTGCCATCACGGCCAACCTCGGCACCCATACCTTTTTCATGATCG
GACTGCCTCTCCTCTTCTGGTGTGGTTACGCATCGTTTGGCAAGGGGTATGATCGTGTCATGGTTCTTCTCGTGT
CGATACTGACCGGCTGCCCCCCTCAGACTCGTCCACATCCTCGCCCTCGGCGTCTTCTGGACCGGCTTCACGAAG
GACCTCTTGTCGCTGCCACGCCCACTGTCGCCGCCGCTACACCGCATCACCATGTCCGGATCAGCGGCGCTCGAG
TACGGGTTCCCATCGACGCACAGCGCAAATGCCGTCTCCGTCGCCGTCTACGCCCTCCTCATCCTCCACAGTCCC
GACAACACGCTCTCAGCCACGACCAAAGTTCTATTCGAGGTGCTGTCGTACTTTTACGCCGCCTCCATCGTCTTT
GGCCGCCTCTACTGCGGTATGCACGGATTCCTCGACGTCATCGTCGGCTCCCTCATGGGCGCCGCCATTAGCTGG
CTCGAGTTCAACTATGGCCCGCCCCTCGATGCCTACATGCACGCCAGCTCGTGGACAGCGCCTCTCCTGGCGGGG
CTCGTCATCGTCATTCTGGTGCGCATACATCCGGAACCGGCAGACGATTGCCCGTGCTTCGACGACAGTGTCGCC
TTTGCCGGCGTCCTCATCGGCCTCGAGCTCGGCACATGGACCTTTGGCAAGATGCCCGGCGATCCGTGGAAGACG
CACGCCTACGGTGACAATGCCATCGACGTCTCCCCGCTTGGCTGGGGTACAAATCTGGCCAGACTCGGCTTCGGC
ATCTTGGTCATCTTCCTGTGGCGCGAGACGATGAAGCCGACGCTTTTGCGGCTGCTGCCCTACCTGTTCCGTAGC
CTGGAGCAGGTCGGCTGGGATCTCCCGCGTCGCTTCTTCATGCCGGCGTCCGAGTACAAGTCGGTCCCTCCCGGG
TCCCGGCTCGACACGTTGTTCCCCAAGGCGTCCGACTTTCCGCGCATGGTGGAGAGCATCCGGCATCCGACGACA
CGGGGTAGGGCCGTGTCCATCGGGCCGCAGAGCGCCGCCGACGCGTACGAGACGCTGGCCTACCGCGAGCGACGC
CGGCGCGAGAGCATAGGCAGCAACAGCCAGGCGAAGCGGCCGTCTCTGGACAGCGTCGACGAGGACCGGTCCGGC
AAGGCGGCTCAGGCGTCGGGCGCGGAGCAGTCGCCGTCCCCCGAAAAGGCGTGGGTCAACGGTTCCGGCATGCCG
CCGGCTGTCCAGTTGGGCGATACCGAGATGTTTCTGCAATTGGTGAGGCCGCGGGTGCGATACGACGTCGAGGTG
GTGACGAAGCTGGTCGTCTATGCGGGTGAGTCATGACTACTCCTGCTCCCTCTTCAGCGGACTGACGTGAGACTT
GTCAGGCATAGCAGGCCTTGCCACGGCTTGCATCCCCATCATGCTCGAGATTGTCGGCCTCGGCACGAACCAGCT
CCAGGTACAGTAAAAGGTACAGTAATGAAGACGTACGCGGCCTTCGCCTTTCTGAATTCGCTACGGCGTTGGTGG
AGGGACGGATACCTGGGCGTACGGGAGTTGTCGGCTGGCGATGCGGTGCGAGGGCGGCAGATGCAAACCTGGAGA
CGTTGGACGAATGATTACACAAGAGATGCCGTTTATCCCCTTTCATTTCTTCTTCTTTTCTTTTCCGCTACATCT
CTGAAGCCTCCTCTGTTTGAGGACCTACCGGAACCGAGCTCCCTCATGCAGCCTCTTATCTGGCGTCCATCGGCT
GCACCGTCGGCTCAGGCAATGCAGGGGGCTCTACCTGGAAGCGGTAGGTGGTGATGAACGACAATTCTCCAGTCA
TCAGTCGGCACGGTTGGTTCTGGCGTCGCACCCGGGCTCCGACCTGCTCCTTTCGGGATGACGGCTGTAGGGGGC
CTTTTGAGTCCTTGCGAGACGCTACTCGACTCCTGTGTTGTCGCCTGTGTGTCGTTTGTGTATATAAAGACGGGA
TGAAGGGAGTCATGGCATTTCACCATCATGGTCGTCGTTGGCTGAGACCGACGCCGCTCTTCATCAGCAAGTCCC
TCGTCCATCTTCAACGTTCGTCGCCATGCGGCTGTCTGCCCTCGTTGTCGGCTTAGCTGTCGGTTCGGAAGCTAA
GAAGCTGGTTCCCCGGCCGGATAGCTTCTGGGACCACGTCTCTCACAGCGAGGATGTTGCCCATCTGAGCAGAAG
GGACTTGAGCGGCTACACGCTGCGGAGCAAGAAGAGCGATCCCGCGAGGCTGGGCATCGATACGGTGAAGCAGTA
TAGCGGCTATCTCGATGACGCGGCCAACGACAAGCACCTCTTTTACTGTCCGTCTCGTCCCCACGATGCTGTTCC
TTCATCTTGTTTCTAACGTGTCAGATGAAAAGGGTTCTTTGAGTCCCGCAACAAGCCCGAGTCAGACCCGGTCGT
GCTCTGGCTCAATGGCGGACCCGGCTGCTCTTCCATGATCGGCCTCTTCACCGAGCTGGGACCGGCGCGGATTCC
GACGCCGGATCTAAAGCCAGAGCGGAACCCGTACTCTTGGAACAATAACGCTTCAATGATCTTCCTCGACCAGCC
CATCAACACGGGCTTCTCGTATAGTCGTGGGAACGTGGACACGACGGCGGCGGCGAGTCGAGATGTTTTGGCGCT
GCTGTCGTTGTTCTTTCATCAGTTTCCGCAGTATGGGGCGAGGCAGTTTCATGTTTCGGGCGAGTCGTATGCTGG
GCATTACATTCCCATCATCGCGGACGAAATCCTCTCCCACCCGGACAGCGGCATCAAGCTTAGCAGCGTGCTCAT
CGGCAACGGACTCACCGACCAGCTGACGCAGTATCGTTACTACCGGCCCATGGCCTGCGGGGAGGGAGGCTATCC
TTCCGTCCTGAATGAGAGCACATGCCGGGCCATGGACGAGGTGCTTCCGCGGTGTGAGGAAATGATCCAGTCGTG
CTACGAGACGGGTGATCGGGAAAAGTGTTCGGCTGCTACGCGCGAATGCAACGACTCCCTGCTGAGCCCATACGA
CGCATCGGGCCGGAGCATGTACGATGTCCGCAAGGCGAGTAATGACGAGGCGCCCGACTACAGCGATCGCTACCT
CAACCAGCCAGACGTTATGGAAGCGCTCGGCTCCGAAGTCGAAAGGTTCAGCAGCTGCAGCTATCGCATCAACGG
CGACTTCGTCTCGTCGGGCGACTGGATGCTGCCCATCCACCGGACGGTCCCCAAGCTCCTGGAGCGCATCCCCGT
GCTCATCTACGCCGGAGACGCCGACTTCATCTGCAACTGGCTGGGGAACAGGGCCTGGACCAGCGCGCTGGAATG
GCCTGGCAAGACGGAGTTTAACGGTGCGGCGGTGAAGACGCTGGTTGGGGGTGCGGGTGAAGCGTATGGTGAGGT
GCGGACGGCGAGGAACTTTACGTTTATGAGGGTGTTTCAGGCGGGACATATGGTTCCGGGGGATCAGCCGAAGGG
GTCGCTTGATTTCTTTAACCGTTGGCTTGGTGGTGAGTGGTGGTCTCATTAGGAGGAGATGCGGTGCTTGGTGTG
AATACCTACCTACCCGTGAGAGAAATCAGATGGGTGATGAGATTGGATGGGAGGAATATGCGAGATACCTGAGAG
CGTCGGTTAGGGAATCATCAGAGGCTTATCAGCATCCGTCCCGTCGAACCTGTCGGATCGCTCTAGAGTCGGAAG
TGGCGAGTTGCATTGCCGCTCGGCTTGTTAGATTAACGCGGGGATCTCGGTTGGTGCTGTGCTTTGCGGGTGCGA
CGCTGTTGAGAACTGTGATTGATAGTGGTGAATCCCAGTGAAGTGTATTCGTACGGTTATGGGCATGCGGGAAGC
CGTCTCGATGGTGGTTGGATGATGTTGTGTCGTTATGTATTACTAATCACACAACGCTGCCTCATTTACGGCTAA
CGCGTGGGAACGCGTTGGCTTCGTCTGATCGCGCTTCATCTCAGCCTCGCGCAACCTCGGATTCAGCCATGGATG
ACGATATGGATGTCGACGACGGGCCTGCGCCTTCCAATAACATTGTCTTTTCGTCTGATGCGAATAAGGGGAAGC
GCACGGCTGCGAACCTCCCCGTCGAGGCTGAAGATAGCCTGCCATGGTGCGTCGTCCTCTCACGCTTCATCTTGT
TATTACCCTGCTGAGACTGGCTGTAGGGTTGAGAAATACCGTCCAACGACGCTGGATCAGGTCTCGGGTCATGGC
GATATCCTGGCGACGATTAACAAGTTTGTCGACTCGAATCGGCTTCCTCATCTGCTTCTCTACGGACCGCCTGGG
ACGGGCAAGACGTCGACGATACTGGCGCTCGCGCGGCGCATCTACGGCACGGCCAACATGCGGCAGATGGTCCTC
GAGCTGAACGCTTCCGACGATCGTGGCATCGACGTGGTGCGCGAGCAAATCAAGACATTTGCCAGCACCAAGCAG
ATCTTCGCCATGGGAGCTTCAGGCGGTGGTCGGTCCTCGGCAGCGGGCTTCAAGCTCATCATCCTCGACGAGGCC
GACGCCATGACGAACACGGCGCAGATGGCGCTGCGGCGCATCATGGAAAAGTACACGGCCAACACGAGGTTCTGC
ATCATTGCAAACTACTCGCACAAGCTGAGCCCGGCGCTGCTGAGCCGCTGTACGCGCTTTCGCTTCAGTCCCTTG
TCTGAGGCAGATATTCGCGTCCTGGTCGACAGGGTGGTGGAGGAGGAAAGGGTCAAGATTGGGGGGGAGGCTGTT
GATGCCCTCGTCGGGCTGAGTAAGGGGGATATGAGGAGGGCGCTCAACGTGCTGCAGGCTTGCCACGCGTCGAGT
GAGTTTCTTCCCGTTTATCAAGTACTGATTTTTTTCAGCAGCAGCTGACGAGACGTTTTCCCTTGCAGGCACCCC
CCTGCGATCCAAGACGGCGCCCAAACCGGCAGCGGACGACGAGACAAAGCGGGAGACGATCACGACGGAGACCAT
CTACAACTGCATCGCAGCGCCACCGCCCGACGCCATCAAGCAGATGATGGCGACGCTTCTGGAGACGACGGACGT
GACGAGCTGCCTGACGACGGTCAACTCGCTCAAGACGACGCGGGGGCTCGCGCTGGCGGATATCATCACGGCGTT
GGCGGAGCAGCTGACTCGGCTCGAGGTCAAGGCTGAGGTGCGTATCGGCTGGTTGGATGCGCTGGCTGAGATTGA
GCATCGGGTTGCGGGGGGGGGGAATGAGACGGTTCAGACGGGGGCTGTGGTGGGAGCTGTGCGGAACGGGGTTGA
GCTGATGAGCCGGTAGAGTCAGATATATCATATCTACGAATACAAATATCCAGGAAGCTGAGATTGGTGTCAGTC
GCTGATATACGGCCAATCTGTCAGCAATGATGACGGGATGCAGGGTAGGCAGCCAAAGGTGGTAGCCGCCGTCAT
GGAGGAGAAACCACTCCTCTCTTCCAACACAGACGGAGCAACTCTCGCCATGGCTTCGACGACCCCCAGTGATGG
TCACGACTTGACGTCAGCCGGGTCCAGACACGTGCTGCCTCCCGACCACCTGTTCGCCATCCAGGTCGGACACCA
GATGTTCAAGTTGACGGGCGCCTCACTATCCTCCGACTGTCAGCGCTGAACCCTCTCTCTTCCTCGCTGTATATC
CCTCTCTCTGACAACGAGTCCAGCTCCATCGTTCTTCACGCGACACTTCTCGCAAACGACAGACATCCATCGCCC
GCTCTACATCGACCGCGACCCGGACACGTTCCGTGACATGGAGCTGCATCTTCAAGGCTACCACGTCAGCGCCAG
GGATGGAACGCACCTGGTGCGACTCCTGTCCGATGCGCATTTCTACAGCCGTGCGTGCCTCGCAAACTGCAGACA
AGAAGAGGAAGATGTCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail