Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|1668
Gene name
LocationContig_171:18330..19594
Strand-
Gene length (bp)1264
Transcript length (bp)1101
Coding sequence length (bp)1101
Protein length (aa) 367

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10343 Q_salvage Potential Queuosine, Q, salvage protein family 2.6E-123 79 366

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q9HDZ9|YKP5_SCHPO UPF0553 protein C589.05c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC589.05c PE=3 SV=1 32 366 4.0E-84
sp|Q5T6V5|CI064_HUMAN UPF0553 protein C9orf64 OS=Homo sapiens GN=C9orf64 PE=1 SV=1 34 366 7.0E-79
sp|Q1JP73|CI064_BOVIN UPF0553 protein C9orf64 homolog OS=Bos taurus PE=2 SV=1 34 366 1.0E-76
sp|A7SNN9|U553_NEMVE UPF0553 protein v1g230591 OS=Nematostella vectensis GN=v1g230591 PE=3 SV=1 34 366 4.0E-76
sp|Q54II8|U553_DICDI UPF0553 protein OS=Dictyostelium discoideum GN=DDB_G0288723 PE=3 SV=1 28 366 5.0E-38

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup3593
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|37
Ophiocordyceps australis map64 (Brazil) OphauB2|1578
Ophiocordyceps camponoti-floridani Ophcf2|05752
Ophiocordyceps camponoti-rufipedis Ophun1|1668 (this protein)
Ophiocordyceps kimflemingae Ophio5|6230
Ophiocordyceps subramaniannii Hirsu2|6925

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|1668
MSDDEPDLELLALLREKLIGQPLQNDEPEMGVLEGAHYVYDNGYDVAIDMRSTKRAAESIYLQMQRKAYSAATWS
EHELHPKTKNEATVAFIFTMDLLNFSFWSELPDDERFAVEYRGRIWKGYWSLVAALQRALDDGVPMTDPHFWQNE
DECNLESMRRVFGSCTDEEMPMLQERLDCLRECGRVLYERYNCSFTNVISSAAGSAPRLVNVLARDFPCFRDEHG
FPGRIKPIRFLKRAQILVADLWACFQGTSYGKFLDIDKITVFADYRVPQILISLGALYCCPPLVAAIKDRRPLES
GGSWEVQLRACSIWCVELMRKEMLRLHPTTHINAILIDFFLYDTMQELEAQGQEALPHHRTRSIWY*
Coding >Ophun1|1668
ATGTCCGACGACGAGCCCGATCTCGAGCTACTCGCTCTCCTCCGCGAGAAGCTCATCGGCCAGCCCCTGCAAAAC
GACGAGCCGGAAATGGGTGTCCTCGAGGGCGCCCATTACGTCTACGACAACGGCTACGACGTCGCCATCGATATG
CGCTCTACCAAGCGCGCCGCAGAGTCCATCTATCTTCAGATGCAGCGCAAGGCTTACTCGGCTGCCACCTGGTCC
GAGCACGAGCTGCATCCCAAGACCAAGAACGAGGCTACCGTCGCCTTCATCTTCACCATGGACCTTCTCAACTTT
TCCTTCTGGTCCGAGCTTCCGGACGATGAGAGATTCGCTGTCGAGTATCGTGGGAGGATCTGGAAGGGATACTGG
AGTCTTGTTGCTGCTCTTCAGCGTGCCCTCGACGACGGAGTTCCCATGACGGATCCACACTTCTGGCAGAACGAG
GACGAGTGCAACTTGGAATCCATGAGACGCGTCTTTGGGTCCTGCACCGACGAGGAGATGCCAATGCTACAGGAG
CGCCTGGACTGTCTCCGAGAATGCGGTCGTGTCCTCTACGAGCGCTACAACTGCTCCTTCACCAACGTCATCTCC
TCCGCCGCCGGCTCCGCCCCTCGCCTCGTCAACGTCCTCGCCCGCGACTTTCCCTGCTTCCGCGACGAGCACGGC
TTCCCAGGCAGGATCAAACCCATCAGGTTCCTCAAGCGCGCCCAGATCCTCGTCGCCGATCTGTGGGCCTGTTTC
CAGGGCACCTCGTACGGCAAGTTCCTCGACATTGACAAAATCACCGTCTTCGCCGACTATCGCGTGCCCCAGATC
CTCATCAGTCTGGGTGCCCTGTACTGCTGCCCCCCTCTGGTCGCTGCCATCAAGGACCGGCGGCCGCTTGAGAGT
GGAGGCAGCTGGGAGGTGCAGTTGAGAGCGTGCAGCATCTGGTGTGTCGAGCTGATGCGCAAGGAAATGCTGAGG
TTACATCCCACGACGCACATCAACGCCATCTTGATAGACTTCTTTCTCTACGATACCATGCAAGAATTAGAGGCT
CAGGGCCAGGAGGCTCTGCCCCACCATAGAACGAGGAGCATCTGGTACTAG
Transcript >Ophun1|1668
ATGTCCGACGACGAGCCCGATCTCGAGCTACTCGCTCTCCTCCGCGAGAAGCTCATCGGCCAGCCCCTGCAAAAC
GACGAGCCGGAAATGGGTGTCCTCGAGGGCGCCCATTACGTCTACGACAACGGCTACGACGTCGCCATCGATATG
CGCTCTACCAAGCGCGCCGCAGAGTCCATCTATCTTCAGATGCAGCGCAAGGCTTACTCGGCTGCCACCTGGTCC
GAGCACGAGCTGCATCCCAAGACCAAGAACGAGGCTACCGTCGCCTTCATCTTCACCATGGACCTTCTCAACTTT
TCCTTCTGGTCCGAGCTTCCGGACGATGAGAGATTCGCTGTCGAGTATCGTGGGAGGATCTGGAAGGGATACTGG
AGTCTTGTTGCTGCTCTTCAGCGTGCCCTCGACGACGGAGTTCCCATGACGGATCCACACTTCTGGCAGAACGAG
GACGAGTGCAACTTGGAATCCATGAGACGCGTCTTTGGGTCCTGCACCGACGAGGAGATGCCAATGCTACAGGAG
CGCCTGGACTGTCTCCGAGAATGCGGTCGTGTCCTCTACGAGCGCTACAACTGCTCCTTCACCAACGTCATCTCC
TCCGCCGCCGGCTCCGCCCCTCGCCTCGTCAACGTCCTCGCCCGCGACTTTCCCTGCTTCCGCGACGAGCACGGC
TTCCCAGGCAGGATCAAACCCATCAGGTTCCTCAAGCGCGCCCAGATCCTCGTCGCCGATCTGTGGGCCTGTTTC
CAGGGCACCTCGTACGGCAAGTTCCTCGACATTGACAAAATCACCGTCTTCGCCGACTATCGCGTGCCCCAGATC
CTCATCAGTCTGGGTGCCCTGTACTGCTGCCCCCCTCTGGTCGCTGCCATCAAGGACCGGCGGCCGCTTGAGAGT
GGAGGCAGCTGGGAGGTGCAGTTGAGAGCGTGCAGCATCTGGTGTGTCGAGCTGATGCGCAAGGAAATGCTGAGG
TTACATCCCACGACGCACATCAACGCCATCTTGATAGACTTCTTTCTCTACGATACCATGCAAGAATTAGAGGCT
CAGGGCCAGGAGGCTCTGCCCCACCATAGAACGAGGAGCATCTGGTACTAG
Gene >Ophun1|1668
ATGTCCGACGACGAGCCCGATCTCGAGCTACTCGCTCTCCTCCGCGAGAAGCTCATCGGCCAGCCCCTGCAAAAC
GACGAGCCGGAAATGGGTGTCCTCGAGGGCGCCCATTACGTCTACGACAACGGCTACGACGTCGCCATCGATATG
CGCTCTACCAAGCGCGCCGCAGAGTCCATCTATCTTCAGATGCAGCGCAAGGCTTACTCGGCTGCCACCTGGTCC
GAGCACGAGCTGCATCCCAAGACCAAGAACGAGGCTACCGTCGCCTTCATCTTCACCATGGACCTTCTCAACTTT
TCCTTCTGGTCCGAGCTTCCGGACGATGAGAGATTCGCTGTCGAGTATCGTGGGAGGATCTGGAAGGGATACTGG
AGTCTTGTTGCTGCTCTTCAGCGTGCCCTCGACGACGGTCAGTCTATACATACCCGGAGCCTGAGACCGTCGTCT
GACGCCCGCTTCCAAAAGGAGTTCCCATGACGGATCCACACTTCTGGCAGAACGAGGACGAGTGCAACTTGGAAT
CCATGAGACGCGTCTTTGGGTCCTGCACCGACGAGGAGATGCCAATGCTACAGGAGCGCCTGGACTGTCTCCGAG
AATGCGGTCGTGTCCTCTACGAGGTGATTCTCCAGCTGCTCGTCCCCTTTTCTCGCCGCTCCTAACATGTCACGA
AGCGCTACAACTGCTCCTTCACCAACGTCATCTCCTCCGCCGCCGGCTCCGCCCCTCGCCTCGTCAACGTCCTCG
CCCGCGACTTTCCCTGCTTCCGCGACGAGCACGGCTTCCCAGGCAGGATCAAACCCATCAGGTTCCTCAAGCGCG
CCCAGATCCTCGTCGCCGATCTGTGGGCCTGTTTCCAGGGCACCTCGTACGGCAAGTTCCTCGACATTGACAAAA
TCACCGTCTTCGCCGACTATCGCGTGCCCCAGATCCTCATCAGTCTGGGTGCCCTGTACTGCTGCCCCCCTCTGG
TCGCTGCCATCAAGGACCGGCGGCCGCTTGAGAGTGGAGGCAGCTGGGAGGTGCAGTTGAGAGGTGAGTTGGCTT
CCGTTGTTGTAATCGTGTTGTGGCGTTCTGACGGCTTGCAGCGTGCAGCATCTGGTGTGTCGAGCTGATGCGCAA
GGAAATGCTGAGGTTACATCCCACGACGCACATCAACGCCATCTTGATAGACTTCTTTCTCTACGATACCATGCA
AGAATTAGAGGCTCAGGGCCAGGAGGCTCTGCCCCACCATAGAACGAGGAGCATCTGGTACTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail