Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|1667
Gene name
LocationContig_171:17316..18031
Strand+
Gene length (bp)715
Transcript length (bp)636
Coding sequence length (bp)636
Protein length (aa) 212

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04081 DNA_pol_delta_4 DNA polymerase delta, subunit 4 3.5E-39 66 193

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O59835|DPOD4_SCHPO DNA polymerase delta subunit 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cdm1 PE=2 SV=1 121 190 2.0E-11
sp|Q9CWP8|DPOD4_MOUSE DNA polymerase delta subunit 4 OS=Mus musculus GN=Pold4 PE=3 SV=1 143 184 9.0E-11
sp|Q3T0X9|DPOD4_BOVIN DNA polymerase delta subunit 4 OS=Bos taurus GN=POLD4 PE=1 SV=1 143 184 2.0E-09
sp|Q9HCU8|DPOD4_HUMAN DNA polymerase delta subunit 4 OS=Homo sapiens GN=POLD4 PE=1 SV=1 146 184 8.0E-09

GO

GO Term Description Terminal node
GO:0000731 DNA synthesis involved in DNA repair Yes
GO:0006260 DNA replication Yes
GO:0043170 macromolecule metabolic process No
GO:0044237 cellular metabolic process No
GO:0044238 primary metabolic process No
GO:0009987 cellular process No
GO:0009058 biosynthetic process No
GO:0008152 metabolic process No
GO:0034654 nucleobase-containing compound biosynthetic process No
GO:1901362 organic cyclic compound biosynthetic process No
GO:0044260 cellular macromolecule metabolic process No
GO:0006259 DNA metabolic process No
GO:0044271 cellular nitrogen compound biosynthetic process No
GO:1901576 organic substance biosynthetic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0090304 nucleic acid metabolic process No
GO:0018130 heterocycle biosynthetic process No
GO:0044249 cellular biosynthetic process No
GO:0071897 DNA biosynthetic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0019438 aromatic compound biosynthetic process No
GO:0046483 heterocycle metabolic process No
GO:0008150 biological_process No
GO:0009059 macromolecule biosynthetic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0071704 organic substance metabolic process No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup5534
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis map64 (Brazil) OphauB2|1577
Ophiocordyceps camponoti-floridani Ophcf2|05753
Ophiocordyceps camponoti-rufipedis Ophun1|1667 (this protein)
Ophiocordyceps kimflemingae Ophio5|6229
Ophiocordyceps subramaniannii Hirsu2|6924

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|1667
MPPTRKHAGGARGTRSSAGKAQSTLSFSGRVTKSSVKDVKKKAITPAAIAKISPQPDTSPDKEAEETVAEEAEEA
EEEEEEEEEEAYDSQPTQSTEPPPRNLTPAETKAQSITDAQISSYWKTLERQRKAPRIHQQDLDTYEKVLRYFDV
SSQYGPCIGIGRMKRWLRADGLGLNPPIEVLAVLVKGEAEGGRDLETAKMDGILNAIVVGT*
Coding >Ophun1|1667
ATGCCACCGACGAGGAAGCACGCAGGCGGAGCCCGTGGAACCCGTTCCAGCGCTGGCAAAGCGCAGTCAACTCTC
AGTTTCTCGGGAAGAGTGACGAAAAGCTCAGTCAAAGATGTGAAGAAGAAGGCCATCACGCCCGCTGCCATCGCC
AAGATTTCCCCTCAGCCCGATACATCTCCGGACAAGGAAGCAGAAGAGACGGTAGCAGAAGAGGCGGAAGAAGCG
GAAGAAGAAGAAGAAGAAGAAGAAGAAGAAGCCTACGACTCGCAACCGACGCAATCAACCGAACCCCCCCCCCGA
AACCTCACCCCCGCCGAAACAAAAGCCCAATCCATCACCGACGCCCAGATATCATCCTACTGGAAAACCCTGGAG
CGCCAGCGCAAAGCCCCACGCATCCACCAGCAAGACCTCGACACGTACGAGAAAGTCCTGCGCTATTTTGACGTC
AGCTCGCAGTACGGGCCCTGCATCGGCATCGGTCGTATGAAGCGCTGGCTTCGTGCTGATGGGTTGGGGCTGAAT
CCGCCGATTGAGGTTCTTGCTGTGCTTGTTAAGGGGGAGGCTGAGGGGGGGAGGGATCTGGAGACGGCCAAGATG
GATGGAATTTTGAATGCTATCGTCGTTGGGACGTGA
Transcript >Ophun1|1667
ATGCCACCGACGAGGAAGCACGCAGGCGGAGCCCGTGGAACCCGTTCCAGCGCTGGCAAAGCGCAGTCAACTCTC
AGTTTCTCGGGAAGAGTGACGAAAAGCTCAGTCAAAGATGTGAAGAAGAAGGCCATCACGCCCGCTGCCATCGCC
AAGATTTCCCCTCAGCCCGATACATCTCCGGACAAGGAAGCAGAAGAGACGGTAGCAGAAGAGGCGGAAGAAGCG
GAAGAAGAAGAAGAAGAAGAAGAAGAAGAAGCCTACGACTCGCAACCGACGCAATCAACCGAACCCCCCCCCCGA
AACCTCACCCCCGCCGAAACAAAAGCCCAATCCATCACCGACGCCCAGATATCATCCTACTGGAAAACCCTGGAG
CGCCAGCGCAAAGCCCCACGCATCCACCAGCAAGACCTCGACACGTACGAGAAAGTCCTGCGCTATTTTGACGTC
AGCTCGCAGTACGGGCCCTGCATCGGCATCGGTCGTATGAAGCGCTGGCTTCGTGCTGATGGGTTGGGGCTGAAT
CCGCCGATTGAGGTTCTTGCTGTGCTTGTTAAGGGGGAGGCTGAGGGGGGGAGGGATCTGGAGACGGCCAAGATG
GATGGAATTTTGAATGCTATCGTCGTTGGGACGTGA
Gene >Ophun1|1667
ATGCCACCGACGAGGAAGCACGCAGGCGGAGCCCGTGGAACCCGTTCCAGCGCTGGCAAAGCGCAGTCAACTCTC
AGTTTCTCGGGAAGAGTGACGAAAAGCTCAGTCAAAGATGTGAAGAAGAAGGCCATCACGCCCGCTGCCATCGCC
AAGATTTCCCCTCAGCCCGATACATCTCCGGACAAGGAAGCAGAAGAGACGGTAGCAGAAGAGGCGGAAGAAGCG
GAAGAAGAAGAAGAAGAAGAAGAAGAAGAAGCCTACGACTCGCAACCGACGCAATCAACCGAACCCCCCCCCCGA
AACCTCACCCCCGCCGAAACAAAAGCCCAATCCATCACCGACGCCCAGATATCATCCTACTGGAAAACCCTGGAG
CGCCAGCGCAAAGCCCCACGCATCCACCAGCAAGACCTCGACACGTACGAGAAAGTCCTGCGCTATTTTGACGTC
AGCTCGCAGTACGGGGTAAGTCTGATCAGGCATTGCGGGTAGTTCTTTTTTTTTCTTTTTGGCTTTCAGCTGACG
CGTGCGCGGGAAACTTTAGCCCTGCATCGGCATCGGTCGTATGAAGCGCTGGCTTCGTGCTGATGGGTTGGGGCT
GAATCCGCCGATTGAGGTTCTTGCTGTGCTTGTTAAGGGGGAGGCTGAGGGGGGGAGGGATCTGGAGACGGCCAA
GATGGATGGAATTTTGAATGCTATCGTCGTTGGGACGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail