Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|1663
Gene name
LocationContig_171:10108..10612
Strand-
Gene length (bp)504
Transcript length (bp)435
Coding sequence length (bp)435
Protein length (aa) 145

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04828 GFA Glutathione-dependent formaldehyde-activating enzyme 9.3E-22 28 125

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|E1VBT6|GFAL_HALED Putative glutathione-dependent formaldehyde-activating enzyme OS=Halomonas elongata (strain ATCC 33173 / DSM 2581 / NBRC 15536 / NCIMB 2198 / 1H9) GN=HELO_2322 PE=3 SV=1 8 144 3.0E-09

GO

GO Term Description Terminal node
GO:0016846 carbon-sulfur lyase activity Yes
GO:0003674 molecular_function No
GO:0016829 lyase activity No
GO:0003824 catalytic activity No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup1078
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5210
Ophiocordyceps australis map64 (Brazil) OphauB2|6832
Ophiocordyceps camponoti-floridani Ophcf2|05756
Ophiocordyceps camponoti-rufipedis Ophun1|1663 (this protein)
Ophiocordyceps kimflemingae Ophio5|4539
Ophiocordyceps kimflemingae Ophio5|6228
Ophiocordyceps subramaniannii Hirsu2|10056

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|1663
MTSKTTRGSCLCGKITYQVTGEPDFTNLCYCNSCRKATGALGMANSVFKKENFKLLSGADHLRTFHDESCKSGAA
LERGFCSSCGSNMMVEHKTKLPDALIVPLGSMDVDPSSGKWAPMNEFFCKYKPTWMTTPDEAKKYDEQF*
Coding >Ophun1|1663
ATGACTTCAAAGACGACTCGCGGCTCCTGCCTCTGCGGAAAGATCACCTACCAGGTCACGGGTGAGCCCGACTTC
ACCAACCTCTGCTACTGCAACAGCTGCCGCAAGGCCACGGGCGCCCTGGGCATGGCCAACAGCGTCTTCAAGAAA
GAGAACTTCAAGCTCCTCAGCGGAGCAGACCACCTGCGAACCTTTCACGACGAATCGTGCAAGTCCGGCGCCGCC
CTCGAACGCGGCTTCTGCAGCTCGTGCGGCTCCAACATGATGGTAGAGCACAAGACGAAACTTCCCGACGCCCTC
ATCGTGCCGCTCGGATCCATGGACGTCGATCCCAGCTCTGGAAAGTGGGCGCCCATGAACGAGTTCTTCTGCAAG
TATAAGCCAACATGGATGACGACGCCAGACGAGGCCAAGAAGTACGACGAGCAGTTTTAG
Transcript >Ophun1|1663
ATGACTTCAAAGACGACTCGCGGCTCCTGCCTCTGCGGAAAGATCACCTACCAGGTCACGGGTGAGCCCGACTTC
ACCAACCTCTGCTACTGCAACAGCTGCCGCAAGGCCACGGGCGCCCTGGGCATGGCCAACAGCGTCTTCAAGAAA
GAGAACTTCAAGCTCCTCAGCGGAGCAGACCACCTGCGAACCTTTCACGACGAATCGTGCAAGTCCGGCGCCGCC
CTCGAACGCGGCTTCTGCAGCTCGTGCGGCTCCAACATGATGGTAGAGCACAAGACGAAACTTCCCGACGCCCTC
ATCGTGCCGCTCGGATCCATGGACGTCGATCCCAGCTCTGGAAAGTGGGCGCCCATGAACGAGTTCTTCTGCAAG
TATAAGCCAACATGGATGACGACGCCAGACGAGGCCAAGAAGTACGACGAGCAGTTTTAG
Gene >Ophun1|1663
ATGACTTCAAAGACGACTCGCGGCTCCTGCCTCTGCGGAAAGATCACCTACCAGGTCACGGGTGAGCCCGACTTC
ACCAACCTCTGCTACTGCAACAGCTGCCGCAAGGCCACGGGCGCCCTGGGCATGGCCAACAGCGTCTTCAAGAAA
GAGGTTCTCTTCCCTCATCCCTTCCTCATCCCTCCCTCATCCCCCAAAGACACAACTAACACACCGACATAGAAC
TTCAAGCTCCTCAGCGGAGCAGACCACCTGCGAACCTTTCACGACGAATCGTGCAAGTCCGGCGCCGCCCTCGAA
CGCGGCTTCTGCAGCTCGTGCGGCTCCAACATGATGGTAGAGCACAAGACGAAACTTCCCGACGCCCTCATCGTG
CCGCTCGGATCCATGGACGTCGATCCCAGCTCTGGAAAGTGGGCGCCCATGAACGAGTTCTTCTGCAAGTATAAG
CCAACATGGATGACGACGCCAGACGAGGCCAAGAAGTACGACGAGCAGTTTTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail