Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|1654
Gene name
LocationContig_170:29127..30794
Strand-
Gene length (bp)1667
Transcript length (bp)1371
Coding sequence length (bp)1371
Protein length (aa) 457

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 8.6E-22 92 345
PF07690 MFS_1 Major Facilitator Superfamily 1.5E-10 337 445

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q08777|MCH5_YEAST Riboflavin transporter MCH5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MCH5 PE=1 SV=2 5 447 3.0E-35
sp|Q08268|MCH4_YEAST Probable transporter MCH4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MCH4 PE=1 SV=1 11 456 1.0E-30
sp|Q66HE2|MOT13_RAT Monocarboxylate transporter 13 OS=Rattus norvegicus GN=Slc16a13 PE=2 SV=1 75 444 1.0E-20
sp|Q8CE94|MOT13_MOUSE Monocarboxylate transporter 13 OS=Mus musculus GN=Slc16a13 PE=2 SV=1 79 444 3.0E-20
sp|Q17QR6|MOT13_BOVIN Monocarboxylate transporter 13 OS=Bos taurus GN=SLC16A13 PE=2 SV=1 79 444 3.0E-18
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q08777|MCH5_YEAST Riboflavin transporter MCH5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MCH5 PE=1 SV=2 5 447 3.0E-35
sp|Q08268|MCH4_YEAST Probable transporter MCH4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MCH4 PE=1 SV=1 11 456 1.0E-30
sp|Q66HE2|MOT13_RAT Monocarboxylate transporter 13 OS=Rattus norvegicus GN=Slc16a13 PE=2 SV=1 75 444 1.0E-20
sp|Q8CE94|MOT13_MOUSE Monocarboxylate transporter 13 OS=Mus musculus GN=Slc16a13 PE=2 SV=1 79 444 3.0E-20
sp|Q17QR6|MOT13_BOVIN Monocarboxylate transporter 13 OS=Bos taurus GN=SLC16A13 PE=2 SV=1 79 444 3.0E-18
sp|Q7RTY0|MOT13_HUMAN Monocarboxylate transporter 13 OS=Homo sapiens GN=SLC16A13 PE=2 SV=1 73 444 5.0E-18
sp|P53918|ESBP6_YEAST Uncharacterized transporter ESBP6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ESBP6 PE=1 SV=1 38 367 2.0E-15
sp|B1AT66|MOT7_MOUSE Monocarboxylate transporter 7 OS=Mus musculus GN=Slc16a6 PE=1 SV=1 3 219 5.0E-14
sp|Q8K1P8|MOT8_RAT Monocarboxylate transporter 8 OS=Rattus norvegicus GN=SLC16A2 PE=1 SV=1 58 455 1.0E-13
sp|O70324|MOT8_MOUSE Monocarboxylate transporter 8 OS=Mus musculus GN=Slc16a2 PE=1 SV=2 58 455 6.0E-12
sp|Q6GM59|MOT12_XENLA Monocarboxylate transporter 12 OS=Xenopus laevis GN=slc16a12 PE=2 SV=1 71 351 2.0E-11
sp|O15403|MOT7_HUMAN Monocarboxylate transporter 7 OS=Homo sapiens GN=SLC16A6 PE=1 SV=2 71 237 3.0E-11
sp|Q63344|MOT2_RAT Monocarboxylate transporter 2 OS=Rattus norvegicus GN=Slc16a7 PE=1 SV=1 80 442 4.0E-11
sp|P36032|MCH2_YEAST Probable transporter MCH2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MCH2 PE=1 SV=2 71 262 7.0E-11
sp|Q8BGC3|MOT12_MOUSE Monocarboxylate transporter 12 OS=Mus musculus GN=Slc16a12 PE=2 SV=1 79 236 8.0E-11
sp|P36021|MOT8_HUMAN Monocarboxylate transporter 8 OS=Homo sapiens GN=SLC16A2 PE=1 SV=2 50 455 2.0E-10
sp|O70451|MOT2_MOUSE Monocarboxylate transporter 2 OS=Mus musculus GN=Slc16a7 PE=1 SV=1 79 331 2.0E-10
sp|Q6ZSM3|MOT12_HUMAN Monocarboxylate transporter 12 OS=Homo sapiens GN=SLC16A12 PE=1 SV=2 68 236 4.0E-10
sp|Q6P2X9|MOT12_XENTR Monocarboxylate transporter 12 OS=Xenopus tropicalis GN=slc16a12 PE=2 SV=1 71 454 7.0E-10
sp|O15427|MOT4_HUMAN Monocarboxylate transporter 4 OS=Homo sapiens GN=SLC16A3 PE=1 SV=1 67 442 6.0E-09
sp|O35910|MOT4_RAT Monocarboxylate transporter 4 OS=Rattus norvegicus GN=Slc16a3 PE=1 SV=1 77 331 2.0E-08
sp|P57787|MOT4_MOUSE Monocarboxylate transporter 4 OS=Mus musculus GN=Slc16a3 PE=1 SV=1 77 331 4.0E-08
sp|A1L1W9|MOT10_DANRE Monocarboxylate transporter 10 OS=Danio rerio GN=slc16a10 PE=2 SV=1 68 451 6.0E-08
sp|Q03064|MOT1_CRILO Monocarboxylate transporter 1 OS=Cricetulus longicaudatus GN=SLC16A1 PE=1 SV=1 79 219 9.0E-08
sp|O60669|MOT2_HUMAN Monocarboxylate transporter 2 OS=Homo sapiens GN=SLC16A7 PE=1 SV=2 80 331 1.0E-07
sp|Q503M4|MT12B_DANRE Monocarboxylate transporter 12-B OS=Danio rerio GN=slc16a12b PE=2 SV=1 71 351 1.0E-07
sp|P53988|MOT2_MESAU Monocarboxylate transporter 2 OS=Mesocricetus auratus GN=SLC16A7 PE=1 SV=1 80 331 2.0E-07
sp|Q3MHW6|MOT1_BOVIN Monocarboxylate transporter 1 OS=Bos taurus GN=SLC16A1 PE=2 SV=2 79 219 3.0E-07
sp|Q90632|MOT3_CHICK Monocarboxylate transporter 3 OS=Gallus gallus GN=SLC16A3 PE=2 SV=2 77 441 4.0E-07
sp|Q3U9N9|MOT10_MOUSE Monocarboxylate transporter 10 OS=Mus musculus GN=Slc16a10 PE=1 SV=1 2 451 1.0E-06
sp|P57788|MOT4_CHICK Monocarboxylate transporter 4 OS=Gallus gallus GN=SLC16A3 PE=2 SV=1 74 219 2.0E-06
sp|P53986|MOT1_MOUSE Monocarboxylate transporter 1 OS=Mus musculus GN=Slc16a1 PE=1 SV=1 79 219 3.0E-06
sp|P53985|MOT1_HUMAN Monocarboxylate transporter 1 OS=Homo sapiens GN=SLC16A1 PE=1 SV=3 79 234 4.0E-06
sp|P53987|MOT1_RAT Monocarboxylate transporter 1 OS=Rattus norvegicus GN=Slc16a1 PE=1 SV=1 79 219 4.0E-06
sp|Q8R0M8|MOT5_MOUSE Monocarboxylate transporter 5 OS=Mus musculus GN=Slc16a4 PE=2 SV=1 73 289 4.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0022857 transmembrane transporter activity Yes
GO:0055085 transmembrane transport Yes
GO:0051179 localization No
GO:0005215 transporter activity No
GO:0051234 establishment of localization No
GO:0003674 molecular_function No
GO:0009987 cellular process No
GO:0006810 transport No
GO:0008150 biological_process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 33 0.45

Transmembrane Domains

Domain # Start End Length
1 86 108 22
2 123 145 22
3 152 174 22
4 212 234 22
5 241 263 22
6 290 312 22
7 332 354 22
8 359 381 22
9 393 415 22
10 425 447 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|1654
MKQPPEQRTWHEAGASIPDSPPEDGPSEGPSTVVASEPASTSGSCFAGTQTEKQTWAESRPVLSSCGSPVKESSE
TRLPDGGLRAWMVVAGGFLNFTVTFGILNSFGTFQAYYESKWPNLSTSTITWIGSLCLFFLGGIFIGPVFDRYGG
QKLMLIGTSFCVLSFLGASWSTQYWHYLLSQGFLLGTGSALLFYPTTGAISEWFDSKRGLALGIAVSGSSLGGVF
WPMLLQVLFERVAEEVVYRIMAVISTPLLLFSCYLIRARPGHGAAAGEGLNRQRTVVRTILEPRFISLSVVLMIL
YAGMLIPFYYIPLYSEERGVDRVMANHLLSISFNILALIGLLMSIMTLGWIWMHSVTQMVVFAILFGLFSAGLVP
LGSACVAQTTPDMGRIGLRIGVMMAVCSIGALAGGPVSGILRESCAGWPAVHLFSASLSLLGALLLLAVRWWHQP
RLLAKF*
Coding >Ophun1|1654
ATGAAGCAGCCCCCCGAGCAGAGAACGTGGCACGAAGCCGGCGCCAGCATCCCCGACTCGCCCCCGGAAGACGGC
CCATCCGAAGGCCCCTCTACCGTCGTTGCCTCGGAGCCGGCCTCGACGTCGGGCAGTTGCTTTGCCGGCACGCAG
ACGGAGAAGCAGACCTGGGCGGAGTCGAGGCCTGTTCTCTCGTCGTGCGGGTCGCCTGTCAAGGAGAGCAGCGAG
ACGAGGCTTCCTGATGGTGGGCTTCGGGCTTGGATGGTTGTTGCCGGGGGGTTTCTCAACTTTACCGTTACCTTT
GGTATCCTCAACTCGTTCGGCACCTTTCAGGCTTACTATGAGAGCAAGTGGCCCAACCTGAGCACTTCAACCATA
ACCTGGATAGGCAGCCTCTGCCTCTTCTTCCTCGGCGGCATCTTCATCGGCCCCGTCTTCGACCGCTACGGCGGC
CAGAAACTCATGCTCATCGGCACCAGCTTTTGCGTCCTCTCCTTTCTCGGGGCCAGCTGGTCGACTCAGTACTGG
CACTACCTCCTATCGCAGGGCTTCCTGCTGGGGACGGGCAGTGCCTTGCTATTCTATCCCACCACCGGGGCCATC
TCGGAGTGGTTCGACAGCAAACGCGGCCTCGCCCTCGGCATCGCCGTCTCCGGATCTTCCCTCGGCGGCGTCTTC
TGGCCCATGCTCCTTCAGGTGCTGTTCGAGAGGGTGGCCGAAGAGGTCGTCTACCGCATCATGGCCGTCATATCG
ACGCCTCTTCTCCTCTTCTCCTGCTACCTCATCCGTGCTCGCCCCGGCCACGGAGCAGCCGCAGGCGAGGGCCTC
AACCGACAGCGGACCGTCGTCAGGACCATCCTCGAGCCTCGATTCATCTCGCTCAGCGTCGTCCTCATGATTCTC
TACGCCGGCATGCTCATCCCCTTTTACTATATTCCGCTCTACTCGGAGGAACGGGGCGTGGACCGCGTCATGGCA
AACCACCTCCTGTCGATATCGTTCAACATCCTTGCCCTCATCGGCCTCCTGATGAGCATCATGACGCTGGGCTGG
ATCTGGATGCATTCGGTCACGCAAATGGTCGTCTTCGCCATCCTCTTCGGCCTCTTCTCCGCCGGTCTCGTCCCC
CTCGGCTCAGCCTGCGTGGCCCAGACAACACCAGACATGGGCCGCATCGGGCTCCGCATCGGCGTCATGATGGCC
GTCTGCTCCATCGGTGCCCTGGCCGGCGGTCCCGTCAGCGGCATCCTCCGCGAGAGTTGCGCCGGCTGGCCGGCC
GTCCATCTCTTCTCGGCCTCGCTATCCCTGCTGGGCGCCCTGCTGCTGCTGGCCGTCAGGTGGTGGCATCAGCCG
CGGCTGCTGGCAAAGTTCTGA
Transcript >Ophun1|1654
ATGAAGCAGCCCCCCGAGCAGAGAACGTGGCACGAAGCCGGCGCCAGCATCCCCGACTCGCCCCCGGAAGACGGC
CCATCCGAAGGCCCCTCTACCGTCGTTGCCTCGGAGCCGGCCTCGACGTCGGGCAGTTGCTTTGCCGGCACGCAG
ACGGAGAAGCAGACCTGGGCGGAGTCGAGGCCTGTTCTCTCGTCGTGCGGGTCGCCTGTCAAGGAGAGCAGCGAG
ACGAGGCTTCCTGATGGTGGGCTTCGGGCTTGGATGGTTGTTGCCGGGGGGTTTCTCAACTTTACCGTTACCTTT
GGTATCCTCAACTCGTTCGGCACCTTTCAGGCTTACTATGAGAGCAAGTGGCCCAACCTGAGCACTTCAACCATA
ACCTGGATAGGCAGCCTCTGCCTCTTCTTCCTCGGCGGCATCTTCATCGGCCCCGTCTTCGACCGCTACGGCGGC
CAGAAACTCATGCTCATCGGCACCAGCTTTTGCGTCCTCTCCTTTCTCGGGGCCAGCTGGTCGACTCAGTACTGG
CACTACCTCCTATCGCAGGGCTTCCTGCTGGGGACGGGCAGTGCCTTGCTATTCTATCCCACCACCGGGGCCATC
TCGGAGTGGTTCGACAGCAAACGCGGCCTCGCCCTCGGCATCGCCGTCTCCGGATCTTCCCTCGGCGGCGTCTTC
TGGCCCATGCTCCTTCAGGTGCTGTTCGAGAGGGTGGCCGAAGAGGTCGTCTACCGCATCATGGCCGTCATATCG
ACGCCTCTTCTCCTCTTCTCCTGCTACCTCATCCGTGCTCGCCCCGGCCACGGAGCAGCCGCAGGCGAGGGCCTC
AACCGACAGCGGACCGTCGTCAGGACCATCCTCGAGCCTCGATTCATCTCGCTCAGCGTCGTCCTCATGATTCTC
TACGCCGGCATGCTCATCCCCTTTTACTATATTCCGCTCTACTCGGAGGAACGGGGCGTGGACCGCGTCATGGCA
AACCACCTCCTGTCGATATCGTTCAACATCCTTGCCCTCATCGGCCTCCTGATGAGCATCATGACGCTGGGCTGG
ATCTGGATGCATTCGGTCACGCAAATGGTCGTCTTCGCCATCCTCTTCGGCCTCTTCTCCGCCGGTCTCGTCCCC
CTCGGCTCAGCCTGCGTGGCCCAGACAACACCAGACATGGGCCGCATCGGGCTCCGCATCGGCGTCATGATGGCC
GTCTGCTCCATCGGTGCCCTGGCCGGCGGTCCCGTCAGCGGCATCCTCCGCGAGAGTTGCGCCGGCTGGCCGGCC
GTCCATCTCTTCTCGGCCTCGCTATCCCTGCTGGGCGCCCTGCTGCTGCTGGCCGTCAGGTGGTGGCATCAGCCG
CGGCTGCTGGCAAAGTTCTGA
Gene >Ophun1|1654
ATGAAGCAGCCCCCCGAGCAGAGAACGTGGCACGAAGCCGGCGCCAGCATCCCCGACTCGCCCCCGGAAGACGGC
CCATCCGAAGGCCCCTCTACCGTCGTTGCCTCGGAGCCGGCCTCGACGTCGGGCAGTTGCTTTGCCGGCACGCAG
ACGGAGAAGCAGACCTGGGCGGAGTCGAGGCCTGTTCTCTCGTCGTGCGGGTCGCCTGTCAAGGAGAGCAGCGAG
ACGAGGCTTCCTGATGGTGGGCTTCGGGCTTGGATGGTTGTTGCCGGGGGGTTTCTCAACTTTACCGTTACCTTT
GGTGAGTTGGCTTCTTTGTTGGGTTGGACGTGCTTGGGCTGATGGAATGACAGGTATCCTCAACTCGTTCGGCAC
CTTTCAGGCTTACTATGAGAGCAAGTGGCCCAACCTGAGCACTTCAACCATAACCTGGATAGGCAGCGTCCAGGC
AAGTTGTCCCTTCAACTGTCACGAATCAAGACTTGCTAACGGAACCGTTTCGACAACAGCTCTGCCTCTTCTTCC
TCGGCGGCATCTTCATCGGCCCCGTCTTCGACCGCTACGGCGGCCAGAAACTCATGCTCATCGGCACCAGCTTTT
GCGTCCTCTCCTTTCTCGGGGCCAGCTGGTCGACTCAGTACTGGCACTACCTCCTATCGCAGGGCTTCCTGCTGG
GGACGGGCAGTGCCTTGCTGTGAGTAGATGGCTACATCTCCTTTATCCCCCTTCACTCGTCGACTCCGTCTCATC
CCCAGCCCGCAGATTCTATCCCACCACCGGGGCCATCTCGGAGTGGTTCGACAGCAAACGCGGCCTCGCCCTCGG
CATCGCCGTCTCCGGATCTTCCCTCGGCGGCGTCTTCTGGCCCATGCTCCTTCAGGTGCTGTTCGAGAGGGTGGC
CGAAGAGGTCGTCTACCGCATCATGGCCGTCATATCGACGCCTCTTCTCCTCTTCTCCTGCTACCTCATCCGTGC
TCGCCCCGGCCACGGAGCAGCCGCAGGCGAGGGCCTCAACCGACAGCGGACCGTCGTCAGGACCATCCTCGAGCC
TCGATTCATCTCGCTCAGCGTCGTCCTCATGATTCTCTACGCCGGCATGCTCATCCCCTTTTACTATATTCCGCT
CTACTCGGAGGAACGGGGCGTGGACCGCGTCATGGCAAACCACCTCCTGTCGATATCGTACGCAGGCTCCTTTAT
AGGCCGCATCGGATCCGGATGGCTGGCCGACTGTCTCGGCAGGCAAGCAGACTGGAAAATCCCCCTTTTCTCACT
CGGCTGACGCTCGCAGGTTCAACATCCTTGCCCTCATCGGCCTCCTGATGAGCATCATGACGCTGGGCTGGATCT
GGATGCATTCGGTCACGCAAATGGTCGTCTTCGCCATCCTCTTCGGCCTCTTCTCCGCCGGTCTCGTCCCCCTCG
GCTCAGCCTGCGTGGCCCAGACAACACCAGACATGGGCCGCATCGGGCTCCGCATCGGCGTCATGATGGCCGTCT
GCTCCATCGGTGCCCTGGCCGGCGGTCCCGTCAGCGGCATCCTCCGCGAGAGTTGCGCCGGCTGGCCGGCCGTCC
ATCTCTTCTCGGCCTCGCTATCCCTGCTGGGCGCCCTGCTGCTGCTGGCCGTCAGGTGGTGGCATCAGCCGCGGC
TGCTGGCAAAGTTCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail