Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|1653
Gene name
LocationContig_170:26927..28322
Strand+
Gene length (bp)1395
Transcript length (bp)1395
Coding sequence length (bp)1395
Protein length (aa) 465

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05004 IFRD Interferon-related developmental regulator (IFRD) 1.5E-55 80 355

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O42973|YGZ3_SCHPO Uncharacterized protein C20F10.03 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC20F10.03 PE=1 SV=1 92 419 2.0E-08

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup3854
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5091
Ophiocordyceps australis map64 (Brazil) OphauB2|146
Ophiocordyceps camponoti-floridani Ophcf2|00757
Ophiocordyceps camponoti-rufipedis Ophun1|1653 (this protein)
Ophiocordyceps kimflemingae Ophio5|7376
Ophiocordyceps subramaniannii Hirsu2|763

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|1653
MNHARVKALKGNGKTVSKKAQKSGRASGTLTPQGSSSPLHASPSHSNTPSRVASDVSDNEEDGDLDFDDMNSSVH
SGGSGPEMADETATGFDVQALIDGLTDRKRNNSSVREQYLDAYLRVLRKRYNVQVHLWLDPAAATLVDMFLKDAN
RGATPRERLLSLQAYTLTLAVVEDLDVYEVGSKLLKQILTDEDDQDCRVQAIYALCMTTLYGGGLQEVALELMQY
LVEIVQSDGESIEAHDDVAVVSAAMRGWAFVASHVDDYADDADLAMDAFVDQLDSADVEVQSLAGHCIALIYESS
RTHETETGEPFQLPYDPQRLVCRLEELAKLSAKSVSRKNRRDLRDSLVSVVTSLERGVGPYYSTALYVPEPDAFV
PASLRTDDGRAEYGHRCKLRLGGRTALIDTWSLYSRVNMMKLLFQGGLENHVFVNPVVVECLEDADWDEVLASAE
PERKPRLSAKARKR*
Coding >Ophun1|1653
ATGAATCACGCTCGAGTAAAAGCCCTCAAGGGCAACGGCAAGACGGTGTCGAAAAAGGCACAGAAATCAGGTCGA
GCCTCGGGCACTCTGACGCCTCAGGGCTCGTCTTCGCCTCTTCACGCCTCGCCCTCTCACTCCAACACGCCCAGC
CGCGTCGCTTCTGATGTCAGCGATAACGAGGAGGATGGCGACCTGGACTTTGATGATATGAATTCGAGCGTCCAT
TCTGGCGGCTCGGGGCCCGAAATGGCCGACGAAACGGCTACCGGATTCGATGTCCAGGCCCTCATCGATGGTCTC
ACGGATCGCAAACGCAACAACAGCAGCGTTCGCGAGCAGTATCTCGACGCCTATCTCCGCGTTCTTCGGAAGCGA
TACAACGTTCAAGTCCATCTCTGGCTGGATCCGGCTGCCGCCACCCTCGTCGACATGTTCCTCAAGGACGCGAAT
CGAGGGGCTACGCCCAGGGAGCGCTTGCTCAGTTTGCAGGCCTACACACTGACGCTGGCCGTCGTTGAGGACCTG
GACGTGTACGAGGTCGGAAGCAAGCTCCTGAAGCAGATCTTGACCGATGAGGATGATCAAGACTGCCGAGTCCAG
GCCATCTATGCCTTGTGCATGACGACGCTCTACGGAGGAGGTCTCCAGGAGGTTGCCCTCGAGCTCATGCAGTAT
CTCGTCGAAATCGTGCAGTCGGACGGCGAGAGCATCGAGGCCCACGATGACGTGGCAGTCGTCTCTGCCGCCATG
AGAGGCTGGGCCTTTGTCGCCAGCCACGTCGATGACTATGCAGATGACGCCGACTTGGCCATGGATGCGTTTGTC
GACCAGCTAGACAGCGCCGACGTCGAAGTCCAGTCGCTGGCCGGTCACTGCATCGCCCTCATCTACGAGTCGTCG
CGCACGCACGAGACGGAGACTGGAGAGCCCTTTCAGCTGCCATATGATCCGCAGAGGCTCGTCTGCCGGCTCGAG
GAGCTTGCCAAGCTGAGCGCCAAGTCCGTGTCTCGCAAGAACCGGCGTGATCTTCGCGACAGCCTCGTCAGCGTC
GTCACATCGCTCGAGAGGGGCGTCGGTCCTTACTATTCGACGGCCCTCTACGTCCCGGAACCAGACGCCTTCGTG
CCGGCCTCGCTGCGGACCGACGACGGAAGGGCAGAGTACGGCCATCGCTGCAAGCTGCGGCTCGGCGGGCGCACC
GCCCTCATCGACACGTGGTCGCTGTACTCGAGAGTCAACATGATGAAGCTGCTCTTCCAGGGAGGGCTCGAGAAC
CACGTGTTTGTCAACCCGGTCGTGGTAGAGTGCTTGGAGGACGCCGATTGGGATGAGGTGCTGGCGAGTGCCGAG
CCGGAGCGGAAACCGAGACTTTCGGCCAAGGCTCGCAAGAGATGA
Transcript >Ophun1|1653
ATGAATCACGCTCGAGTAAAAGCCCTCAAGGGCAACGGCAAGACGGTGTCGAAAAAGGCACAGAAATCAGGTCGA
GCCTCGGGCACTCTGACGCCTCAGGGCTCGTCTTCGCCTCTTCACGCCTCGCCCTCTCACTCCAACACGCCCAGC
CGCGTCGCTTCTGATGTCAGCGATAACGAGGAGGATGGCGACCTGGACTTTGATGATATGAATTCGAGCGTCCAT
TCTGGCGGCTCGGGGCCCGAAATGGCCGACGAAACGGCTACCGGATTCGATGTCCAGGCCCTCATCGATGGTCTC
ACGGATCGCAAACGCAACAACAGCAGCGTTCGCGAGCAGTATCTCGACGCCTATCTCCGCGTTCTTCGGAAGCGA
TACAACGTTCAAGTCCATCTCTGGCTGGATCCGGCTGCCGCCACCCTCGTCGACATGTTCCTCAAGGACGCGAAT
CGAGGGGCTACGCCCAGGGAGCGCTTGCTCAGTTTGCAGGCCTACACACTGACGCTGGCCGTCGTTGAGGACCTG
GACGTGTACGAGGTCGGAAGCAAGCTCCTGAAGCAGATCTTGACCGATGAGGATGATCAAGACTGCCGAGTCCAG
GCCATCTATGCCTTGTGCATGACGACGCTCTACGGAGGAGGTCTCCAGGAGGTTGCCCTCGAGCTCATGCAGTAT
CTCGTCGAAATCGTGCAGTCGGACGGCGAGAGCATCGAGGCCCACGATGACGTGGCAGTCGTCTCTGCCGCCATG
AGAGGCTGGGCCTTTGTCGCCAGCCACGTCGATGACTATGCAGATGACGCCGACTTGGCCATGGATGCGTTTGTC
GACCAGCTAGACAGCGCCGACGTCGAAGTCCAGTCGCTGGCCGGTCACTGCATCGCCCTCATCTACGAGTCGTCG
CGCACGCACGAGACGGAGACTGGAGAGCCCTTTCAGCTGCCATATGATCCGCAGAGGCTCGTCTGCCGGCTCGAG
GAGCTTGCCAAGCTGAGCGCCAAGTCCGTGTCTCGCAAGAACCGGCGTGATCTTCGCGACAGCCTCGTCAGCGTC
GTCACATCGCTCGAGAGGGGCGTCGGTCCTTACTATTCGACGGCCCTCTACGTCCCGGAACCAGACGCCTTCGTG
CCGGCCTCGCTGCGGACCGACGACGGAAGGGCAGAGTACGGCCATCGCTGCAAGCTGCGGCTCGGCGGGCGCACC
GCCCTCATCGACACGTGGTCGCTGTACTCGAGAGTCAACATGATGAAGCTGCTCTTCCAGGGAGGGCTCGAGAAC
CACGTGTTTGTCAACCCGGTCGTGGTAGAGTGCTTGGAGGACGCCGATTGGGATGAGGTGCTGGCGAGTGCCGAG
CCGGAGCGGAAACCGAGACTTTCGGCCAAGGCTCGCAAGAGATGA
Gene >Ophun1|1653
ATGAATCACGCTCGAGTAAAAGCCCTCAAGGGCAACGGCAAGACGGTGTCGAAAAAGGCACAGAAATCAGGTCGA
GCCTCGGGCACTCTGACGCCTCAGGGCTCGTCTTCGCCTCTTCACGCCTCGCCCTCTCACTCCAACACGCCCAGC
CGCGTCGCTTCTGATGTCAGCGATAACGAGGAGGATGGCGACCTGGACTTTGATGATATGAATTCGAGCGTCCAT
TCTGGCGGCTCGGGGCCCGAAATGGCCGACGAAACGGCTACCGGATTCGATGTCCAGGCCCTCATCGATGGTCTC
ACGGATCGCAAACGCAACAACAGCAGCGTTCGCGAGCAGTATCTCGACGCCTATCTCCGCGTTCTTCGGAAGCGA
TACAACGTTCAAGTCCATCTCTGGCTGGATCCGGCTGCCGCCACCCTCGTCGACATGTTCCTCAAGGACGCGAAT
CGAGGGGCTACGCCCAGGGAGCGCTTGCTCAGTTTGCAGGCCTACACACTGACGCTGGCCGTCGTTGAGGACCTG
GACGTGTACGAGGTCGGAAGCAAGCTCCTGAAGCAGATCTTGACCGATGAGGATGATCAAGACTGCCGAGTCCAG
GCCATCTATGCCTTGTGCATGACGACGCTCTACGGAGGAGGTCTCCAGGAGGTTGCCCTCGAGCTCATGCAGTAT
CTCGTCGAAATCGTGCAGTCGGACGGCGAGAGCATCGAGGCCCACGATGACGTGGCAGTCGTCTCTGCCGCCATG
AGAGGCTGGGCCTTTGTCGCCAGCCACGTCGATGACTATGCAGATGACGCCGACTTGGCCATGGATGCGTTTGTC
GACCAGCTAGACAGCGCCGACGTCGAAGTCCAGTCGCTGGCCGGTCACTGCATCGCCCTCATCTACGAGTCGTCG
CGCACGCACGAGACGGAGACTGGAGAGCCCTTTCAGCTGCCATATGATCCGCAGAGGCTCGTCTGCCGGCTCGAG
GAGCTTGCCAAGCTGAGCGCCAAGTCCGTGTCTCGCAAGAACCGGCGTGATCTTCGCGACAGCCTCGTCAGCGTC
GTCACATCGCTCGAGAGGGGCGTCGGTCCTTACTATTCGACGGCCCTCTACGTCCCGGAACCAGACGCCTTCGTG
CCGGCCTCGCTGCGGACCGACGACGGAAGGGCAGAGTACGGCCATCGCTGCAAGCTGCGGCTCGGCGGGCGCACC
GCCCTCATCGACACGTGGTCGCTGTACTCGAGAGTCAACATGATGAAGCTGCTCTTCCAGGGAGGGCTCGAGAAC
CACGTGTTTGTCAACCCGGTCGTGGTAGAGTGCTTGGAGGACGCCGATTGGGATGAGGTGCTGGCGAGTGCCGAG
CCGGAGCGGAAACCGAGACTTTCGGCCAAGGCTCGCAAGAGATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail