Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|1652
Gene name
LocationContig_170:23445..25701
Strand-
Gene length (bp)2256
Transcript length (bp)1989
Coding sequence length (bp)1989
Protein length (aa) 663

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00498 FHA FHA domain 3.2E-12 42 117

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P0C219|SLMAP_RAT Sarcolemmal membrane-associated protein OS=Rattus norvegicus GN=Slmap PE=1 SV=1 29 124 1.0E-07
sp|Q3URD3|SLMAP_MOUSE Sarcolemmal membrane-associated protein OS=Mus musculus GN=Slmap PE=1 SV=2 29 124 1.0E-07
sp|Q28623|SLMAP_RABIT Sarcolemmal membrane-associated protein OS=Oryctolagus cuniculus GN=SLMAP PE=1 SV=2 29 138 3.0E-07
sp|Q14BN4|SLMAP_HUMAN Sarcolemmal membrane-associated protein OS=Homo sapiens GN=SLMAP PE=1 SV=1 29 138 4.0E-07
sp|O74388|YNVD_SCHPO Uncharacterized protein C3H7.13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC3H7.13 PE=1 SV=1 37 120 2.0E-06

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 25 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|1652
MPSNHADQVRVDLTPTSRASEASASNLARHVVLTRDSPSLQIGRMSQRNPDLRASSANAWFESAVMSRHHAKLHF
DADQTTLSIEDTQSLHGTFHNGTRLESGMQSQLHSGDELCFGIQVDRHTDTFPPCAMTVTFEFDEANSQPRQNPV
VYKVPDDTDVEDTSDDDKDEEDEDEDAEDSSICSSIHVLRENRLHPAEAFLIRDTVAIDLTSDANTPENQASDCE
VLEPNYQAQDAPEDHHVIPETVQHGGLEPAEDVWQPVSPVSHSVDNHQGAGAHVGPRPRADGIPGAGSDEWEHGS
TTEQCRVASARPCTLPASWETQGSSDGLESDAGVAFCLNPVSSNPPPRSTIPAPKRFDLANLLSPSNQASSSFCD
PTRTIVSQDMARPECGSPLPSLATARPTLWGSDSPLGFKKQSAQAAAEALGQKAGKPEYFTARLANKRFVEQLCE
VAQQLEQTEADSPESSAEEAHNEDVAMENTSDEDQGGHEKDDQGSVSLFALSGENPLIALEDASKNKLLASGERF
LLSPPQEPVASRPPVESPELNDLSAHEFELSKMNAEAKSRAQRNDGLDVPGRVEEARQLSETKRSCLKRKAADML
ESNPKVGPKASSSSSETRLAARNSMDESRTVKRLRTAAEVLGYAALGGVAVVSALIATAPSL*
Coding >Ophun1|1652
ATGCCGTCGAATCACGCGGATCAAGTCCGCGTCGATCTGACCCCAACATCGCGGGCTTCCGAGGCCTCAGCCTCC
AACCTCGCCCGTCATGTCGTCTTGACCAGAGATTCCCCCAGCCTGCAAATCGGCCGCATGAGCCAGAGGAACCCC
GACCTTAGGGCCTCGTCGGCAAACGCCTGGTTCGAGTCGGCCGTCATGTCTCGTCATCATGCCAAGCTGCACTTT
GATGCAGACCAGACGACGCTCTCCATCGAAGATACTCAATCTCTGCACGGCACCTTCCATAATGGCACTCGCCTT
GAGTCGGGCATGCAGTCCCAGCTACACTCTGGGGATGAACTCTGCTTCGGAATTCAAGTCGACAGACATACGGAT
ACCTTTCCGCCCTGTGCCATGACGGTCACTTTTGAATTTGACGAAGCCAACAGCCAACCTCGGCAAAACCCCGTC
GTCTACAAGGTTCCCGATGACACTGACGTCGAGGACACAAGCGATGACGATAAAGACGAAGAGGACGAGGACGAG
GACGCAGAGGACTCGAGCATATGCAGCAGCATCCATGTCCTTCGCGAGAACCGCCTTCACCCAGCTGAAGCATTT
CTGATACGCGATACTGTGGCCATCGATCTGACGTCCGACGCCAACACGCCTGAAAATCAGGCATCCGACTGCGAG
GTCCTGGAACCCAACTACCAAGCCCAAGATGCTCCCGAAGACCACCATGTGATTCCCGAGACGGTGCAGCATGGT
GGCCTGGAGCCGGCCGAAGACGTGTGGCAGCCAGTGTCGCCCGTCTCCCACTCGGTCGACAACCATCAGGGTGCT
GGTGCTCACGTCGGCCCTCGTCCGCGCGCCGACGGTATTCCTGGCGCCGGATCGGATGAATGGGAACATGGCAGT
ACCACTGAGCAGTGCCGCGTTGCATCCGCGCGCCCTTGTACCTTGCCCGCCTCGTGGGAGACGCAGGGATCCTCG
GACGGGCTTGAATCAGACGCTGGCGTGGCCTTTTGCCTAAATCCAGTTTCATCGAATCCGCCTCCCAGGTCAACC
ATCCCCGCTCCCAAAAGGTTCGATTTGGCAAATCTGTTGTCACCGTCGAACCAAGCGTCATCCAGCTTCTGCGAT
CCCACCCGTACAATCGTCTCTCAAGATATGGCACGGCCGGAGTGCGGAAGCCCGCTGCCCTCGTTGGCTACCGCT
CGGCCGACTCTTTGGGGAAGCGACTCTCCCCTCGGTTTCAAAAAACAGAGCGCCCAAGCAGCAGCTGAGGCTCTA
GGCCAGAAGGCTGGCAAGCCGGAGTATTTCACCGCCCGCCTCGCCAACAAGCGCTTCGTCGAACAATTGTGCGAA
GTCGCCCAGCAGCTTGAACAGACGGAGGCTGATTCGCCTGAAAGCTCTGCCGAGGAAGCTCACAACGAGGATGTC
GCCATGGAAAATACTAGCGACGAAGATCAAGGCGGCCACGAGAAAGACGACCAGGGTTCCGTTTCGCTATTTGCA
CTATCGGGCGAGAACCCTCTCATCGCGTTGGAAGACGCATCCAAGAACAAGCTGCTGGCCTCTGGCGAAAGGTTT
CTGCTGTCGCCTCCTCAGGAGCCCGTGGCATCCCGGCCGCCGGTCGAATCGCCCGAGTTGAACGACTTGTCGGCC
CACGAGTTTGAACTGAGCAAGATGAACGCGGAAGCCAAGAGCCGGGCCCAACGCAACGATGGCCTTGACGTTCCC
GGTCGGGTCGAAGAAGCGCGGCAACTGTCGGAGACCAAGCGATCCTGCCTCAAGCGGAAAGCAGCCGATATGTTG
GAGTCGAACCCGAAGGTCGGCCCCAAGGCATCATCGAGCAGCTCAGAGACGAGGCTCGCCGCTCGCAACTCTATG
GACGAGTCCCGGACCGTGAAGCGGCTCCGAACAGCAGCCGAGGTGCTGGGATACGCGGCACTGGGCGGTGTGGCG
GTGGTGTCGGCTCTGATTGCCACGGCGCCGTCGCTTTAA
Transcript >Ophun1|1652
ATGCCGTCGAATCACGCGGATCAAGTCCGCGTCGATCTGACCCCAACATCGCGGGCTTCCGAGGCCTCAGCCTCC
AACCTCGCCCGTCATGTCGTCTTGACCAGAGATTCCCCCAGCCTGCAAATCGGCCGCATGAGCCAGAGGAACCCC
GACCTTAGGGCCTCGTCGGCAAACGCCTGGTTCGAGTCGGCCGTCATGTCTCGTCATCATGCCAAGCTGCACTTT
GATGCAGACCAGACGACGCTCTCCATCGAAGATACTCAATCTCTGCACGGCACCTTCCATAATGGCACTCGCCTT
GAGTCGGGCATGCAGTCCCAGCTACACTCTGGGGATGAACTCTGCTTCGGAATTCAAGTCGACAGACATACGGAT
ACCTTTCCGCCCTGTGCCATGACGGTCACTTTTGAATTTGACGAAGCCAACAGCCAACCTCGGCAAAACCCCGTC
GTCTACAAGGTTCCCGATGACACTGACGTCGAGGACACAAGCGATGACGATAAAGACGAAGAGGACGAGGACGAG
GACGCAGAGGACTCGAGCATATGCAGCAGCATCCATGTCCTTCGCGAGAACCGCCTTCACCCAGCTGAAGCATTT
CTGATACGCGATACTGTGGCCATCGATCTGACGTCCGACGCCAACACGCCTGAAAATCAGGCATCCGACTGCGAG
GTCCTGGAACCCAACTACCAAGCCCAAGATGCTCCCGAAGACCACCATGTGATTCCCGAGACGGTGCAGCATGGT
GGCCTGGAGCCGGCCGAAGACGTGTGGCAGCCAGTGTCGCCCGTCTCCCACTCGGTCGACAACCATCAGGGTGCT
GGTGCTCACGTCGGCCCTCGTCCGCGCGCCGACGGTATTCCTGGCGCCGGATCGGATGAATGGGAACATGGCAGT
ACCACTGAGCAGTGCCGCGTTGCATCCGCGCGCCCTTGTACCTTGCCCGCCTCGTGGGAGACGCAGGGATCCTCG
GACGGGCTTGAATCAGACGCTGGCGTGGCCTTTTGCCTAAATCCAGTTTCATCGAATCCGCCTCCCAGGTCAACC
ATCCCCGCTCCCAAAAGGTTCGATTTGGCAAATCTGTTGTCACCGTCGAACCAAGCGTCATCCAGCTTCTGCGAT
CCCACCCGTACAATCGTCTCTCAAGATATGGCACGGCCGGAGTGCGGAAGCCCGCTGCCCTCGTTGGCTACCGCT
CGGCCGACTCTTTGGGGAAGCGACTCTCCCCTCGGTTTCAAAAAACAGAGCGCCCAAGCAGCAGCTGAGGCTCTA
GGCCAGAAGGCTGGCAAGCCGGAGTATTTCACCGCCCGCCTCGCCAACAAGCGCTTCGTCGAACAATTGTGCGAA
GTCGCCCAGCAGCTTGAACAGACGGAGGCTGATTCGCCTGAAAGCTCTGCCGAGGAAGCTCACAACGAGGATGTC
GCCATGGAAAATACTAGCGACGAAGATCAAGGCGGCCACGAGAAAGACGACCAGGGTTCCGTTTCGCTATTTGCA
CTATCGGGCGAGAACCCTCTCATCGCGTTGGAAGACGCATCCAAGAACAAGCTGCTGGCCTCTGGCGAAAGGTTT
CTGCTGTCGCCTCCTCAGGAGCCCGTGGCATCCCGGCCGCCGGTCGAATCGCCCGAGTTGAACGACTTGTCGGCC
CACGAGTTTGAACTGAGCAAGATGAACGCGGAAGCCAAGAGCCGGGCCCAACGCAACGATGGCCTTGACGTTCCC
GGTCGGGTCGAAGAAGCGCGGCAACTGTCGGAGACCAAGCGATCCTGCCTCAAGCGGAAAGCAGCCGATATGTTG
GAGTCGAACCCGAAGGTCGGCCCCAAGGCATCATCGAGCAGCTCAGAGACGAGGCTCGCCGCTCGCAACTCTATG
GACGAGTCCCGGACCGTGAAGCGGCTCCGAACAGCAGCCGAGGTGCTGGGATACGCGGCACTGGGCGGTGTGGCG
GTGGTGTCGGCTCTGATTGCCACGGCGCCGTCGCTTTAA
Gene >Ophun1|1652
ATGCCGTCGAATCACGCGGATCAAGGTGAGCTTCATCCCGCCACTCTCCCTTCTCCCCTCTCCCCTCTACCCTTC
GCTTCCGGCTAATGACGTCGTCCAGTCCGCGTCGATCTGACCCCAACATCGCGGGCTTCCGAGGCCTCAGCCTCC
AACCTCGCCCGTCATGTCGTCTTGACCAGAGATTCCCCCAGCCTGCAAATCGGCCGCATGAGCCAGAGGAACCCC
GACCTTAGGGCCTCGTCGGCAAACGCCTGGTTCGAGTCGGCCGTCATGTCTCGTCATCATGCCAAGCTGCACTTT
GATGCAGACCAGACGGTAGCGATCCCCCTCCCATACCAGAGGCATTTTCTTGGAAATATTTACTGACTCTTACTT
GCCTCTTCAGACGCTCTCCATCGAAGATACTCAATCTCTGCACGGCACCTTCCATAATGGCACTCGCCTTGAGTC
GGGCATGCAGTCCCAGCTACACTCTGGGGATGAACTCTGCTTCGGAATTCAAGTCGACAGACATACGGATACCTT
TCCGCCCTGTGCCATGACGGTCACTTTTGAATTTGACGAAGCCAACAGGTGTGTCCTTCCCTCGTCATCGCCCTT
CCATCCCGACTTTACTAATGTCTCGTCTTTCAGCCAACCTCGGCAAAACCCCGTCGTCTACAAGGTTCCCGATGA
CACTGACGTCGAGGACACAAGCGATGACGATAAAGACGAAGAGGACGAGGACGAGGACGCAGAGGACTCGAGCAT
ATGCAGCAGCATCCATGTCCTTCGCGAGAACCGCCTTCACCCAGCTGAAGCATTTCTGATACGCGATACTGTGGC
CATCGATCTGACGTCCGACGCCAACACGCCTGAAAATCAGGCATCCGACTGCGAGGTCCTGGAACCCAACTACCA
AGCCCAAGATGCTCCCGAAGACCACCATGTGATTCCCGAGACGGTGCAGCATGGTGGCCTGGAGCCGGCCGAAGA
CGTGTGGCAGCCAGTGTCGCCCGTCTCCCACTCGGTCGACAACCATCAGGGTGCTGGTGCTCACGTCGGCCCTCG
TCCGCGCGCCGACGGTATTCCTGGCGCCGGATCGGATGAATGGGAACATGGCAGTACCACTGAGCAGTGCCGCGT
TGCATCCGCGCGCCCTTGTACCTTGCCCGCCTCGTGGGAGACGCAGGGATCCTCGGACGGGCTTGAATCAGACGC
TGGCGTGGCCTTTTGCCTAAATCCAGGTAAGCAGCATAATGTTCCCGACATGGACAAACACATTTTGGCTGACAG
TCCGCTGCAATAGTTTCATCGAATCCGCCTCCCAGGTCAACCATCCCCGCTCCCAAAAGGTTCGATTTGGCAAAT
CTGTTGTCACCGTCGAACCAAGCGTCATCCAGCTTCTGCGATCCCACCCGTACAATCGTCTCTCAAGATATGGCA
CGGCCGGAGTGCGGAAGCCCGCTGCCCTCGTTGGCTACCGCTCGGCCGACTCTTTGGGGAAGCGACTCTCCCCTC
GGTTTCAAAAAACAGAGCGCCCAAGCAGCAGCTGAGGCTCTAGGCCAGAAGGCTGGCAAGCCGGAGTATTTCACC
GCCCGCCTCGCCAACAAGCGCTTCGTCGAACAATTGTGCGAAGTCGCCCAGCAGCTTGAACAGACGGAGGCTGAT
TCGCCTGAAAGCTCTGCCGAGGAAGCTCACAACGAGGATGTCGCCATGGAAAATACTAGCGACGAAGATCAAGGC
GGCCACGAGAAAGACGACCAGGGTTCCGTTTCGCTATTTGCACTATCGGGCGAGAACCCTCTCATCGCGTTGGAA
GACGCATCCAAGAACAAGCTGCTGGCCTCTGGCGAAAGGTTTCTGCTGTCGCCTCCTCAGGAGCCCGTGGCATCC
CGGCCGCCGGTCGAATCGCCCGAGTTGAACGACTTGTCGGCCCACGAGTTTGAACTGAGCAAGATGAACGCGGAA
GCCAAGAGCCGGGCCCAACGCAACGATGGCCTTGACGTTCCCGGTCGGGTCGAAGAAGCGCGGCAACTGTCGGAG
ACCAAGCGATCCTGCCTCAAGCGGAAAGCAGCCGATATGTTGGAGTCGAACCCGAAGGTCGGCCCCAAGGCATCA
TCGAGCAGCTCAGAGACGAGGCTCGCCGCTCGCAACTCTATGGACGAGTCCCGGACCGTGAAGCGGCTCCGAACA
GCAGCCGAGGTGCTGGGATACGCGGCACTGGGCGGTGTGGCGGTGGTGTCGGCTCTGATTGCCACGGCGCCGTCG
CTTTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail