Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|1641
Gene name
LocationContig_170:2679..5588
Strand-
Gene length (bp)2909
Transcript length (bp)2409
Coding sequence length (bp)2409
Protein length (aa) 803

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01915 Glyco_hydro_3_C Glycosyl hydrolase family 3 C-terminal domain 6.3E-40 398 669
PF00933 Glyco_hydro_3 Glycosyl hydrolase family 3 N terminal domain 4.3E-33 118 348
PF14310 Fn3-like Fibronectin type III-like domain 2.9E-23 723 791

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|A1D122|BGLM_NEOFI Probable beta-glucosidase M OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=bglM PE=3 SV=1 51 802 0.0E+00
sp|Q4WR62|BGLM_ASPFU Probable beta-glucosidase M OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=bglM PE=3 SV=1 51 802 0.0E+00
sp|B0XPB8|BGLM_ASPFC Probable beta-glucosidase M OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=bglM PE=3 SV=1 51 802 0.0E+00
sp|A5ABF5|BGLM_ASPNC Probable beta-glucosidase M OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=bglM PE=3 SV=1 56 802 0.0E+00
sp|Q2UDK7|BGLM_ASPOR Probable beta-glucosidase M OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=bglM PE=3 SV=1 56 802 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|A1D122|BGLM_NEOFI Probable beta-glucosidase M OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=bglM PE=3 SV=1 51 802 0.0E+00
sp|Q4WR62|BGLM_ASPFU Probable beta-glucosidase M OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=bglM PE=3 SV=1 51 802 0.0E+00
sp|B0XPB8|BGLM_ASPFC Probable beta-glucosidase M OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=bglM PE=3 SV=1 51 802 0.0E+00
sp|A5ABF5|BGLM_ASPNC Probable beta-glucosidase M OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=bglM PE=3 SV=1 56 802 0.0E+00
sp|Q2UDK7|BGLM_ASPOR Probable beta-glucosidase M OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=bglM PE=3 SV=1 56 802 0.0E+00
sp|B8N5S6|BGLM_ASPFN Probable beta-glucosidase M OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=bglM PE=3 SV=1 56 802 0.0E+00
sp|Q0C7L4|BGLM_ASPTN Probable beta-glucosidase M OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=bglM PE=3 SV=1 56 802 0.0E+00
sp|Q5AWD4|BGLM_EMENI Probable beta-glucosidase M OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=bglM PE=3 SV=1 56 800 0.0E+00
sp|G4N7Z0|CEL3B_MAGO7 Beta-glucosidase cel3A OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=cel3B PE=1 SV=1 63 802 0.0E+00
sp|Q5B0F4|BGLG_EMENI Probable beta-glucosidase G OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=bglG PE=3 SV=2 60 794 0.0E+00
sp|Q2U325|BGLG_ASPOR Probable beta-glucosidase G OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=bglG PE=3 SV=1 27 800 0.0E+00
sp|B8NMR5|BGLG_ASPFN Probable beta-glucosidase G OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=bglG PE=3 SV=1 27 800 0.0E+00
sp|A1DC16|BGLG_NEOFI Probable beta-glucosidase G OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=bglG PE=3 SV=1 27 794 2.0E-177
sp|Q0CUC1|BGLG_ASPTN Probable beta-glucosidase G OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=bglG PE=3 SV=1 60 794 2.0E-175
sp|Q0CEF3|BGLL_ASPTN Probable beta-glucosidase L OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=bglL PE=3 SV=1 77 802 3.0E-167
sp|G4NI45|CEL3A_MAGO7 Beta-glucosidase cel3A OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=cel3A PE=1 SV=1 77 796 6.0E-158
sp|B0YB65|BGLL_ASPFC Probable beta-glucosidase L OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=bglL PE=3 SV=1 74 802 1.0E-157
sp|Q4WGT3|BGLL_ASPFU Probable beta-glucosidase L OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=bglL PE=3 SV=1 74 802 1.0E-157
sp|A1DCV5|BGLL_NEOFI Probable beta-glucosidase L OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=bglL PE=3 SV=1 74 802 4.0E-156
sp|Q5B9F2|BGLL_EMENI Probable beta-glucosidase L OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=bglL PE=3 SV=1 77 802 4.0E-154
sp|P22507|BGL2_SACFI Beta-glucosidase 2 OS=Saccharomycopsis fibuligera GN=BGL2 PE=3 SV=1 63 788 5.0E-146
sp|P48825|BGL1_ASPAC Beta-glucosidase 1 OS=Aspergillus aculeatus PE=1 SV=1 45 680 1.0E-140
sp|Q2UUD6|BGLA_ASPOR Probable beta-glucosidase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=bglA PE=3 SV=1 54 680 7.0E-140
sp|B8NRX2|BGLA_ASPFN Probable beta-glucosidase A OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=bglA PE=3 SV=1 54 680 1.0E-139
sp|A2QPK4|BGLD_ASPNC Probable beta-glucosidase D OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=bglD PE=3 SV=2 37 802 4.0E-139
sp|A1CR85|BGLA_ASPCL Probable beta-glucosidase A OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=bglA PE=3 SV=1 59 800 9.0E-139
sp|A1D451|BGLA_NEOFI Probable beta-glucosidase A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=bglA PE=3 SV=1 32 800 6.0E-138
sp|P87076|BGLA_ASPKW Beta-glucosidase A OS=Aspergillus kawachii (strain NBRC 4308) GN=bglA PE=1 SV=2 44 680 1.0E-137
sp|A2RAL4|BGLA_ASPNC Probable beta-glucosidase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=bglA PE=3 SV=1 44 680 1.0E-136
sp|B8NJF4|BGLD_ASPFN Probable beta-glucosidase D OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=bglD PE=3 SV=2 75 802 6.0E-136
sp|Q2UNR0|BGLD_ASPOR Probable beta-glucosidase D OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=bglD PE=3 SV=1 75 802 3.0E-135
sp|Q4WD56|BGLE_ASPFU Probable beta-glucosidase E OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=bglE PE=3 SV=1 67 799 4.0E-135
sp|B0YD91|BGLE_ASPFC Probable beta-glucosidase E OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=bglE PE=3 SV=1 67 799 4.0E-135
sp|P22506|BGL1_SACFI Beta-glucosidase 1 OS=Saccharomycopsis fibuligera GN=BGL1 PE=3 SV=1 29 788 2.0E-134
sp|Q0CI67|BGLF_ASPTN Probable beta-glucosidase F OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=bglF PE=3 SV=1 63 790 5.0E-134
sp|Q4WJJ3|BGLA_ASPFU Probable beta-glucosidase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=bglA PE=3 SV=1 32 680 5.0E-134
sp|B0XPE1|BGLA_ASPFC Probable beta-glucosidase A OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=bglA PE=3 SV=1 32 680 5.0E-134
sp|Q5B5S8|BGLA_EMENI Probable beta-glucosidase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=bglA PE=3 SV=2 75 680 6.0E-134
sp|A1CMH6|BGLE_ASPCL Probable beta-glucosidase E OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=bglE PE=3 SV=1 67 681 3.0E-133
sp|D4AN50|BGLA_ARTBC Probable beta-glucosidase ARB_05654 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_05654 PE=1 SV=1 62 680 9.0E-132
sp|Q2UTX5|BGLE_ASPOR Probable beta-glucosidase E OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=bglE PE=3 SV=2 67 681 1.0E-128
sp|Q5B6C6|BGLF_EMENI Probable beta-glucosidase F OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=bglF PE=3 SV=2 63 676 1.0E-127
sp|B8NP65|BGLF_ASPFN Probable beta-glucosidase F OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=bglF PE=3 SV=1 62 690 3.0E-127
sp|A1DMR8|BGLF_NEOFI Probable beta-glucosidase F OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=bglF PE=3 SV=1 63 690 3.0E-127
sp|B0Y7Q8|BGLF_ASPFC Probable beta-glucosidase F OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=bglF PE=3 SV=2 63 702 6.0E-127
sp|Q2UN12|BGLF_ASPOR Probable beta-glucosidase F OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=bglF PE=3 SV=1 62 690 8.0E-127
sp|Q4WMU3|BGLF_ASPFU Probable beta-glucosidase F OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=bglF PE=3 SV=2 63 702 2.0E-126
sp|A1DLJ5|BGLE_NEOFI Probable beta-glucosidase E OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=bglE PE=3 SV=1 28 679 4.0E-126
sp|Q5AYH8|BGLE_EMENI Probable beta-glucosidase E OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=bglE PE=3 SV=1 67 679 2.0E-125
sp|P06835|BGLS_WICAO Beta-glucosidase OS=Wickerhamomyces anomalus PE=3 SV=1 37 681 3.0E-122
sp|Q5B681|BGLN_EMENI Probable beta-glucosidase N OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=bglN PE=3 SV=1 233 802 6.0E-108
sp|Q0CTD7|BGLA_ASPTN Probable beta-glucosidase A OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=bglA PE=3 SV=1 38 351 2.0E-99
sp|D0VKF5|BGLA_ASPTE Probable beta-glucosidase A OS=Aspergillus terreus GN=bglA PE=2 SV=1 62 351 7.0E-98
sp|Q5AUW5|BGLD_EMENI Probable beta-glucosidase D OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=bglD PE=3 SV=2 248 800 2.0E-97
sp|P14002|BGLB_CLOTH Thermostable beta-glucosidase B OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=bglB PE=1 SV=2 85 797 5.0E-90
sp|F6C6C1|APY_BIFBA Exo-alpha-(1->6)-L-arabinopyranosidase OS=Bifidobacterium breve (strain ACS-071-V-Sch8b) GN=HMPREF9228_1477 PE=1 SV=1 88 792 2.0E-69
sp|E7CY69|APY_BIFLN Exo-alpha-(1->6)-L-arabinopyranosidase OS=Bifidobacterium longum GN=apy PE=1 SV=1 88 792 3.0E-61
sp|A1DFA8|BGLI_NEOFI Probable beta-glucosidase I OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=bglI PE=3 SV=1 88 425 3.0E-44
sp|Q56078|BGLX_SALTY Periplasmic beta-glucosidase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=bglX PE=3 SV=2 113 793 6.0E-44
sp|Q4WU49|BGLI_ASPFU Probable beta-glucosidase I OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=bglI PE=3 SV=1 88 425 7.0E-44
sp|B0Y3M6|BGLI_ASPFC Probable beta-glucosidase I OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=bglI PE=3 SV=1 88 425 1.0E-43
sp|A1CA51|BGLI_ASPCL Probable beta-glucosidase I OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=bglI PE=3 SV=1 81 425 8.0E-43
sp|P27034|BGLS_RHIRD Beta-glucosidase OS=Rhizobium radiobacter GN=cbg-1 PE=3 SV=1 87 425 4.0E-42
sp|Q0CAF5|BGLI_ASPTN Probable beta-glucosidase I OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=bglI PE=3 SV=1 88 425 5.0E-42
sp|Q2U8Y5|BGLI_ASPOR Probable beta-glucosidase I OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=bglI PE=3 SV=1 88 425 5.0E-42
sp|B8NDE2|BGLI_ASPFN Probable beta-glucosidase I OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=bglI PE=3 SV=2 88 425 6.0E-42
sp|Q5BB53|BGLI_EMENI Probable beta-glucosidase I OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=bglI PE=2 SV=2 88 425 1.0E-41
sp|P33363|BGLX_ECOLI Periplasmic beta-glucosidase OS=Escherichia coli (strain K12) GN=bglX PE=1 SV=2 113 802 4.0E-41
sp|Q5AV15|BGLJ_EMENI Probable beta-glucosidase J OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=bglJ PE=3 SV=1 62 425 8.0E-40
sp|Q5BFG8|BGLB_EMENI Beta-glucosidase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=bglB PE=1 SV=1 85 468 2.0E-38
sp|D0VKF5|BGLA_ASPTE Probable beta-glucosidase A OS=Aspergillus terreus GN=bglA PE=2 SV=1 468 800 3.0E-38
sp|A2R989|BGLI_ASPNC Probable beta-glucosidase I OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=bglI PE=3 SV=1 116 425 5.0E-38
sp|Q0CTD7|BGLA_ASPTN Probable beta-glucosidase A OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=bglA PE=3 SV=1 468 800 1.0E-37
sp|B0Y8M8|BGLJ_ASPFC Probable beta-glucosidase J OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=bglJ PE=3 SV=2 87 425 1.0E-37
sp|Q4WLY1|BGLJ_ASPFU Probable beta-glucosidase J OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=bglJ PE=3 SV=2 87 425 1.0E-37
sp|A1DNN8|BGLJ_NEOFI Probable beta-glucosidase J OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=bglJ PE=3 SV=1 87 345 6.0E-36
sp|Q9P6J6|BGLS_SCHPO Putative beta-glucosidase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1683.04 PE=3 SV=1 87 334 3.0E-34
sp|P07337|BGLS_KLUMA Beta-glucosidase OS=Kluyveromyces marxianus PE=3 SV=1 87 483 1.0E-31
sp|Q5B6C7|BGLH_EMENI Probable beta-glucosidase H OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=bglH PE=3 SV=2 87 522 2.0E-31
sp|A7LXS8|BGH3A_BACO1 Beta-glucosidase BoGH3A OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / NCTC 11153) GN=BACOVA_02644 PE=1 SV=1 90 330 2.0E-31
sp|Q94KD8|BXL2_ARATH Probable beta-D-xylosidase 2 OS=Arabidopsis thaliana GN=BXL2 PE=2 SV=1 82 796 3.0E-31
sp|Q5BA18|BGLK_EMENI Probable beta-glucosidase K OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=bglK PE=2 SV=1 74 345 5.0E-31
sp|Q4WA69|BGLK_ASPFU Probable beta-glucosidase K OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=bglK PE=3 SV=1 87 345 9.0E-30
sp|Q2U9M7|BGLH_ASPOR Probable beta-glucosidase H OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=bglH PE=3 SV=2 87 348 3.0E-29
sp|B8NPL7|BGLH_ASPFN Probable beta-glucosidase H OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=bglH PE=3 SV=1 87 348 3.0E-29
sp|B8NDE2|BGLI_ASPFN Probable beta-glucosidase I OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=bglI PE=3 SV=2 506 801 1.0E-28
sp|Q2U8Y5|BGLI_ASPOR Probable beta-glucosidase I OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=bglI PE=3 SV=1 506 801 8.0E-28
sp|A1DPG0|BGLH_NEOFI Probable beta-glucosidase H OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=bglH PE=3 SV=1 521 802 8.0E-28
sp|A1CUR8|BGLH_ASPCL Probable beta-glucosidase H OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=bglH PE=3 SV=1 116 424 1.0E-27
sp|Q5BFG8|BGLB_EMENI Beta-glucosidase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=bglB PE=1 SV=1 506 802 2.0E-27
sp|Q9LXD6|BXL3_ARATH Beta-D-xylosidase 3 OS=Arabidopsis thaliana GN=BXL3 PE=1 SV=1 87 797 2.0E-27
sp|A1DPG0|BGLH_NEOFI Probable beta-glucosidase H OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=bglH PE=3 SV=1 116 424 4.0E-27
sp|B0XM94|BGLH_ASPFC Probable beta-glucosidase H OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=bglH PE=3 SV=1 116 424 4.0E-27
sp|Q4WL79|BGLH_ASPFU Probable beta-glucosidase H OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=bglH PE=3 SV=1 116 424 4.0E-27
sp|Q9LJN4|BXL5_ARATH Probable beta-D-xylosidase 5 OS=Arabidopsis thaliana GN=BXL5 PE=2 SV=2 84 791 5.0E-27
sp|B0XM94|BGLH_ASPFC Probable beta-glucosidase H OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=bglH PE=3 SV=1 521 802 7.0E-27
sp|Q4WL79|BGLH_ASPFU Probable beta-glucosidase H OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=bglH PE=3 SV=1 521 802 8.0E-27
sp|Q0CB82|BXLB_ASPTN Probable exo-1,4-beta-xylosidase bxlB OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=bxlB PE=3 SV=1 84 768 9.0E-27
sp|Q5B6C7|BGLH_EMENI Probable beta-glucosidase H OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=bglH PE=3 SV=2 514 802 5.0E-26
sp|A1CUR8|BGLH_ASPCL Probable beta-glucosidase H OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=bglH PE=3 SV=1 511 792 8.0E-26
sp|A1CA51|BGLI_ASPCL Probable beta-glucosidase I OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=bglI PE=3 SV=1 506 801 2.0E-25
sp|Q9FLG1|BXL4_ARATH Beta-D-xylosidase 4 OS=Arabidopsis thaliana GN=BXL4 PE=1 SV=1 87 774 2.0E-25
sp|Q4WU49|BGLI_ASPFU Probable beta-glucosidase I OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=bglI PE=3 SV=1 506 801 3.0E-25
sp|Q2U9M7|BGLH_ASPOR Probable beta-glucosidase H OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=bglH PE=3 SV=2 511 792 3.0E-25
sp|B8NPL7|BGLH_ASPFN Probable beta-glucosidase H OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=bglH PE=3 SV=1 511 792 3.0E-25
sp|B0Y3M6|BGLI_ASPFC Probable beta-glucosidase I OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=bglI PE=3 SV=1 506 801 4.0E-25
sp|P29091|BGLS_SCHCO Beta-glucosidase (Fragment) OS=Schizophyllum commune PE=2 SV=1 485 663 7.0E-25
sp|A2R989|BGLI_ASPNC Probable beta-glucosidase I OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=bglI PE=3 SV=1 506 787 1.0E-24
sp|A1DNN8|BGLJ_NEOFI Probable beta-glucosidase J OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=bglJ PE=3 SV=1 521 785 1.0E-24
sp|Q4WLY1|BGLJ_ASPFU Probable beta-glucosidase J OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=bglJ PE=3 SV=2 521 785 2.0E-24
sp|P15885|BGLS_RUMAL Beta-glucosidase OS=Ruminococcus albus PE=3 SV=1 111 313 2.0E-24
sp|Q5BB53|BGLI_EMENI Probable beta-glucosidase I OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=bglI PE=2 SV=2 496 787 3.0E-24
sp|Q0CAF5|BGLI_ASPTN Probable beta-glucosidase I OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=bglI PE=3 SV=1 528 801 1.0E-23
sp|B0Y8M8|BGLJ_ASPFC Probable beta-glucosidase J OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=bglJ PE=3 SV=2 521 785 1.0E-23
sp|A1DJS5|XYND_NEOFI Probable exo-1,4-beta-xylosidase xlnD OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=xlnD PE=3 SV=1 84 768 1.0E-23
sp|A5JTQ3|XYL2_MEDSV Beta-xylosidase/alpha-L-arabinofuranosidase 2 OS=Medicago sativa subsp. varia GN=Xyl2 PE=2 SV=1 85 770 2.0E-23
sp|Q5BA18|BGLK_EMENI Probable beta-glucosidase K OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=bglK PE=2 SV=1 576 802 7.0E-23
sp|A1DFA8|BGLI_NEOFI Probable beta-glucosidase I OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=bglI PE=3 SV=1 506 797 9.0E-23
sp|P27034|BGLS_RHIRD Beta-glucosidase OS=Rhizobium radiobacter GN=cbg-1 PE=3 SV=1 528 791 2.0E-22
sp|P16084|BGLS_BUTFI Beta-glucosidase A OS=Butyrivibrio fibrisolvens GN=bglA PE=3 SV=1 541 792 2.0E-22
sp|P16084|BGLS_BUTFI Beta-glucosidase A OS=Butyrivibrio fibrisolvens GN=bglA PE=3 SV=1 78 359 8.0E-22
sp|P07337|BGLS_KLUMA Beta-glucosidase OS=Kluyveromyces marxianus PE=3 SV=1 489 791 2.0E-21
sp|Q2TYT2|BXLB_ASPOR Probable exo-1,4-beta-xylosidase bxlB OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=bxlB PE=3 SV=1 84 768 2.0E-21
sp|B8NYD8|BXLB_ASPFN Probable exo-1,4-beta-xylosidase bxlB OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=bxlB PE=3 SV=1 84 768 4.0E-21
sp|Q9P6J6|BGLS_SCHPO Putative beta-glucosidase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1683.04 PE=3 SV=1 521 802 5.0E-21
sp|A7LXS8|BGH3A_BACO1 Beta-glucosidase BoGH3A OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / NCTC 11153) GN=BACOVA_02644 PE=1 SV=1 578 791 4.0E-20
sp|Q5AV15|BGLJ_EMENI Probable beta-glucosidase J OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=bglJ PE=3 SV=1 521 792 1.0E-19
sp|D5EY15|XYL3A_PRER2 Xylan 1,4-beta-xylosidase OS=Prevotella ruminicola (strain ATCC 19189 / JCM 8958 / 23) GN=xyl3A PE=1 SV=1 574 791 1.0E-19
sp|B0YBJ3|BGLK_ASPFC Probable beta-glucosidase K OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=bglK PE=3 SV=1 87 345 4.0E-19
sp|O00089|XYND_ASPNG Exo-1,4-beta-xylosidase xlnD OS=Aspergillus niger GN=xlnD PE=1 SV=2 78 802 6.0E-19
sp|A2QA27|XYND_ASPNC Probable exo-1,4-beta-xylosidase xlnD OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=xlnD PE=3 SV=1 78 802 6.0E-19
sp|A7LXU3|BGH3B_BACO1 Beta-glucosidase BoGH3B OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / NCTC 11153) GN=BACOVA_02659 PE=1 SV=1 116 424 2.0E-18
sp|A1CMH6|BGLE_ASPCL Probable beta-glucosidase E OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=bglE PE=3 SV=1 702 799 4.0E-18
sp|Q4AEG8|XYND_ASPAW Exo-1,4-beta-xylosidase xlnD OS=Aspergillus awamori GN=xlnD PE=2 SV=1 78 802 4.0E-17
sp|Q9LXA8|BXL6_ARATH Probable beta-D-xylosidase 6 OS=Arabidopsis thaliana GN=BXL6 PE=2 SV=1 84 759 4.0E-17
sp|D5EY15|XYL3A_PRER2 Xylan 1,4-beta-xylosidase OS=Prevotella ruminicola (strain ATCC 19189 / JCM 8958 / 23) GN=xyl3A PE=1 SV=1 80 411 1.0E-16
sp|P15885|BGLS_RUMAL Beta-glucosidase OS=Ruminococcus albus PE=3 SV=1 517 770 2.0E-16
sp|Q5AUW5|BGLD_EMENI Probable beta-glucosidase D OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=bglD PE=3 SV=2 75 237 5.0E-16
sp|Q5ATH9|BXLB_EMENI Exo-1,4-beta-xylosidase bxlB OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=bxlB PE=1 SV=1 82 419 7.0E-16
sp|Q5B5S8|BGLA_EMENI Probable beta-glucosidase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=bglA PE=3 SV=2 689 800 1.0E-15
sp|Q5B6C6|BGLF_EMENI Probable beta-glucosidase F OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=bglF PE=3 SV=2 688 802 2.0E-15
sp|A7LXU3|BGH3B_BACO1 Beta-glucosidase BoGH3B OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / NCTC 11153) GN=BACOVA_02659 PE=1 SV=1 545 790 2.0E-15
sp|Q23892|GLUA_DICDI Lysosomal beta glucosidase OS=Dictyostelium discoideum GN=gluA PE=1 SV=2 546 796 2.0E-15
sp|Q2UTX5|BGLE_ASPOR Probable beta-glucosidase E OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=bglE PE=3 SV=2 683 799 4.0E-15
sp|A5JTQ2|XYL1_MEDSV Beta-xylosidase/alpha-L-arabinofuranosidase 1 (Fragment) OS=Medicago sativa subsp. varia GN=Xyl1 PE=1 SV=1 82 424 4.0E-15
sp|Q9FGY1|BXL1_ARATH Beta-D-xylosidase 1 OS=Arabidopsis thaliana GN=BXL1 PE=1 SV=1 83 419 4.0E-15
sp|B8NP65|BGLF_ASPFN Probable beta-glucosidase F OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=bglF PE=3 SV=1 688 790 7.0E-15
sp|Q2UN12|BGLF_ASPOR Probable beta-glucosidase F OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=bglF PE=3 SV=1 688 790 7.0E-15
sp|Q4WJJ3|BGLA_ASPFU Probable beta-glucosidase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=bglA PE=3 SV=1 671 800 3.0E-14
sp|B0XPE1|BGLA_ASPFC Probable beta-glucosidase A OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=bglA PE=3 SV=1 671 800 3.0E-14
sp|P48825|BGL1_ASPAC Beta-glucosidase 1 OS=Aspergillus aculeatus PE=1 SV=1 689 800 4.0E-14
sp|A1DLJ5|BGLE_NEOFI Probable beta-glucosidase E OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=bglE PE=3 SV=1 702 799 5.0E-14
sp|Q5BAS1|XYND_EMENI Exo-1,4-beta-xylosidase xlnD OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=xlnD PE=1 SV=1 82 794 2.0E-13
sp|Q5AYH8|BGLE_EMENI Probable beta-glucosidase E OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=bglE PE=3 SV=1 696 796 3.0E-13
sp|B6EY09|XYND_ASPJA Probable exo-1,4-beta-xylosidase xlnD OS=Aspergillus japonicus GN=xlnD PE=1 SV=1 78 761 3.0E-13
sp|A1CCL9|BXLB_ASPCL Probable exo-1,4-beta-xylosidase bxlB OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=bxlB PE=3 SV=2 84 419 4.0E-13
sp|C0STH4|XYND_ASPAC Probable exo-1,4-beta-xylosidase xlnD OS=Aspergillus aculeatus GN=xlnD PE=3 SV=1 78 761 1.0E-12
sp|B0Y7Q8|BGLF_ASPFC Probable beta-glucosidase F OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=bglF PE=3 SV=2 688 802 2.0E-12
sp|Q4WMU3|BGLF_ASPFU Probable beta-glucosidase F OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=bglF PE=3 SV=2 688 802 2.0E-12
sp|A1DMR8|BGLF_NEOFI Probable beta-glucosidase F OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=bglF PE=3 SV=1 688 802 5.0E-12
sp|Q4WFI6|BXLB_ASPFU Probable exo-1,4-beta-xylosidase bxlB OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=bxlB PE=3 SV=1 83 312 5.0E-12
sp|B0Y0I4|BXLB_ASPFC Probable exo-1,4-beta-xylosidase bxlB OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=bxlB PE=3 SV=1 83 312 5.0E-12
sp|Q4WRB0|XYND_ASPFU Probable exo-1,4-beta-xylosidase xlnD OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=xlnD PE=2 SV=1 78 309 3.0E-11
sp|B0XP71|XYND_ASPFC Probable exo-1,4-beta-xylosidase xlnD OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=xlnD PE=3 SV=1 78 309 3.0E-11
sp|A1CND4|XYND_ASPCL Probable exo-1,4-beta-xylosidase xlnD OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=xlnD PE=3 SV=2 81 309 6.0E-11
sp|P40406|NAGZ_BACSU Beta-hexosaminidase OS=Bacillus subtilis (strain 168) GN=nagZ PE=1 SV=1 142 346 4.0E-10
sp|B2FPW9|NAGZ_STRMK Beta-hexosaminidase OS=Stenotrophomonas maltophilia (strain K279a) GN=nagZ PE=3 SV=1 156 309 9.0E-10
sp|Q4WFI6|BXLB_ASPFU Probable exo-1,4-beta-xylosidase bxlB OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=bxlB PE=3 SV=1 526 768 4.0E-09
sp|B0Y0I4|BXLB_ASPFC Probable exo-1,4-beta-xylosidase bxlB OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=bxlB PE=3 SV=1 526 768 4.0E-09
sp|Q9SGZ5|BXL7_ARATH Probable beta-D-xylosidase 7 OS=Arabidopsis thaliana GN=BXL7 PE=2 SV=2 84 312 4.0E-09
sp|Q23892|GLUA_DICDI Lysosomal beta glucosidase OS=Dictyostelium discoideum GN=gluA PE=1 SV=2 128 328 5.0E-09
sp|B4SRK3|NAGZ_STRM5 Beta-hexosaminidase OS=Stenotrophomonas maltophilia (strain R551-3) GN=nagZ PE=3 SV=1 156 309 6.0E-09
sp|P83344|XYNB_PRUPE Putative beta-D-xylosidase (Fragment) OS=Prunus persica PE=2 SV=1 522 761 2.0E-08
sp|B8NGU6|BGLC_ASPFN Probable beta-glucosidase C OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=bglC PE=3 SV=1 118 311 3.0E-08
sp|Q5BCC6|BGLC_EMENI Beta-glucosidase C OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=bglC PE=1 SV=1 69 311 3.0E-08
sp|Q0CMH8|XYND_ASPTN Probable exo-1,4-beta-xylosidase xlnD OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=xlnD PE=3 SV=2 78 312 3.0E-08
sp|B8MYV0|XYND_ASPFN Probable exo-1,4-beta-xylosidase xlnD OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=xlnD PE=3 SV=1 78 312 3.0E-08
sp|Q2UR38|XYND_ASPOR Exo-1,4-beta-xylosidase xlnD OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=xlnD PE=1 SV=1 78 312 4.0E-08
sp|Q2UFP8|BGLC_ASPOR Probable beta-glucosidase C OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=bglC PE=3 SV=2 118 311 6.0E-08
sp|Q9FGY1|BXL1_ARATH Beta-D-xylosidase 1 OS=Arabidopsis thaliana GN=BXL1 PE=1 SV=1 530 758 1.0E-07
sp|P29090|BGL3_ASPWE Beta-glucosidase A-3 (Fragment) OS=Aspergillus wentii PE=1 SV=1 299 351 2.0E-07
sp|A1CCL9|BXLB_ASPCL Probable exo-1,4-beta-xylosidase bxlB OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=bxlB PE=3 SV=2 556 768 3.0E-07
sp|Q0CMH8|XYND_ASPTN Probable exo-1,4-beta-xylosidase xlnD OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=xlnD PE=3 SV=2 556 770 8.0E-07
sp|Q5ATH9|BXLB_EMENI Exo-1,4-beta-xylosidase bxlB OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=bxlB PE=1 SV=1 556 768 1.0E-06
sp|B8GSD2|NAGZ_THISH Beta-hexosaminidase OS=Thioalkalivibrio sulfidiphilus (strain HL-EbGR7) GN=nagZ PE=3 SV=1 143 309 1.0E-06
sp|Q4WRB0|XYND_ASPFU Probable exo-1,4-beta-xylosidase xlnD OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=xlnD PE=2 SV=1 553 770 6.0E-06
sp|B0XP71|XYND_ASPFC Probable exo-1,4-beta-xylosidase xlnD OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=xlnD PE=3 SV=1 553 770 6.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005975 carbohydrate metabolic process Yes
GO:0004553 hydrolase activity, hydrolyzing O-glycosyl compounds Yes
GO:0003674 molecular_function No
GO:0008152 metabolic process No
GO:0008150 biological_process No
GO:0071704 organic substance metabolic process No
GO:0003824 catalytic activity No
GO:0016787 hydrolase activity No
GO:0016798 hydrolase activity, acting on glycosyl bonds No
GO:0044238 primary metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 53 0.5

Transmembrane Domains

Domain # Start End Length
1 29 51 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|1641
MAMIETREPPAELSSPNPKQPRSSPASTIVAMIFGPLLLAAAILALLAVAAAPKDDGFFYGHSPPVYPSPAMTGG
DWAEAYDHARTLVAQMTLVEKVNLTGGVKLGSGCSGSVMPVPRLGFPGMCLSDAGNGLRATDLVNAYPSGIHVGA
SWNKGLARRRASSMAAEFRRKGVNVLLGPVVGPVGRVVRGGRNWEAFSVDPYLSGALVAETVEGIQGEGVQASVK
HYVANEQEDYRSPEAGREAVSSNIDDRTMHELYLWPFQDAVKAGCANIMCSYQRINNSYGCANSKTLNGLLKTEL
GFQGFVVSDWGAQHAGVATALAGLDLAMPSGAEFWGEHLLEAVKNGLMTTWFQFKQNDNFPNPGFGMPEKLLDPH
TPVQGRDDSSRQTLLDGALEGHVLVKNTKNTLPLKRPRMLSVFGYSAKSADDWGPSTDENLNNAYIYGVIPLDPE
GRLASLFSWVKRPATARQGTIIGGGGSGAVTPAVFTAPFEALKVRAARDDTALMYDLVSERPGVHPASDACLVFG
NAWAAEGYDRPALYDNYTDGLIRAVADKCARTVVVLHNAGVRVVDGFIDHDNVTAVIMAHLPGRDSGEALVSLLY
GDANPSGKLPYTVARAEADYGPVVGPDQPKGDYSRFPQSDFDEGIMLDYRSFDRDGKQPRFEFGFGLSYTTFALS
DLTIRTEDVHDGPLPTGAVTAGGPSDLWDVLATVEATVTNTGSVTGAEVVQLYLGFPGDEAPVRQLRGFDKVRLR
AGERRTVRFGLTRRDLSRWDVVAQGWRLADGGFGVFVGNSSRVLGLSGRLEL*
Coding >Ophun1|1641
ATGGCCATGATAGAGACGAGGGAGCCTCCAGCCGAGCTCTCAAGCCCCAACCCGAAACAGCCGAGATCCAGTCCG
GCGTCAACCATCGTCGCCATGATTTTCGGCCCTCTCCTGCTCGCTGCTGCTATTCTGGCCCTGCTGGCCGTAGCA
GCCGCGCCCAAAGACGATGGCTTCTTCTACGGCCACTCACCACCCGTCTATCCATCGCCGGCCATGACGGGCGGC
GACTGGGCCGAAGCCTACGACCACGCGCGGACCCTCGTCGCGCAGATGACGCTGGTGGAAAAGGTCAACCTCACG
GGAGGCGTCAAGCTCGGGTCCGGCTGCTCCGGGTCCGTCATGCCCGTGCCCCGGCTGGGATTCCCGGGCATGTGC
CTCAGCGACGCGGGGAATGGCCTGCGGGCTACCGACCTTGTGAATGCGTATCCGAGCGGGATCCATGTTGGCGCC
AGTTGGAACAAGGGCCTCGCTCGCCGGCGTGCCTCGTCCATGGCCGCAGAGTTCCGCAGAAAGGGCGTCAACGTG
CTTCTCGGTCCCGTCGTTGGGCCTGTCGGTCGTGTTGTTCGGGGGGGCCGCAACTGGGAGGCCTTTTCCGTTGAC
CCCTATCTCTCGGGGGCGCTCGTGGCCGAGACGGTAGAGGGTATCCAGGGCGAGGGGGTGCAGGCCAGCGTCAAG
CATTACGTTGCTAATGAACAGGAAGACTATCGCTCTCCTGAGGCTGGGCGAGAGGCCGTCTCTTCCAACATCGAT
GACAGGACAATGCACGAGCTCTATCTATGGCCCTTCCAAGACGCCGTCAAAGCCGGCTGCGCCAACATCATGTGC
TCCTACCAGCGCATCAACAACTCGTACGGCTGCGCCAACAGCAAGACGCTCAACGGCCTGCTCAAGACGGAGCTC
GGCTTCCAGGGCTTCGTCGTGTCCGACTGGGGAGCCCAGCATGCGGGCGTCGCCACGGCGCTGGCGGGCTTGGAT
TTGGCTATGCCGAGCGGTGCCGAGTTTTGGGGCGAGCATCTGCTGGAGGCTGTCAAGAATGGACTCATGACGACC
TGGTTCCAGTTCAAGCAAAACGACAACTTCCCAAACCCCGGCTTCGGCATGCCGGAAAAGCTCCTCGACCCGCAC
ACGCCCGTCCAAGGCCGAGACGACAGCTCCCGCCAGACGCTCCTCGACGGTGCCCTCGAGGGCCACGTGCTCGTC
AAGAACACAAAGAACACGCTGCCCCTGAAGCGGCCCCGGATGCTGTCCGTCTTCGGCTACTCGGCCAAGTCGGCC
GACGACTGGGGCCCCTCGACCGACGAGAACCTCAACAACGCCTACATCTACGGCGTCATCCCCCTCGACCCCGAG
GGAAGGCTGGCCAGTCTCTTCTCCTGGGTCAAGCGGCCCGCCACGGCCAGGCAGGGGACCATCATCGGCGGAGGC
GGATCAGGGGCCGTCACGCCCGCCGTCTTCACCGCGCCCTTTGAGGCCCTCAAGGTCCGGGCCGCCCGAGACGAC
ACGGCTCTCATGTACGACCTGGTGTCGGAGCGGCCCGGCGTCCACCCGGCGTCGGATGCCTGCCTCGTCTTCGGC
AACGCCTGGGCCGCCGAGGGCTACGACCGGCCGGCCCTCTACGACAACTACACCGACGGCCTGATCCGGGCCGTG
GCCGATAAGTGCGCCCGGACCGTAGTGGTGCTTCACAACGCCGGCGTCCGCGTCGTCGACGGCTTCATCGATCAC
GACAACGTCACGGCCGTCATCATGGCCCATCTCCCGGGCCGGGACAGCGGCGAGGCCCTCGTCTCGCTCCTCTAC
GGCGACGCCAACCCGTCCGGTAAGCTGCCTTACACCGTGGCCCGGGCCGAGGCCGACTACGGGCCCGTGGTGGGG
CCGGACCAGCCGAAGGGGGACTACAGCCGGTTCCCGCAGTCCGACTTCGACGAGGGCATCATGCTCGACTACCGC
AGCTTCGACCGGGACGGGAAGCAGCCGCGGTTCGAGTTCGGCTTCGGCCTCAGCTACACGACCTTTGCCCTCTCG
GACCTGACGATCCGGACCGAGGACGTCCATGACGGGCCGCTCCCCACGGGTGCCGTGACTGCGGGCGGACCGTCG
GACCTCTGGGACGTGCTGGCGACGGTGGAGGCGACGGTGACCAACACGGGCTCCGTGACGGGGGCCGAAGTGGTG
CAGCTGTACCTGGGATTCCCCGGGGACGAGGCTCCGGTCCGGCAGCTGCGAGGCTTCGACAAGGTGAGGCTCCGG
GCGGGCGAGAGACGGACGGTTCGGTTCGGCCTGACGAGGAGGGACCTGAGCCGGTGGGACGTGGTGGCTCAGGGC
TGGAGGCTTGCGGACGGGGGGTTTGGCGTGTTTGTCGGGAATAGCAGCCGGGTGTTGGGTCTGAGTGGCAGGCTG
GAGCTGTGA
Transcript >Ophun1|1641
ATGGCCATGATAGAGACGAGGGAGCCTCCAGCCGAGCTCTCAAGCCCCAACCCGAAACAGCCGAGATCCAGTCCG
GCGTCAACCATCGTCGCCATGATTTTCGGCCCTCTCCTGCTCGCTGCTGCTATTCTGGCCCTGCTGGCCGTAGCA
GCCGCGCCCAAAGACGATGGCTTCTTCTACGGCCACTCACCACCCGTCTATCCATCGCCGGCCATGACGGGCGGC
GACTGGGCCGAAGCCTACGACCACGCGCGGACCCTCGTCGCGCAGATGACGCTGGTGGAAAAGGTCAACCTCACG
GGAGGCGTCAAGCTCGGGTCCGGCTGCTCCGGGTCCGTCATGCCCGTGCCCCGGCTGGGATTCCCGGGCATGTGC
CTCAGCGACGCGGGGAATGGCCTGCGGGCTACCGACCTTGTGAATGCGTATCCGAGCGGGATCCATGTTGGCGCC
AGTTGGAACAAGGGCCTCGCTCGCCGGCGTGCCTCGTCCATGGCCGCAGAGTTCCGCAGAAAGGGCGTCAACGTG
CTTCTCGGTCCCGTCGTTGGGCCTGTCGGTCGTGTTGTTCGGGGGGGCCGCAACTGGGAGGCCTTTTCCGTTGAC
CCCTATCTCTCGGGGGCGCTCGTGGCCGAGACGGTAGAGGGTATCCAGGGCGAGGGGGTGCAGGCCAGCGTCAAG
CATTACGTTGCTAATGAACAGGAAGACTATCGCTCTCCTGAGGCTGGGCGAGAGGCCGTCTCTTCCAACATCGAT
GACAGGACAATGCACGAGCTCTATCTATGGCCCTTCCAAGACGCCGTCAAAGCCGGCTGCGCCAACATCATGTGC
TCCTACCAGCGCATCAACAACTCGTACGGCTGCGCCAACAGCAAGACGCTCAACGGCCTGCTCAAGACGGAGCTC
GGCTTCCAGGGCTTCGTCGTGTCCGACTGGGGAGCCCAGCATGCGGGCGTCGCCACGGCGCTGGCGGGCTTGGAT
TTGGCTATGCCGAGCGGTGCCGAGTTTTGGGGCGAGCATCTGCTGGAGGCTGTCAAGAATGGACTCATGACGACC
TGGTTCCAGTTCAAGCAAAACGACAACTTCCCAAACCCCGGCTTCGGCATGCCGGAAAAGCTCCTCGACCCGCAC
ACGCCCGTCCAAGGCCGAGACGACAGCTCCCGCCAGACGCTCCTCGACGGTGCCCTCGAGGGCCACGTGCTCGTC
AAGAACACAAAGAACACGCTGCCCCTGAAGCGGCCCCGGATGCTGTCCGTCTTCGGCTACTCGGCCAAGTCGGCC
GACGACTGGGGCCCCTCGACCGACGAGAACCTCAACAACGCCTACATCTACGGCGTCATCCCCCTCGACCCCGAG
GGAAGGCTGGCCAGTCTCTTCTCCTGGGTCAAGCGGCCCGCCACGGCCAGGCAGGGGACCATCATCGGCGGAGGC
GGATCAGGGGCCGTCACGCCCGCCGTCTTCACCGCGCCCTTTGAGGCCCTCAAGGTCCGGGCCGCCCGAGACGAC
ACGGCTCTCATGTACGACCTGGTGTCGGAGCGGCCCGGCGTCCACCCGGCGTCGGATGCCTGCCTCGTCTTCGGC
AACGCCTGGGCCGCCGAGGGCTACGACCGGCCGGCCCTCTACGACAACTACACCGACGGCCTGATCCGGGCCGTG
GCCGATAAGTGCGCCCGGACCGTAGTGGTGCTTCACAACGCCGGCGTCCGCGTCGTCGACGGCTTCATCGATCAC
GACAACGTCACGGCCGTCATCATGGCCCATCTCCCGGGCCGGGACAGCGGCGAGGCCCTCGTCTCGCTCCTCTAC
GGCGACGCCAACCCGTCCGGTAAGCTGCCTTACACCGTGGCCCGGGCCGAGGCCGACTACGGGCCCGTGGTGGGG
CCGGACCAGCCGAAGGGGGACTACAGCCGGTTCCCGCAGTCCGACTTCGACGAGGGCATCATGCTCGACTACCGC
AGCTTCGACCGGGACGGGAAGCAGCCGCGGTTCGAGTTCGGCTTCGGCCTCAGCTACACGACCTTTGCCCTCTCG
GACCTGACGATCCGGACCGAGGACGTCCATGACGGGCCGCTCCCCACGGGTGCCGTGACTGCGGGCGGACCGTCG
GACCTCTGGGACGTGCTGGCGACGGTGGAGGCGACGGTGACCAACACGGGCTCCGTGACGGGGGCCGAAGTGGTG
CAGCTGTACCTGGGATTCCCCGGGGACGAGGCTCCGGTCCGGCAGCTGCGAGGCTTCGACAAGGTGAGGCTCCGG
GCGGGCGAGAGACGGACGGTTCGGTTCGGCCTGACGAGGAGGGACCTGAGCCGGTGGGACGTGGTGGCTCAGGGC
TGGAGGCTTGCGGACGGGGGGTTTGGCGTGTTTGTCGGGAATAGCAGCCGGGTGTTGGGTCTGAGTGGCAGGCTG
GAGCTGTGA
Gene >Ophun1|1641
ATGGCCATGATAGAGACGAGGGAGCCTCCAGCCGAGCTCTCAAGCCCCAACCCGAAACAGCCGAGATCCAGTCCG
GCGTCAACCATCGTCGCCATGATTTTCGGCCCTCTCCTGCTCGCTGCTGCTATTCTGGCCCTGCTGGCCGTAGCA
GCCGCGCCCAAAGACGATGGCTTCTTCTACGGCCACTCACCACCCGTCTATCCATCGCGTACGTCAACTTTCCAA
AGAAACGCGAGACGAACGCGTGTCAGATGATGCTGAGAGGGGAAAACCAAAACCCACAGCGGCCATGACGGGCGG
CGACTGGGCCGAAGCCTACGACCACGCGCGGACCCTCGTCGCGCAGATGACGCTGGTGGAAAAGGTCAACCTCAC
GGGAGGCGTCAAGCTCGGGTCCGGCTGCTCCGGGTCCGTCATGCCCGTGCCCCGGCTGGGATTCCCGGGCATGTG
CCTCAGCGACGCGGGGAATGGCCTGCGGGCTACCGACCTTGTGAATGCGTATCCGAGCGGGATCCATGTTGGCGC
CAGGTGAGGGCTATACCGACAAAGTTCTCTTGGTGTCTCTATATCTGATTCATGGTAGTTGGAACAAGGGCCTCG
CTCGCCGGCGTGCCTCGTCCATGGCCGCAGAGTTCCGCAGAAAGGGCGTCAACGTGCTTCTCGGTCCCGTCGTTG
GGCCTGTCGGTCGTGTTGTTCGGGGGGGCCGCAACTGGGAGGCCTTTTCCGTTGACCCCTATCTCTCGGGGGCGC
TCGTGGCCGAGACGGTAGAGGGTATCCAGGGCGAGGGGGTGCAGGCCAGCGTCAAGGTTGGCTTCTGCTCTGTCT
GTTTCTCTGCCTTGGTGGTTGGCTGACGGCTTTCGGTCTGGTAGCATTACGTTGCTAATGAACAGGAAGACTATC
GCTCTCCTGAGGCTGGGCGAGAGGCCGTCTCTTCCAACATCGATGACAGGACAATGCACGAGCTCTATCTATGGT
GAGTCTTCCTGTTACCACACACGATATCTGGACCCTCCCCTAACTCCCAGTGATAAAGGCCCTTCCAAGACGCCG
TCAAAGCCGGCTGCGCCAACATCATGTGCTCCTACCAGCGCATCAACAACTCGTACGGCTGCGCCAACAGCAAGA
CGCTCAACGGCCTGCTCAAGACGGAGCTCGGCTTCCAGGTATGTCTCCGACGAGCCCCCTATCTCTTGACGACAC
GACACGGGCTGAGGGTGCTTGGGGTAGGGCTTCGTCGTGTCCGACTGGGGAGCCCAGCATGCGGGCGTCGCCACG
GCGCTGGCGGGCTTGGATTTGGCTATGCCGAGCGGTGCCGAGTTTTGGGGCGAGCATCTGCTGGAGGCTGTCAAG
AATGGGTCTGTGTCTGAGGCGAGGGTTGACGACATGGTGACGAGGCGAGCTGCCCCTTTTTCATCTGTCTTGAAC
GCTCTTGCACGCTGTCTCTCACCCCATCACAACCCCTTATACACTCTCTCTTACACACCCTCTCATACAACCTCT
CTCTCCCCCCCTCACTCTCCCGCTAACACCTCCCCAGACTCATGACGACCTGGTTCCAGTTCAAGCAAAACGACA
ACTTCCCAAACCCCGGCTTCGGCATGCCGGAAAAGCTCCTCGACCCGCACACGCCCGTCCAAGGCCGAGACGACA
GCTCCCGCCAGACGCTCCTCGACGGTGCCCTCGAGGGCCACGTGCTCGTCAAGAACACAAAGAACACGCTGCCCC
TGAAGCGGCCCCGGATGCTGTCCGTCTTCGGCTACTCGGCCAAGTCGGCCGACGACTGGGGCCCCTCGACCGACG
AGAACCTCAACAACGCCTACATCTACGGCGTCATCCCCCTCGACCCCGAGGGAAGGCTGGCCAGTCTCTTCTCCT
GGGTCAAGCGGCCCGCCACGGCCAGGCAGGGGACCATCATCGGCGGAGGCGGATCAGGGGCCGTCACGCCCGCCG
TCTTCACCGCGCCCTTTGAGGCCCTCAAGGTCCGGGCCGCCCGAGACGACACGGCTCTCATGTACGACCTGGTGT
CGGAGCGGCCCGGCGTCCACCCGGCGTCGGATGCCTGCCTCGTCTTCGGCAACGCCTGGGCCGCCGAGGGCTACG
ACCGGCCGGCCCTCTACGACAACTACACCGACGGCCTGATCCGGGCCGTGGCCGATAAGTGCGCCCGGACCGTAG
TGGTGCTTCACAACGCCGGCGTCCGCGTCGTCGACGGCTTCATCGATCACGACAACGTCACGGCCGTCATCATGG
CCCATCTCCCGGGCCGGGACAGCGGCGAGGCCCTCGTCTCGCTCCTCTACGGCGACGCCAACCCGTCCGGTAAGC
TGCCTTACACCGTGGCCCGGGCCGAGGCCGACTACGGGCCCGTGGTGGGGCCGGACCAGCCGAAGGGGGACTACA
GCCGGTTCCCGCAGTCCGACTTCGACGAGGGCATCATGCTCGACTACCGCAGCTTCGACCGGGACGGGAAGCAGC
CGCGGTTCGAGTTCGGCTTCGGCCTCAGCTACACGACCTTTGCCCTCTCGGACCTGACGATCCGGACCGAGGACG
TCCATGACGGGCCGCTCCCCACGGGTGCCGTGACTGCGGGCGGACCGTCGGACCTCTGGGACGTGCTGGCGACGG
TGGAGGCGACGGTGACCAACACGGGCTCCGTGACGGGGGCCGAAGTGGTGCAGCTGTACCTGGGATTCCCCGGGG
ACGAGGCTCCGGTCCGGCAGCTGCGAGGCTTCGACAAGGTGAGGCTCCGGGCGGGCGAGAGACGGACGGTTCGGT
TCGGCCTGACGAGGAGGGACCTGAGCCGGTGGGACGTGGTGGCTCAGGGCTGGAGGCTTGCGGACGGGGGGTTTG
GCGTGTTTGTCGGGAATAGCAGCCGGGTGTTGGGTCTGAGTGGCAGGCTGGAGCTGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail