Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|163
Gene name
LocationContig_102:28909..29575
Strand+
Gene length (bp)666
Transcript length (bp)603
Coding sequence length (bp)603
Protein length (aa) 201

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04892 VanZ VanZ like family 5.6E-07 34 110

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O13689|YDYA_SCHPO Uncharacterized protein C11E3.10 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC11E3.10 PE=4 SV=2 3 129 9.0E-25

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 22 0.5

Transmembrane Domains

Domain # Start End Length
1 7 26 19
2 36 53 17
3 60 79 19
4 94 111 17

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|163
MRIRLPFAGGFVLLLLAAAYAGLSTLQLGHIVNDKILHTVTFFLLTVVFYWIVDTNRRRTLNMTLIVCTLILGVG
SEFVQSFLPNDRDFDLYDIVANVVGSLTGLGLCSWYHRRMLERRRKRKSYTAVPDEEGVELSPDYEAGLTDGPAQ
PRTLEEEVDNWNENAADDWDGDIVAEASPPIAKAKEPDGHDPAEAKKRTD*
Coding >Ophun1|163
ATGCGCATACGCTTGCCCTTTGCTGGCGGCTTCGTACTGTTGCTGCTGGCTGCCGCCTACGCCGGTCTCTCTACT
CTTCAGCTCGGCCACATCGTCAACGACAAGATCTTGCATACCGTTACCTTCTTCCTCCTCACCGTCGTCTTCTAC
TGGATCGTCGATACAAACCGCCGGCGCACGCTCAACATGACGCTCATCGTCTGTACTCTGATTCTCGGAGTCGGC
TCCGAGTTCGTTCAAAGCTTCCTCCCCAACGACCGCGACTTCGACCTCTACGATATCGTCGCCAACGTGGTGGGC
AGTCTTACTGGTCTCGGTCTCTGCTCGTGGTATCATAGACGCATGCTTGAGCGGCGCAGGAAGCGCAAATCATAC
ACGGCCGTTCCCGACGAGGAGGGCGTCGAACTGTCTCCGGACTACGAGGCGGGCTTGACCGACGGTCCGGCCCAG
CCAAGGACACTGGAGGAAGAGGTTGATAATTGGAACGAAAACGCCGCCGACGACTGGGACGGTGACATTGTCGCC
GAGGCCTCCCCGCCCATCGCCAAGGCCAAGGAACCCGATGGTCACGATCCGGCTGAAGCCAAGAAGCGGACGGAC
TGA
Transcript >Ophun1|163
ATGCGCATACGCTTGCCCTTTGCTGGCGGCTTCGTACTGTTGCTGCTGGCTGCCGCCTACGCCGGTCTCTCTACT
CTTCAGCTCGGCCACATCGTCAACGACAAGATCTTGCATACCGTTACCTTCTTCCTCCTCACCGTCGTCTTCTAC
TGGATCGTCGATACAAACCGCCGGCGCACGCTCAACATGACGCTCATCGTCTGTACTCTGATTCTCGGAGTCGGC
TCCGAGTTCGTTCAAAGCTTCCTCCCCAACGACCGCGACTTCGACCTCTACGATATCGTCGCCAACGTGGTGGGC
AGTCTTACTGGTCTCGGTCTCTGCTCGTGGTATCATAGACGCATGCTTGAGCGGCGCAGGAAGCGCAAATCATAC
ACGGCCGTTCCCGACGAGGAGGGCGTCGAACTGTCTCCGGACTACGAGGCGGGCTTGACCGACGGTCCGGCCCAG
CCAAGGACACTGGAGGAAGAGGTTGATAATTGGAACGAAAACGCCGCCGACGACTGGGACGGTGACATTGTCGCC
GAGGCCTCCCCGCCCATCGCCAAGGCCAAGGAACCCGATGGTCACGATCCGGCTGAAGCCAAGAAGCGGACGGAC
TGA
Gene >Ophun1|163
ATGCGCATACGCTTGCCCTTTGCTGGTCAGTCCTGAGTGTCGCTTTTTCGAGAGCTTCAGCCTTACTGATGGCGG
CGTCTCCGCTCAGGCGGCTTCGTACTGTTGCTGCTGGCTGCCGCCTACGCCGGTCTCTCTACTCTTCAGCTCGGC
CACATCGTCAACGACAAGATCTTGCATACCGTTACCTTCTTCCTCCTCACCGTCGTCTTCTACTGGATCGTCGAT
ACAAACCGCCGGCGCACGCTCAACATGACGCTCATCGTCTGTACTCTGATTCTCGGAGTCGGCTCCGAGTTCGTT
CAAAGCTTCCTCCCCAACGACCGCGACTTCGACCTCTACGATATCGTCGCCAACGTGGTGGGCAGTCTTACTGGT
CTCGGTCTCTGCTCGTGGTATCATAGACGCATGCTTGAGCGGCGCAGGAAGCGCAAATCATACACGGCCGTTCCC
GACGAGGAGGGCGTCGAACTGTCTCCGGACTACGAGGCGGGCTTGACCGACGGTCCGGCCCAGCCAAGGACACTG
GAGGAAGAGGTTGATAATTGGAACGAAAACGCCGCCGACGACTGGGACGGTGACATTGTCGCCGAGGCCTCCCCG
CCCATCGCCAAGGCCAAGGAACCCGATGGTCACGATCCGGCTGAAGCCAAGAAGCGGACGGACTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail