Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|1628
Gene name
LocationContig_17:40193..42616
Strand+
Gene length (bp)2423
Transcript length (bp)2136
Coding sequence length (bp)2136
Protein length (aa) 712

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF06472 ABC_membrane_2 ABC transporter transmembrane region 2 4.2E-103 100 368
PF00005 ABC_tran ABC transporter 9.5E-17 481 624

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P33897|ABCD1_HUMAN ATP-binding cassette sub-family D member 1 OS=Homo sapiens GN=ABCD1 PE=1 SV=2 70 707 0.0E+00
sp|Q9UBJ2|ABCD2_HUMAN ATP-binding cassette sub-family D member 2 OS=Homo sapiens GN=ABCD2 PE=1 SV=1 78 707 0.0E+00
sp|Q61285|ABCD2_MOUSE ATP-binding cassette sub-family D member 2 OS=Mus musculus GN=Abcd2 PE=1 SV=1 42 707 0.0E+00
sp|P48410|ABCD1_MOUSE ATP-binding cassette sub-family D member 1 OS=Mus musculus GN=Abcd1 PE=1 SV=1 86 707 0.0E+00
sp|Q9QY44|ABCD2_RAT ATP-binding cassette sub-family D member 2 OS=Rattus norvegicus GN=Abcd2 PE=1 SV=1 42 707 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P33897|ABCD1_HUMAN ATP-binding cassette sub-family D member 1 OS=Homo sapiens GN=ABCD1 PE=1 SV=2 70 707 0.0E+00
sp|Q9UBJ2|ABCD2_HUMAN ATP-binding cassette sub-family D member 2 OS=Homo sapiens GN=ABCD2 PE=1 SV=1 78 707 0.0E+00
sp|Q61285|ABCD2_MOUSE ATP-binding cassette sub-family D member 2 OS=Mus musculus GN=Abcd2 PE=1 SV=1 42 707 0.0E+00
sp|P48410|ABCD1_MOUSE ATP-binding cassette sub-family D member 1 OS=Mus musculus GN=Abcd1 PE=1 SV=1 86 707 0.0E+00
sp|Q9QY44|ABCD2_RAT ATP-binding cassette sub-family D member 2 OS=Rattus norvegicus GN=Abcd2 PE=1 SV=1 42 707 0.0E+00
sp|P16970|ABCD3_RAT ATP-binding cassette sub-family D member 3 OS=Rattus norvegicus GN=Abcd3 PE=1 SV=3 21 678 9.0E-159
sp|P28288|ABCD3_HUMAN ATP-binding cassette sub-family D member 3 OS=Homo sapiens GN=ABCD3 PE=1 SV=1 21 678 3.0E-158
sp|P55096|ABCD3_MOUSE ATP-binding cassette sub-family D member 3 OS=Mus musculus GN=Abcd3 PE=1 SV=2 43 678 6.0E-158
sp|Q8T8P3|ABCD2_DICDI ABC transporter D family member 2 OS=Dictyostelium discoideum GN=abcD2 PE=3 SV=1 89 678 9.0E-132
sp|P34230|PXA2_YEAST Peroxisomal long-chain fatty acid import protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PXA2 PE=1 SV=1 115 707 2.0E-127
sp|P41909|PXA1_YEAST Peroxisomal long-chain fatty acid import protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PXA1 PE=1 SV=2 92 697 5.0E-112
sp|Q94FB9|AB1D_ARATH ABC transporter D family member 1 OS=Arabidopsis thaliana GN=ABCC1 PE=1 SV=1 123 670 4.0E-101
sp|Q94FB9|AB1D_ARATH ABC transporter D family member 1 OS=Arabidopsis thaliana GN=ABCC1 PE=1 SV=1 100 670 5.0E-86
sp|O89016|ABCD4_MOUSE ATP-binding cassette sub-family D member 4 OS=Mus musculus GN=Abcd4 PE=1 SV=2 71 678 8.0E-71
sp|O14678|ABCD4_HUMAN ATP-binding cassette sub-family D member 4 OS=Homo sapiens GN=ABCD4 PE=1 SV=1 71 678 6.0E-70
sp|Q54W19|ABCD1_DICDI ABC transporter D family member 1 OS=Dictyostelium discoideum GN=abcD1 PE=3 SV=1 361 665 7.0E-52
sp|Q54W20|ABCD3_DICDI ABC transporter D family member 3 OS=Dictyostelium discoideum GN=abcD3 PE=3 SV=1 353 670 4.0E-51
sp|Q55774|Y182_SYNY3 Uncharacterized ABC transporter ATP-binding protein sll0182 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=sll0182 PE=3 SV=1 175 676 8.0E-50
sp|Q6NLC1|AB2D_ARATH ABC transporter D family member 2, chloroplastic OS=Arabidopsis thaliana GN=ABCC2 PE=1 SV=1 68 696 3.0E-45
sp|P9WQI9|BACA_MYCTU Vitamin B12 transport ATP-binding protein BacA OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=bacA PE=1 SV=1 133 677 7.0E-36
sp|P9WQI8|BACA_MYCTO Vitamin B12 transport ATP-binding protein BacA OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=bacA PE=3 SV=1 133 677 7.0E-36
sp|Q57335|Y036_HAEIN Uncharacterized ABC transporter ATP-binding protein HI_0036 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=HI_0036 PE=3 SV=1 121 669 1.0E-35
sp|P45221|Y1467_HAEIN Uncharacterized ABC transporter ATP-binding protein HI_1467 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=HI_1467 PE=3 SV=1 175 665 1.0E-25
sp|P31826|YDDA_ECOLI Inner membrane ABC transporter ATP-binding protein YddA OS=Escherichia coli (strain K12) GN=yddA PE=1 SV=2 180 656 1.0E-21
sp|P33310|MDL1_YEAST ATP-dependent permease MDL1, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MDL1 PE=1 SV=2 227 673 2.0E-17
sp|Q66AT7|ZNUC_YERPS Zinc import ATP-binding protein ZnuC OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=znuC PE=3 SV=1 483 650 2.0E-17
sp|Q1CJG3|ZNUC_YERPN Zinc import ATP-binding protein ZnuC OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=znuC PE=3 SV=1 483 650 2.0E-17
sp|Q7CIC2|ZNUC_YERPE Zinc import ATP-binding protein ZnuC OS=Yersinia pestis GN=znuC PE=3 SV=1 483 650 2.0E-17
sp|Q1C812|ZNUC_YERPA Zinc import ATP-binding protein ZnuC OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=znuC PE=3 SV=1 483 650 2.0E-17
sp|P34712|PGP1_CAEEL Multidrug resistance protein pgp-1 OS=Caenorhabditis elegans GN=pgp-1 PE=1 SV=2 479 651 6.0E-17
sp|A1JRI2|ZNUC_YERE8 Zinc import ATP-binding protein ZnuC OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=znuC PE=3 SV=1 483 650 2.0E-16
sp|P97998|MDL1_CANAX ATP-dependent permease MDL1 OS=Candida albicans GN=MDL1 PE=3 SV=1 328 671 1.0E-15
sp|P43245|MDR1_RAT Multidrug resistance protein 1 OS=Rattus norvegicus GN=Abcb1 PE=2 SV=1 474 653 2.0E-15
sp|Q2SSS4|POTA_MYCCT Spermidine/putrescine import ATP-binding protein PotA OS=Mycoplasma capricolum subsp. capricolum (strain California kid / ATCC 27343 / NCTC 10154) GN=potA PE=3 SV=1 475 650 1.0E-14
sp|Q9NP78|ABCB9_HUMAN ATP-binding cassette sub-family B member 9 OS=Homo sapiens GN=ABCB9 PE=1 SV=1 96 671 1.0E-14
sp|Q00449|MDR49_DROME Multidrug resistance protein homolog 49 OS=Drosophila melanogaster GN=Mdr49 PE=2 SV=2 457 651 2.0E-14
sp|Q6MU19|POTA_MYCMS Spermidine/putrescine import ATP-binding protein PotA OS=Mycoplasma mycoides subsp. mycoides SC (strain PG1) GN=potA PE=3 SV=1 475 653 2.0E-14
sp|Q9GTN7|TAGA_DICDI Serine protease/ABC transporter B family protein tagA OS=Dictyostelium discoideum GN=tagA PE=1 SV=2 452 651 8.0E-14
sp|Q0P9C4|PGLK_CAMJE Protein glycosylation K OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=pglK PE=1 SV=1 479 653 9.0E-14
sp|Q65UE1|POTA_MANSM Spermidine/putrescine import ATP-binding protein PotA OS=Mannheimia succiniciproducens (strain MBEL55E) GN=potA PE=3 SV=1 473 650 1.0E-13
sp|Q1QE80|POTA_PSYCK Spermidine/putrescine import ATP-binding protein PotA OS=Psychrobacter cryohalolentis (strain K5) GN=potA PE=3 SV=1 475 650 2.0E-13
sp|Q8XIZ5|POTA_CLOPE Spermidine/putrescine import ATP-binding protein PotA OS=Clostridium perfringens (strain 13 / Type A) GN=potA PE=3 SV=1 477 653 2.0E-13
sp|Q0TNZ3|POTA_CLOP1 Spermidine/putrescine import ATP-binding protein PotA OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) GN=potA PE=3 SV=1 477 653 2.0E-13
sp|Q9CP06|POTA_PASMU Spermidine/putrescine import ATP-binding protein PotA OS=Pasteurella multocida (strain Pm70) GN=potA PE=3 SV=2 476 674 4.0E-13
sp|Q08201|MDR3_RAT Phosphatidylcholine translocator ABCB4 OS=Rattus norvegicus GN=Abcb4 PE=1 SV=1 464 665 6.0E-13
sp|Q0SRL2|POTA_CLOPS Spermidine/putrescine import ATP-binding protein PotA OS=Clostridium perfringens (strain SM101 / Type A) GN=potA PE=3 SV=2 477 653 7.0E-13
sp|P36619|PMD1_SCHPO Leptomycin B resistance protein pmd1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pmd1 PE=3 SV=2 399 666 7.0E-13
sp|Q4UMZ3|Y214_RICFE Putative export ATP-binding/permease protein RF_0214 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=RF_0214 PE=3 SV=2 479 668 7.0E-13
sp|Q897I2|Y753_CLOTE Putative ABC transporter ATP-binding protein CTC_00753 OS=Clostridium tetani (strain Massachusetts / E88) GN=CTC_00753 PE=3 SV=1 479 667 8.0E-13
sp|P06795|MDR1B_MOUSE Multidrug resistance protein 1B OS=Mus musculus GN=Abcb1b PE=1 SV=1 474 653 8.0E-13
sp|Q9CJB8|LCNCL_LACLA Lactococcin transport/processing ATP-binding protein LcnC-like OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=lcnC PE=3 SV=1 476 671 8.0E-13
sp|Q2M3G0|ABCB5_HUMAN ATP-binding cassette sub-family B member 5 OS=Homo sapiens GN=ABCB5 PE=1 SV=4 479 653 8.0E-13
sp|Q2G2M9|Y2003_STAA8 Putative multidrug export ATP-binding/permease protein SAOUHSC_02003 OS=Staphylococcus aureus (strain NCTC 8325) GN=SAOUHSC_02003 PE=3 SV=1 402 662 9.0E-13
sp|Q6GFJ1|Y1956_STAAR Putative multidrug export ATP-binding/permease protein SAR1956 OS=Staphylococcus aureus (strain MRSA252) GN=SAR1956 PE=3 SV=1 402 662 9.0E-13
sp|Q5HEQ8|Y1924_STAAC Putative multidrug export ATP-binding/permease protein SACOL1924 OS=Staphylococcus aureus (strain COL) GN=SACOL1924 PE=3 SV=1 402 662 9.0E-13
sp|Q99T13|Y1866_STAAM Putative multidrug export ATP-binding/permease protein SAV1866 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=SAV1866 PE=1 SV=1 402 662 9.0E-13
sp|Q2FFM9|Y1847_STAA3 Putative multidrug export ATP-binding/permease protein SAUSA300_1847 OS=Staphylococcus aureus (strain USA300) GN=SAUSA300_1847 PE=3 SV=1 402 662 9.0E-13
sp|Q7A0J1|Y1806_STAAW Putative multidrug export ATP-binding/permease protein MW1806 OS=Staphylococcus aureus (strain MW2) GN=MW1806 PE=3 SV=1 402 662 9.0E-13
sp|Q6G868|Y1788_STAAS Putative multidrug export ATP-binding/permease protein SAS1788 OS=Staphylococcus aureus (strain MSSA476) GN=SAS1788 PE=3 SV=1 402 662 9.0E-13
sp|Q7A4T3|Y1683_STAAN Putative multidrug export ATP-binding/permease protein SA1683 OS=Staphylococcus aureus (strain N315) GN=SA1683 PE=1 SV=1 402 662 9.0E-13
sp|Q03518|TAP1_HUMAN Antigen peptide transporter 1 OS=Homo sapiens GN=TAP1 PE=1 SV=2 464 666 1.0E-12
sp|Q00564|LCNC_LACLL Lactococcin-A transport/processing ATP-binding protein LcnC OS=Lactococcus lactis subsp. lactis GN=lcnC PE=3 SV=1 476 671 1.0E-12
sp|Q28433|TAP1_GORGO Antigen peptide transporter 1 OS=Gorilla gorilla gorilla GN=TAP1 PE=2 SV=2 464 666 1.0E-12
sp|Q0I3Y9|POTA_HAES1 Spermidine/putrescine import ATP-binding protein PotA OS=Haemophilus somnus (strain 129Pt) GN=potA PE=3 SV=1 479 650 2.0E-12
sp|Q2YU20|Y1799_STAAB Putative multidrug export ATP-binding/permease protein SAB1799c OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=SAB1799c PE=3 SV=1 479 662 2.0E-12
sp|P21439|MDR3_HUMAN Phosphatidylcholine translocator ABCB4 OS=Homo sapiens GN=ABCB4 PE=1 SV=2 463 664 2.0E-12
sp|A0LCH8|ZNUC_MAGMM Zinc import ATP-binding protein ZnuC OS=Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1) GN=znuC PE=3 SV=1 479 650 2.0E-12
sp|P34713|PGP3_CAEEL Multidrug resistance protein pgp-3 OS=Caenorhabditis elegans GN=pgp-3 PE=2 SV=2 436 662 2.0E-12
sp|O32169|METN_BACSU Methionine import ATP-binding protein MetN OS=Bacillus subtilis (strain 168) GN=metN PE=1 SV=1 464 650 2.0E-12
sp|P21440|MDR3_MOUSE Phosphatidylcholine translocator ABCB4 OS=Mus musculus GN=Abcb4 PE=1 SV=2 464 653 3.0E-12
sp|A0PY57|POTA_CLONN Spermidine/putrescine import ATP-binding protein PotA OS=Clostridium novyi (strain NT) GN=potA PE=3 SV=1 475 653 3.0E-12
sp|Q4L8L7|HRTA_STAHJ Putative hemin import ATP-binding protein HrtA OS=Staphylococcus haemolyticus (strain JCSC1435) GN=hrtA PE=3 SV=1 475 667 3.0E-12
sp|Q6D4A8|ZNUC_PECAS Zinc import ATP-binding protein ZnuC OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=znuC PE=3 SV=1 483 636 3.0E-12
sp|P21449|MDR2_CRIGR Multidrug resistance protein 2 OS=Cricetulus griseus GN=PGY2 PE=2 SV=2 468 653 4.0E-12
sp|Q110U3|POTA_TRIEI Spermidine/putrescine import ATP-binding protein PotA OS=Trichodesmium erythraeum (strain IMS101) GN=potA PE=3 SV=1 476 650 4.0E-12
sp|Q9LSJ5|AB18B_ARATH ABC transporter B family member 18 OS=Arabidopsis thaliana GN=ABCB18 PE=3 SV=1 431 653 4.0E-12
sp|O85818|POTA_AGGAC Spermidine/putrescine import ATP-binding protein PotA OS=Aggregatibacter actinomycetemcomitans GN=potA PE=3 SV=1 477 650 5.0E-12
sp|Q7N545|ZNUC_PHOLL Zinc import ATP-binding protein ZnuC OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=znuC PE=3 SV=2 483 636 5.0E-12
sp|P21448|MDR1_CRIGR Multidrug resistance protein 1 OS=Cricetulus griseus GN=ABCB1 PE=1 SV=2 468 653 5.0E-12
sp|Q9JJ59|ABCB9_MOUSE ATP-binding cassette sub-family B member 9 OS=Mus musculus GN=Abcb9 PE=2 SV=1 96 671 6.0E-12
sp|Q92GP9|Y1073_RICCN Putative export ATP-binding/permease protein RC1073 OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=RC1073 PE=3 SV=1 479 668 6.0E-12
sp|P08183|MDR1_HUMAN Multidrug resistance protein 1 OS=Homo sapiens GN=ABCB1 PE=1 SV=3 463 664 6.0E-12
sp|Q14Q07|POTA_SPICI Spermidine/putrescine import ATP-binding protein PotA OS=Spiroplasma citri GN=potA PE=3 SV=1 475 653 6.0E-12
sp|Q9QYJ4|ABCB9_RAT ATP-binding cassette sub-family B member 9 OS=Rattus norvegicus GN=Abcb9 PE=1 SV=1 96 671 6.0E-12
sp|P36370|TAP1_RAT Antigen peptide transporter 1 OS=Rattus norvegicus GN=Tap1 PE=1 SV=2 464 662 8.0E-12
sp|P21447|MDR1A_MOUSE Multidrug resistance protein 1A OS=Mus musculus GN=Abcb1a PE=1 SV=3 479 653 9.0E-12
sp|Q8Z7H7|POTA_SALTI Spermidine/putrescine import ATP-binding protein PotA OS=Salmonella typhi GN=potA PE=3 SV=1 475 650 1.0E-11
sp|O15439|MRP4_HUMAN Multidrug resistance-associated protein 4 OS=Homo sapiens GN=ABCC4 PE=1 SV=3 454 703 1.0E-11
sp|P40790|POTA_SALTY Spermidine/putrescine import ATP-binding protein PotA OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=potA PE=3 SV=2 475 650 1.0E-11
sp|Q5PMK1|POTA_SALPA Spermidine/putrescine import ATP-binding protein PotA OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=potA PE=3 SV=1 475 650 1.0E-11
sp|Q57QC8|POTA_SALCH Spermidine/putrescine import ATP-binding protein PotA OS=Salmonella choleraesuis (strain SC-B67) GN=potA PE=3 SV=1 475 650 1.0E-11
sp|Q7VNG4|POTA_HAEDU Spermidine/putrescine import ATP-binding protein PotA OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=potA PE=3 SV=1 476 650 1.0E-11
sp|Q10418|MESD_LEUME Mesentericin-Y105 transport/processing ATP-binding protein MesD OS=Leuconostoc mesenteroides GN=mesD PE=3 SV=1 480 662 1.0E-11
sp|Q9ZCM8|Y696_RICPR Putative export ATP-binding/permease protein RP696 OS=Rickettsia prowazekii (strain Madrid E) GN=RP696 PE=3 SV=1 474 668 2.0E-11
sp|P23174|MDR3_CRIGR Phosphatidylcholine translocator ABCB4 OS=Cricetulus griseus GN=ABCB4 PE=2 SV=1 464 653 2.0E-11
sp|P45171|POTA_HAEIN Spermidine/putrescine import ATP-binding protein PotA OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=potA PE=3 SV=2 477 650 2.0E-11
sp|O31708|YKNV_BACSU Uncharacterized ABC transporter ATP-binding protein YknV OS=Bacillus subtilis (strain 168) GN=yknV PE=3 SV=1 463 671 2.0E-11
sp|Q8U4K3|WTPC_PYRFU Molybdate/tungstate import ATP-binding protein WtpC OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=wtpC PE=3 SV=1 477 650 2.0E-11
sp|Q4QK57|POTA_HAEI8 Spermidine/putrescine import ATP-binding protein PotA OS=Haemophilus influenzae (strain 86-028NP) GN=potA PE=3 SV=2 477 650 2.0E-11
sp|Q8DUF7|POTA_STRMU Spermidine/putrescine import ATP-binding protein PotA OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=potA PE=3 SV=1 475 650 2.0E-11
sp|P75094|Y019_MYCPN Putative ABC transporter ATP-binding protein MG015 homolog OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=MPN_019 PE=3 SV=1 479 667 2.0E-11
sp|P45861|YWJA_BACSU Uncharacterized ABC transporter ATP-binding protein YwjA OS=Bacillus subtilis (strain 168) GN=ywjA PE=3 SV=1 479 668 3.0E-11
sp|Q57213|Y1474_HAEIN Uncharacterized ABC transporter ATP-binding protein HI_1474 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=HI_1474 PE=3 SV=1 479 667 3.0E-11
sp|P23596|PRTD_DICCH Proteases secretion ATP-binding protein PrtD OS=Dickeya chrysanthemi GN=prtD PE=3 SV=1 469 675 3.0E-11
sp|Q64SQ6|POTA_BACFR Spermidine/putrescine import ATP-binding protein PotA OS=Bacteroides fragilis (strain YCH46) GN=potA PE=3 SV=2 483 653 3.0E-11
sp|Q6F0V4|POTA_MESFL Spermidine/putrescine import ATP-binding protein PotA OS=Mesoplasma florum (strain ATCC 33453 / NBRC 100688 / NCTC 11704 / L1) GN=potA PE=3 SV=1 475 650 3.0E-11
sp|Q5LBT4|POTA_BACFN Spermidine/putrescine import ATP-binding protein PotA OS=Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / JCM 11019 / NCTC 9343) GN=potA PE=3 SV=1 483 653 3.0E-11
sp|Q1MEG2|ZNUC_RHIL3 Zinc import ATP-binding protein ZnuC OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=znuC PE=3 SV=1 475 650 3.0E-11
sp|P21958|TAP1_MOUSE Antigen peptide transporter 1 OS=Mus musculus GN=Tap1 PE=1 SV=3 464 662 3.0E-11
sp|O06967|BMRA_BACSU Multidrug resistance ABC transporter ATP-binding/permease protein BmrA OS=Bacillus subtilis (strain 168) GN=bmrA PE=1 SV=1 478 653 3.0E-11
sp|Q54W20|ABCD3_DICDI ABC transporter D family member 3 OS=Dictyostelium discoideum GN=abcD3 PE=3 SV=1 124 313 4.0E-11
sp|Q9LSJ6|AB17B_ARATH ABC transporter B family member 17 OS=Arabidopsis thaliana GN=ABCB17 PE=3 SV=1 464 671 4.0E-11
sp|Q2W4W1|ZNUC_MAGSA Zinc import ATP-binding protein ZnuC OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) GN=znuC PE=3 SV=1 472 650 4.0E-11
sp|Q5X627|POTA_LEGPA Spermidine/putrescine import ATP-binding protein PotA OS=Legionella pneumophila (strain Paris) GN=potA PE=3 SV=1 479 650 4.0E-11
sp|Q5ZWE4|POTA_LEGPH Spermidine/putrescine import ATP-binding protein PotA OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=potA PE=3 SV=2 479 650 4.0E-11
sp|Q5L222|POTA_GEOKA Spermidine/putrescine import ATP-binding protein PotA OS=Geobacillus kaustophilus (strain HTA426) GN=potA PE=3 SV=1 475 650 5.0E-11
sp|P23886|CYDC_ECOLI ATP-binding/permease protein CydC OS=Escherichia coli (strain K12) GN=cydC PE=3 SV=2 458 667 6.0E-11
sp|P59653|COMA_STRR6 Transport/processing ATP-binding protein ComA OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=comA PE=3 SV=1 463 671 6.0E-11
sp|P97027|SSUB_BACSU Aliphatic sulfonates import ATP-binding protein SsuB OS=Bacillus subtilis (strain 168) GN=ssuB PE=1 SV=4 477 650 6.0E-11
sp|Q32EY4|POTA_SHIDS Spermidine/putrescine import ATP-binding protein PotA OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=potA PE=3 SV=1 475 650 6.0E-11
sp|Q4K681|POTA_PSEF5 Spermidine/putrescine import ATP-binding protein PotA OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=potA PE=3 SV=1 475 650 7.0E-11
sp|Q8RY46|AB26B_ARATH ABC transporter B family member 26, chloroplastic OS=Arabidopsis thaliana GN=ABCB26 PE=2 SV=1 464 671 7.0E-11
sp|Q65M64|SSUB_BACLD Aliphatic sulfonates import ATP-binding protein SsuB OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=ssuB PE=3 SV=1 479 650 7.0E-11
sp|Q9LHD1|AB15B_ARATH ABC transporter B family member 15 OS=Arabidopsis thaliana GN=ABCB15 PE=3 SV=1 459 671 8.0E-11
sp|P32386|YBT1_YEAST ATP-dependent bile acid permease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YBT1 PE=1 SV=2 475 654 8.0E-11
sp|Q02R79|POTA_PSEAB Spermidine/putrescine import ATP-binding protein PotA OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=potA PE=3 SV=1 480 677 8.0E-11
sp|P97046|LMRA_LACLM Multidrug resistance ABC transporter ATP-binding and permease protein OS=Lactococcus lactis subsp. cremoris (strain MG1363) GN=lmrA PE=3 SV=3 393 653 8.0E-11
sp|Q3Z2Z3|POTA_SHISS Spermidine/putrescine import ATP-binding protein PotA OS=Shigella sonnei (strain Ss046) GN=potA PE=3 SV=1 475 650 8.0E-11
sp|Q31ZK0|POTA_SHIBS Spermidine/putrescine import ATP-binding protein PotA OS=Shigella boydii serotype 4 (strain Sb227) GN=potA PE=3 SV=1 475 650 8.0E-11
sp|Q1RD28|POTA_ECOUT Spermidine/putrescine import ATP-binding protein PotA OS=Escherichia coli (strain UTI89 / UPEC) GN=potA PE=3 SV=1 475 650 8.0E-11
sp|A1AA20|POTA_ECOK1 Spermidine/putrescine import ATP-binding protein PotA OS=Escherichia coli O1:K1 / APEC GN=potA PE=3 SV=1 475 650 8.0E-11
sp|Q87RE5|ZNUC_VIBPA Zinc import ATP-binding protein ZnuC OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=znuC PE=3 SV=1 483 636 8.0E-11
sp|Q9HY19|POTA2_PSEAE Spermidine/putrescine import ATP-binding protein PotA 2 OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=potA2 PE=3 SV=1 480 677 8.0E-11
sp|P69877|POTA_SHIFL Spermidine/putrescine import ATP-binding protein PotA OS=Shigella flexneri GN=potA PE=3 SV=1 475 650 8.0E-11
sp|P69874|POTA_ECOLI Spermidine/putrescine import ATP-binding protein PotA OS=Escherichia coli (strain K12) GN=potA PE=1 SV=1 475 650 8.0E-11
sp|P69875|POTA_ECOL6 Spermidine/putrescine import ATP-binding protein PotA OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=potA PE=3 SV=1 475 650 8.0E-11
sp|Q0TIU8|POTA_ECOL5 Spermidine/putrescine import ATP-binding protein PotA OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=potA PE=3 SV=1 475 650 8.0E-11
sp|P69876|POTA_ECO57 Spermidine/putrescine import ATP-binding protein PotA OS=Escherichia coli O157:H7 GN=potA PE=3 SV=1 475 650 8.0E-11
sp|Q54W19|ABCD1_DICDI ABC transporter D family member 1 OS=Dictyostelium discoideum GN=abcD1 PE=3 SV=1 89 313 9.0E-11
sp|Q0T5R2|POTA_SHIF8 Spermidine/putrescine import ATP-binding protein PotA OS=Shigella flexneri serotype 5b (strain 8401) GN=potA PE=3 SV=1 475 650 9.0E-11
sp|Q5PIA5|ZNUC_SALPA Zinc import ATP-binding protein ZnuC OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=znuC PE=3 SV=1 483 650 9.0E-11
sp|Q57NA5|ZNUC_SALCH Zinc import ATP-binding protein ZnuC OS=Salmonella choleraesuis (strain SC-B67) GN=znuC PE=3 SV=2 483 650 9.0E-11
sp|P68580|SUNT_BPSPB Sublancin-168-processing and transport ATP-binding protein sunT OS=Bacillus phage SPbeta GN=sunT PE=3 SV=1 479 662 9.0E-11
sp|P68579|SUNT_BACSU SPBc2 prophage-derived sublancin-168-processing and transport ATP-binding protein SunT OS=Bacillus subtilis (strain 168) GN=sunT PE=3 SV=1 479 662 9.0E-11
sp|Q8RI39|POTA_FUSNN Spermidine/putrescine import ATP-binding protein PotA OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) GN=potA PE=3 SV=1 460 652 9.0E-11
sp|Q03024|APRD_PSEAE Alkaline protease secretion ATP-binding protein AprD OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=aprD PE=3 SV=1 480 700 9.0E-11
sp|Q8DZJ0|POTA_STRA5 Spermidine/putrescine import ATP-binding protein PotA OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=potA PE=3 SV=1 478 653 9.0E-11
sp|Q8E554|POTA_STRA3 Spermidine/putrescine import ATP-binding protein PotA OS=Streptococcus agalactiae serotype III (strain NEM316) GN=potA PE=3 SV=1 478 653 9.0E-11
sp|Q3K0Y6|POTA_STRA1 Spermidine/putrescine import ATP-binding protein PotA OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=potA PE=3 SV=1 478 653 9.0E-11
sp|P34712|PGP1_CAEEL Multidrug resistance protein pgp-1 OS=Caenorhabditis elegans GN=pgp-1 PE=1 SV=2 454 653 1.0E-10
sp|Q5WXF0|POTA_LEGPL Spermidine/putrescine import ATP-binding protein PotA OS=Legionella pneumophila (strain Lens) GN=potA PE=3 SV=1 479 650 1.0E-10
sp|P33311|MDL2_YEAST ATP-dependent permease MDL2, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MDL2 PE=1 SV=3 374 671 1.0E-10
sp|Q9CHL8|LMRA_LACLA Multidrug resistance ABC transporter ATP-binding and permease protein OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=lmrA PE=1 SV=2 407 653 1.0E-10
sp|Q54BU4|ABCB1_DICDI ABC transporter B family member 1 OS=Dictyostelium discoideum GN=abcB1 PE=3 SV=1 474 653 1.0E-10
sp|Q32HA3|ZNUC_SHIDS Zinc import ATP-binding protein ZnuC OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=znuC PE=3 SV=1 483 650 1.0E-10
sp|Q68W42|Y691_RICTY Putative export ATP-binding/permease protein RT0691 OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=RT0691 PE=3 SV=1 474 671 1.0E-10
sp|Q0S0X2|SSUB3_RHOJR Aliphatic sulfonates import ATP-binding protein SsuB 3 OS=Rhodococcus jostii (strain RHA1) GN=ssuB3 PE=3 SV=1 476 636 1.0E-10
sp|Q56A55|ABCB8_DANRE ATP-binding cassette sub-family B member 8, mitochondrial OS=Danio rerio GN=abcb8 PE=2 SV=1 464 653 1.0E-10
sp|Q8Z5W6|ZNUC_SALTI Zinc import ATP-binding protein ZnuC OS=Salmonella typhi GN=znuC PE=3 SV=1 483 650 1.0E-10
sp|Q9NRK6|ABCBA_HUMAN ATP-binding cassette sub-family B member 10, mitochondrial OS=Homo sapiens GN=ABCB10 PE=1 SV=2 70 669 1.0E-10
sp|P34713|PGP3_CAEEL Multidrug resistance protein pgp-3 OS=Caenorhabditis elegans GN=pgp-3 PE=2 SV=2 479 665 2.0E-10
sp|Q9LSJ2|AB22B_ARATH ABC transporter B family member 22 OS=Arabidopsis thaliana GN=ABCB22 PE=3 SV=2 464 671 2.0E-10
sp|Q48IB9|SSUB1_PSE14 Aliphatic sulfonates import ATP-binding protein SsuB 1 OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=ssuB1 PE=3 SV=1 476 650 2.0E-10
sp|Q3Z2L6|ZNUC_SHISS Zinc import ATP-binding protein ZnuC OS=Shigella sonnei (strain Ss046) GN=znuC PE=3 SV=1 483 650 2.0E-10
sp|Q322E8|ZNUC_SHIBS Zinc import ATP-binding protein ZnuC OS=Shigella boydii serotype 4 (strain Sb227) GN=znuC PE=3 SV=1 483 650 2.0E-10
sp|Q1RAS6|ZNUC_ECOUT Zinc import ATP-binding protein ZnuC OS=Escherichia coli (strain UTI89 / UPEC) GN=znuC PE=3 SV=1 483 650 2.0E-10
sp|P0A9X1|ZNUC_ECOLI Zinc import ATP-binding protein ZnuC OS=Escherichia coli (strain K12) GN=znuC PE=1 SV=1 483 650 2.0E-10
sp|P0A9X2|ZNUC_ECOL6 Zinc import ATP-binding protein ZnuC OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=znuC PE=3 SV=1 483 650 2.0E-10
sp|Q0TGX4|ZNUC_ECOL5 Zinc import ATP-binding protein ZnuC OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=znuC PE=3 SV=1 483 650 2.0E-10
sp|A1AC19|ZNUC_ECOK1 Zinc import ATP-binding protein ZnuC OS=Escherichia coli O1:K1 / APEC GN=znuC PE=3 SV=1 483 650 2.0E-10
sp|P0A9X3|ZNUC_ECO57 Zinc import ATP-binding protein ZnuC OS=Escherichia coli O157:H7 GN=znuC PE=3 SV=1 483 650 2.0E-10
sp|Q7ANN4|PRSD_RHIME Type I secretion system ATP-binding protein PrsD OS=Rhizobium meliloti (strain 1021) GN=prsD PE=1 SV=2 478 653 2.0E-10
sp|Q08D64|ABCB6_XENTR ATP-binding cassette sub-family B member 6, mitochondrial OS=Xenopus tropicalis GN=abcb6 PE=2 SV=1 461 653 2.0E-10
sp|P54718|YFIB_BACSU Uncharacterized ABC transporter ATP-binding protein YfiB OS=Bacillus subtilis (strain 168) GN=yfiB PE=3 SV=1 409 651 2.0E-10
sp|Q9ZR72|AB1B_ARATH ABC transporter B family member 1 OS=Arabidopsis thaliana GN=ABCB1 PE=1 SV=1 483 669 2.0E-10
sp|Q88RL1|ZNUC_PSEPK Zinc import ATP-binding protein ZnuC OS=Pseudomonas putida (strain KT2440) GN=znuC PE=3 SV=1 475 650 2.0E-10
sp|Q60AI1|POTA_METCA Spermidine/putrescine import ATP-binding protein PotA OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=potA PE=3 SV=1 483 652 2.0E-10
sp|P47261|Y015_MYCGE Putative ABC transporter ATP-binding protein MG015 OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=MG015 PE=3 SV=1 482 654 2.0E-10
sp|Q03519|TAP2_HUMAN Antigen peptide transporter 2 OS=Homo sapiens GN=TAP2 PE=1 SV=1 464 651 2.0E-10
sp|Q7MMN0|ZNUC_VIBVY Zinc import ATP-binding protein ZnuC OS=Vibrio vulnificus (strain YJ016) GN=znuC PE=3 SV=1 479 636 2.0E-10
sp|Q8DFQ4|ZNUC_VIBVU Zinc import ATP-binding protein ZnuC OS=Vibrio vulnificus (strain CMCP6) GN=znuC PE=3 SV=1 479 636 2.0E-10
sp|P78966|MAM1_SCHPO Mating factor M secretion protein mam1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mam1 PE=3 SV=1 418 653 2.0E-10
sp|Q5B1Q2|ATM1_EMENI Iron-sulfur clusters transporter atm1, mitochondrial OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=atm1 PE=3 SV=2 462 702 2.0E-10
sp|Q1IGY7|ZNUC_PSEE4 Zinc import ATP-binding protein ZnuC OS=Pseudomonas entomophila (strain L48) GN=znuC PE=3 SV=1 472 650 2.0E-10
sp|Q9JI39|ABCBA_MOUSE ATP-binding cassette sub-family B member 10, mitochondrial OS=Mus musculus GN=Abcb10 PE=1 SV=1 407 665 2.0E-10
sp|Q8ZNV7|ZNUC_SALTY Zinc import ATP-binding protein ZnuC OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=znuC PE=2 SV=2 483 650 3.0E-10
sp|Q58903|Y1508_METJA Uncharacterized ABC transporter ATP-binding protein MJ1508 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ1508 PE=3 SV=1 478 667 3.0E-10
sp|P71082|YGAD_BACSU Putative multidrug export ATP-binding/permease protein YgaD OS=Bacillus subtilis (strain 168) GN=ygaD PE=3 SV=2 479 673 3.0E-10
sp|Q8A883|POTA_BACTN Spermidine/putrescine import ATP-binding protein PotA OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=potA PE=3 SV=1 462 653 3.0E-10
sp|Q9KQB8|ZNUC_VIBCH Zinc import ATP-binding protein ZnuC OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=znuC PE=3 SV=1 485 650 3.0E-10
sp|Q0P9X7|PEB1C_CAMJE Probable ABC transporter ATP-binding protein PEB1C OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=peb1C PE=3 SV=1 479 678 3.0E-10
sp|B5X0E4|ABCB5_MOUSE ATP-binding cassette sub-family B member 5 OS=Mus musculus GN=Abcb5 PE=2 SV=1 479 653 3.0E-10
sp|A0AGP9|POTA_LISW6 Spermidine/putrescine import ATP-binding protein PotA OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=potA PE=3 SV=1 464 650 3.0E-10
sp|Q8Y8T6|POTA_LISMO Spermidine/putrescine import ATP-binding protein PotA OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=potA PE=3 SV=2 464 650 4.0E-10
sp|Q9V2C0|WTPC_PYRAB Molybdate/tungstate import ATP-binding protein WtpC OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=wtpC PE=3 SV=1 483 650 4.0E-10
sp|A1VZQ5|PEB1C_CAMJJ Probable ABC transporter ATP-binding protein PEB1C OS=Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176) GN=peb1C PE=3 SV=1 479 678 4.0E-10
sp|Q48PV0|ZNUC_PSE14 Zinc import ATP-binding protein ZnuC OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=znuC PE=3 SV=1 472 635 4.0E-10
sp|Q16BJ3|TAUB_ROSDO Taurine import ATP-binding protein TauB OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) GN=tauB PE=3 SV=1 474 650 4.0E-10
sp|Q3IWB5|ZNUC_RHOS4 Zinc import ATP-binding protein ZnuC OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=znuC PE=3 SV=1 477 650 4.0E-10
sp|Q8EK40|CCMA_SHEON Cytochrome c biogenesis ATP-binding export protein CcmA OS=Shewanella oneidensis (strain MR-1) GN=ccmA PE=3 SV=1 478 656 4.0E-10
sp|B2GUP8|ABCB8_XENTR ATP-binding cassette sub-family B member 8, mitochondrial OS=Xenopus tropicalis GN=abcb8 PE=2 SV=1 455 653 4.0E-10
sp|P55604|Y4OS_RHISN Uncharacterized ABC transporter ATP-binding protein y4oS OS=Rhizobium sp. (strain NGR234) GN=NGR_a02170 PE=3 SV=1 479 650 4.0E-10
sp|Q0HNQ5|CCMA_SHESM Cytochrome c biogenesis ATP-binding export protein CcmA OS=Shewanella sp. (strain MR-4) GN=ccmA PE=3 SV=1 478 656 5.0E-10
sp|Q92DL6|POTA_LISIN Spermidine/putrescine import ATP-binding protein PotA OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=potA PE=3 SV=2 464 650 5.0E-10
sp|P9WQJ7|IRTB_MYCTU Iron import ATP-binding/permease protein IrtB OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=irtB PE=1 SV=1 475 671 5.0E-10
sp|P9WQJ6|IRTB_MYCTO Iron import ATP-binding/permease protein IrtB OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=irtB PE=3 SV=1 475 671 5.0E-10
sp|P63394|IRTB_MYCBO Iron import ATP-binding/permease protein IrtB OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=irtB PE=3 SV=1 475 671 5.0E-10
sp|Q9M1Q9|AB21B_ARATH ABC transporter B family member 21 OS=Arabidopsis thaliana GN=ABCB21 PE=1 SV=2 479 656 5.0E-10
sp|O07549|YHEH_BACSU Probable multidrug resistance ABC transporter ATP-binding/permease protein YheH OS=Bacillus subtilis (strain 168) GN=yheH PE=1 SV=1 427 665 5.0E-10
sp|Q722B1|POTA_LISMF Spermidine/putrescine import ATP-binding protein PotA OS=Listeria monocytogenes serotype 4b (strain F2365) GN=potA PE=3 SV=2 464 650 5.0E-10
sp|Q38VW6|POTA_LACSS Spermidine/putrescine import ATP-binding protein PotA OS=Lactobacillus sakei subsp. sakei (strain 23K) GN=potA PE=3 SV=1 479 653 5.0E-10
sp|Q9SYI3|AB5B_ARATH ABC transporter B family member 5 OS=Arabidopsis thaliana GN=ABCB5 PE=3 SV=1 483 656 5.0E-10
sp|Q9FNU2|AB25B_ORYSJ ABC transporter B family member 25 OS=Oryza sativa subsp. japonica GN=OsABCB25 PE=2 SV=1 407 667 5.0E-10
sp|P9WQI3|SUGC_MYCTU Trehalose import ATP-binding protein SugC OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=sugC PE=1 SV=1 474 653 6.0E-10
sp|P9WQI2|SUGC_MYCTO Trehalose import ATP-binding protein SugC OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=sugC PE=3 SV=1 474 653 6.0E-10
sp|Q3MAR5|POTA_ANAVT Spermidine/putrescine import ATP-binding protein PotA OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=potA PE=3 SV=1 475 650 6.0E-10
sp|Q03727|COMA_STRPN Transport/processing ATP-binding protein ComA OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=comA PE=3 SV=3 463 671 7.0E-10
sp|Q87UN0|ZNUC_PSESM Zinc import ATP-binding protein ZnuC OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=znuC PE=3 SV=1 472 635 7.0E-10
sp|Q5WKG4|SSUB1_BACSK Aliphatic sulfonates import ATP-binding protein SsuB 1 OS=Bacillus clausii (strain KSM-K16) GN=ssuB1 PE=3 SV=1 479 650 7.0E-10
sp|Q0I074|CCMA_SHESR Cytochrome c biogenesis ATP-binding export protein CcmA OS=Shewanella sp. (strain MR-7) GN=ccmA PE=3 SV=1 478 656 7.0E-10
sp|Q54NL1|ABCC9_DICDI ABC transporter C family member 9 OS=Dictyostelium discoideum GN=abcC9 PE=3 SV=1 476 670 7.0E-10
sp|Q28K97|TAUB_JANSC Taurine import ATP-binding protein TauB OS=Jannaschia sp. (strain CCS1) GN=tauB PE=3 SV=1 474 650 8.0E-10
sp|Q8XXB6|MSBA_RALSO Lipid A export ATP-binding/permease protein MsbA OS=Ralstonia solanacearum (strain GMI1000) GN=msbA PE=3 SV=1 473 662 8.0E-10
sp|Q9LSJ8|AB16B_ARATH ABC transporter B family member 16 OS=Arabidopsis thaliana GN=ABCB16 PE=2 SV=1 464 671 8.0E-10
sp|Q4ZZS2|ZNUC_PSEU2 Zinc import ATP-binding protein ZnuC OS=Pseudomonas syringae pv. syringae (strain B728a) GN=znuC PE=3 SV=1 461 635 9.0E-10
sp|Q9X2W0|MCJD_ECOLX Microcin-J25 export ATP-binding/permease protein McjD OS=Escherichia coli GN=mcjD PE=1 SV=1 479 656 9.0E-10
sp|P21449|MDR2_CRIGR Multidrug resistance protein 2 OS=Cricetulus griseus GN=PGY2 PE=2 SV=2 385 666 1.0E-09
sp|Q87PH3|POTA_VIBPA Spermidine/putrescine import ATP-binding protein PotA OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=potA PE=3 SV=1 475 650 1.0E-09
sp|Q8LGU1|AB8C_ARATH ABC transporter C family member 8 OS=Arabidopsis thaliana GN=ABCC8 PE=2 SV=3 487 638 1.0E-09
sp|A1SWH9|UGPC_PSYIN sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Psychromonas ingrahamii (strain 37) GN=ugpC PE=3 SV=1 474 649 1.0E-09
sp|Q881U6|SSUB2_PSESM Aliphatic sulfonates import ATP-binding protein SsuB 2 OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=ssuB2 PE=3 SV=1 476 650 1.0E-09
sp|P22638|HEPA_NOSS1 Heterocyst differentiation ATP-binding protein HepA OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=hepA PE=2 SV=3 461 671 1.0E-09
sp|Q8T6H3|ABCC6_DICDI ABC transporter C family member 6 OS=Dictyostelium discoideum GN=abcC6 PE=3 SV=1 490 671 1.0E-09
sp|Q4HVU7|ATM1_GIBZE Iron-sulfur clusters transporter ATM1, mitochondrial OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=ATM1 PE=3 SV=1 407 651 1.0E-09
sp|Q8CG09|MRP1_RAT Multidrug resistance-associated protein 1 OS=Rattus norvegicus GN=Abcc1 PE=1 SV=2 480 637 1.0E-09
sp|Q5F364|MRP1_CHICK Multidrug resistance-associated protein 1 OS=Gallus gallus GN=ABCC1 PE=2 SV=1 459 637 1.0E-09
sp|Q5F364|MRP1_CHICK Multidrug resistance-associated protein 1 OS=Gallus gallus GN=ABCC1 PE=2 SV=1 477 665 1.0E-09
sp|Q9FWX7|AB11B_ARATH ABC transporter B family member 11 OS=Arabidopsis thaliana GN=ABCB11 PE=2 SV=1 483 656 1.0E-09
sp|Q9P7V2|ABC4_SCHPO ATP-binding cassette transporter abc4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=abc4 PE=3 SV=1 157 635 1.0E-09
sp|Q9Y7M7|MDL1_SCHPO ATP-dependent permease MDL1, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mdl1 PE=3 SV=1 330 654 1.0E-09
sp|A3CMQ7|POTA_STRSV Spermidine/putrescine import ATP-binding protein PotA OS=Streptococcus sanguinis (strain SK36) GN=potA PE=3 SV=1 471 650 1.0E-09
sp|Q24XJ2|POTA_DESHY Spermidine/putrescine import ATP-binding protein PotA OS=Desulfitobacterium hafniense (strain Y51) GN=potA PE=3 SV=2 475 653 2.0E-09
sp|Q8U8D6|SSUB1_AGRFC Aliphatic sulfonates import ATP-binding protein SsuB 1 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=ssuB1 PE=3 SV=1 479 621 2.0E-09
sp|Q4L9P7|PHNC_STAHJ Phosphonates import ATP-binding protein PhnC OS=Staphylococcus haemolyticus (strain JCSC1435) GN=phnC PE=3 SV=1 464 650 2.0E-09
sp|P55469|Y4GM_RHISN Uncharacterized ABC transporter ATP-binding protein y4gM OS=Rhizobium sp. (strain NGR234) GN=NGR_a03510 PE=3 SV=1 445 666 2.0E-09
sp|P18767|NDVA_RHIME Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Rhizobium meliloti (strain 1021) GN=ndvA PE=1 SV=2 455 671 2.0E-09
sp|Q83KR7|ZNUC_SHIFL Zinc import ATP-binding protein ZnuC OS=Shigella flexneri GN=znuC PE=3 SV=1 483 650 2.0E-09
sp|Q0T3U8|ZNUC_SHIF8 Zinc import ATP-binding protein ZnuC OS=Shigella flexneri serotype 5b (strain 8401) GN=znuC PE=3 SV=1 483 650 2.0E-09
sp|P0DKX6|CYAB_BORP1 Cyclolysin secretion/processing ATP-binding protein CyaB OS=Bordetella pertussis (strain ATCC 9797 / DSM 5571 / NCTC 10739 / 18323) GN=cyaB PE=3 SV=1 474 666 2.0E-09
sp|P0DKX5|CYAB_BORPE Cyclolysin secretion/processing ATP-binding protein CyaB OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=cyaB PE=3 SV=1 474 666 2.0E-09
sp|Q8YM92|POTA_NOSS1 Spermidine/putrescine import ATP-binding protein PotA OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=potA PE=3 SV=1 475 650 2.0E-09
sp|Q00748|MDR65_DROME Multidrug resistance protein homolog 65 OS=Drosophila melanogaster GN=Mdr65 PE=1 SV=2 463 653 2.0E-09
sp|Q9QY30|ABCBB_MOUSE Bile salt export pump OS=Mus musculus GN=Abcb11 PE=1 SV=2 464 668 2.0E-09
sp|O70127|ABCBB_RAT Bile salt export pump OS=Rattus norvegicus GN=Abcb11 PE=1 SV=1 464 668 2.0E-09
sp|O67154|PSTB_AQUAE Phosphate import ATP-binding protein PstB OS=Aquifex aeolicus (strain VF5) GN=pstB PE=3 SV=1 480 681 2.0E-09
sp|Q6YUU5|MDR_ORYSJ Putative multidrug resistance protein OS=Oryza sativa subsp. japonica GN=Os02g0190300 PE=3 SV=1 463 653 2.0E-09
sp|P06795|MDR1B_MOUSE Multidrug resistance protein 1B OS=Mus musculus GN=Abcb1b PE=1 SV=1 479 666 3.0E-09
sp|P21447|MDR1A_MOUSE Multidrug resistance protein 1A OS=Mus musculus GN=Abcb1a PE=1 SV=3 479 666 3.0E-09
sp|Q6G5J0|UGPC_BARHE sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=ugpC PE=3 SV=1 475 650 3.0E-09
sp|Q2SPI3|ZNUC1_HAHCH Zinc import ATP-binding protein ZnuC 1 OS=Hahella chejuensis (strain KCTC 2396) GN=znuC1 PE=3 SV=1 475 641 3.0E-09
sp|P26760|RTX1B_ACTPL Toxin RTX-I translocation ATP-binding protein OS=Actinobacillus pleuropneumoniae GN=apxIB PE=1 SV=2 453 670 3.0E-09
sp|P77279|FETA_ECOLI Probable iron export ATP-binding protein FetA OS=Escherichia coli (strain K12) GN=fetA PE=1 SV=1 476 626 3.0E-09
sp|Q5JEB0|WTPC_THEKO Molybdate/tungstate import ATP-binding protein WtpC OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=wtpC PE=3 SV=1 483 650 3.0E-09
sp|Q933I3|LKTB_MANGL Leukotoxin translocation ATP-binding protein LktB OS=Mannheimia glucosida GN=lktB PE=3 SV=1 453 662 3.0E-09
sp|Q4ZTG9|SSUB1_PSEU2 Aliphatic sulfonates import ATP-binding protein SsuB 1 OS=Pseudomonas syringae pv. syringae (strain B728a) GN=ssuB1 PE=3 SV=1 476 626 3.0E-09
sp|O80725|AB4B_ARATH ABC transporter B family member 4 OS=Arabidopsis thaliana GN=ABCB4 PE=1 SV=1 479 656 3.0E-09
sp|Q06034|MDR1_LEIEN Multidrug resistance protein 1 OS=Leishmania enriettii GN=MDR1 PE=3 SV=1 462 651 3.0E-09
sp|Q9HT73|ZNUC_PSEAE Zinc import ATP-binding protein ZnuC OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=znuC PE=3 SV=1 472 650 3.0E-09
sp|Q02DK9|ZNUC_PSEAB Zinc import ATP-binding protein ZnuC OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=znuC PE=3 SV=1 472 650 3.0E-09
sp|Q9FHF1|AB7B_ARATH ABC transporter B family member 7 OS=Arabidopsis thaliana GN=ABCB7 PE=3 SV=1 474 651 3.0E-09
sp|Q61102|ABCB7_MOUSE ATP-binding cassette sub-family B member 7, mitochondrial OS=Mus musculus GN=Abcb7 PE=1 SV=3 460 658 3.0E-09
sp|Q3KKA1|ZNUC_PSEPF Zinc import ATP-binding protein ZnuC OS=Pseudomonas fluorescens (strain Pf0-1) GN=znuC PE=3 SV=1 476 650 3.0E-09
sp|P55122|LKTB_PASSP Leukotoxin translocation ATP-binding protein LktB OS=Pasteurella haemolytica-like sp. (strain 5943B) GN=lktB PE=3 SV=1 453 662 3.0E-09
sp|Q8RCU0|PSTB1_CALS4 Phosphate import ATP-binding protein PstB 1 OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=pstB1 PE=3 SV=1 475 651 3.0E-09
sp|Q5E6M2|ZNUC1_VIBF1 Zinc import ATP-binding protein ZnuC 1 OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=znuC1 PE=3 SV=1 464 635 3.0E-09
sp|O95342|ABCBB_HUMAN Bile salt export pump OS=Homo sapiens GN=ABCB11 PE=1 SV=2 464 668 3.0E-09
sp|P43245|MDR1_RAT Multidrug resistance protein 1 OS=Rattus norvegicus GN=Abcb1 PE=2 SV=1 479 666 4.0E-09
sp|P54537|ARTM_BACSU Arginine transport ATP-binding protein ArtM OS=Bacillus subtilis (strain 168) GN=artM PE=1 SV=1 479 671 4.0E-09
sp|Q089M3|CCMA_SHEFN Cytochrome c biogenesis ATP-binding export protein CcmA OS=Shewanella frigidimarina (strain NCIMB 400) GN=ccmA PE=3 SV=1 478 654 4.0E-09
sp|P45081|CYDC_HAEIN ATP-binding/permease protein CydC OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=cydC PE=3 SV=1 436 671 4.0E-09
sp|Q1LNM0|SSUB_CUPMC Aliphatic sulfonates import ATP-binding protein SsuB OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=ssuB PE=3 SV=1 475 650 4.0E-09
sp|Q9YGA6|MALK_THELN Trehalose/maltose import ATP-binding protein MalK OS=Thermococcus litoralis (strain ATCC 51850 / DSM 5473 / JCM 8560 / NS-C) GN=malK PE=1 SV=1 480 650 4.0E-09
sp|Q9I6T2|POTA1_PSEAE Spermidine/putrescine import ATP-binding protein PotA 1 OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=potA1 PE=3 SV=1 475 650 4.0E-09
sp|Q9SGY1|AB10B_ARATH ABC transporter B family member 10 OS=Arabidopsis thaliana GN=ABCB10 PE=1 SV=2 454 671 4.0E-09
sp|Q54W24|ABCB4_DICDI ABC transporter B family member 4 OS=Dictyostelium discoideum GN=abcB4 PE=3 SV=1 351 653 4.0E-09
sp|Q88WA5|METN1_LACPL Methionine import ATP-binding protein MetN 1 OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=metN1 PE=3 SV=1 480 671 5.0E-09
sp|Q2ULH4|ATM1_ASPOR Iron-sulfur clusters transporter atm1, mitochondrial OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=atm1 PE=3 SV=1 458 651 5.0E-09
sp|Q7NQN5|POTA_CHRVO Spermidine/putrescine import ATP-binding protein PotA OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=potA PE=3 SV=1 480 681 5.0E-09
sp|Q03203|NIST_LACLL Nisin transport ATP-binding protein NisT OS=Lactococcus lactis subsp. lactis GN=nisT PE=3 SV=1 446 654 5.0E-09
sp|Q2G506|ATM1_NOVAD ATM1-type heavy metal exporter OS=Novosphingobium aromaticivorans (strain DSM 12444 / F199) GN=atm1 PE=1 SV=1 479 669 5.0E-09
sp|Q9X196|POTA_THEMA Spermidine/putrescine import ATP-binding protein PotA OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=potA PE=3 SV=1 479 653 5.0E-09
sp|Q7RX59|ATM1_NEUCR Iron-sulfur clusters transporter atm1, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=fes-4 PE=3 SV=1 455 641 5.0E-09
sp|Q18AM3|POTA_PEPD6 Spermidine/putrescine import ATP-binding protein PotA OS=Peptoclostridium difficile (strain 630) GN=potA PE=3 SV=1 479 653 5.0E-09
sp|Q704E8|ABCB7_RAT ATP-binding cassette sub-family B member 7, mitochondrial OS=Rattus norvegicus GN=Abcb7 PE=1 SV=1 460 658 5.0E-09
sp|P08716|HLYBP_ECOLX Alpha-hemolysin translocation ATP-binding protein HlyB OS=Escherichia coli GN=hlyB PE=1 SV=1 453 671 5.0E-09
sp|O35379|MRP1_MOUSE Multidrug resistance-associated protein 1 OS=Mus musculus GN=Abcc1 PE=1 SV=1 480 637 5.0E-09
sp|Q8X4L6|NIKE_ECO57 Nickel import ATP-binding protein NikE OS=Escherichia coli O157:H7 GN=nikE PE=3 SV=1 483 679 6.0E-09
sp|Q97KS6|POTA_CLOAB Spermidine/putrescine import ATP-binding protein PotA OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=potA PE=3 SV=1 479 653 6.0E-09
sp|Q2K342|NDVA_RHIEC Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=ndvA PE=3 SV=2 464 671 6.0E-09
sp|Q1GB17|POTA_LACDA Spermidine/putrescine import ATP-binding protein PotA OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / JCM 1002 / NBRC 13953 / NCIMB 11778) GN=potA PE=3 SV=2 475 653 6.0E-09
sp|Q6G2E2|METN_BARHE Methionine import ATP-binding protein MetN OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=metN PE=3 SV=1 483 671 6.0E-09
sp|Q8D954|UGPC_VIBVU sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Vibrio vulnificus (strain CMCP6) GN=ugpC PE=3 SV=1 475 650 6.0E-09
sp|Q0K9I2|SSUB_CUPNH Aliphatic sulfonates import ATP-binding protein SsuB OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=ssuB PE=3 SV=1 475 650 6.0E-09
sp|P21448|MDR1_CRIGR Multidrug resistance protein 1 OS=Cricetulus griseus GN=ABCB1 PE=1 SV=2 479 666 7.0E-09
sp|O57896|WTPC_PYRHO Molybdate/tungstate import ATP-binding protein WtpC OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=wtpC PE=3 SV=1 480 650 7.0E-09
sp|P33527|MRP1_HUMAN Multidrug resistance-associated protein 1 OS=Homo sapiens GN=ABCC1 PE=1 SV=3 477 665 7.0E-09
sp|Q8XZQ4|SSUB_RALSO Aliphatic sulfonates import ATP-binding protein SsuB OS=Ralstonia solanacearum (strain GMI1000) GN=ssuB PE=3 SV=1 483 650 7.0E-09
sp|Q7MLB8|UGPC_VIBVY sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Vibrio vulnificus (strain YJ016) GN=ugpC PE=3 SV=2 475 650 7.0E-09
sp|P10089|HLYBC_ECOLX Alpha-hemolysin translocation ATP-binding protein HlyB OS=Escherichia coli GN=hlyB PE=3 SV=2 463 671 8.0E-09
sp|Q47258|HLYB3_ECOLX Alpha-hemolysin translocation ATP-binding protein HlyB OS=Escherichia coli GN=hlyB PE=1 SV=1 463 671 8.0E-09
sp|Q2SE49|CCMA_HAHCH Cytochrome c biogenesis ATP-binding export protein CcmA OS=Hahella chejuensis (strain KCTC 2396) GN=ccmA PE=3 SV=1 478 650 8.0E-09
sp|O75027|ABCB7_HUMAN ATP-binding cassette sub-family B member 7, mitochondrial OS=Homo sapiens GN=ABCB7 PE=1 SV=2 460 658 8.0E-09
sp|Q63563|ABCC9_RAT ATP-binding cassette sub-family C member 9 OS=Rattus norvegicus GN=Abcc9 PE=1 SV=1 490 708 8.0E-09
sp|Q07LU3|HMUV_RHOP5 Hemin import ATP-binding protein HmuV OS=Rhodopseudomonas palustris (strain BisA53) GN=hmuV PE=3 SV=1 473 650 8.0E-09
sp|Q5LVM5|TAUB_RUEPO Taurine import ATP-binding protein TauB OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=tauB PE=3 SV=1 474 650 8.0E-09
sp|Q5PB72|ZNUC_ANAMM Zinc import ATP-binding protein ZnuC OS=Anaplasma marginale (strain St. Maries) GN=znuC PE=3 SV=1 479 650 9.0E-09
sp|Q9RCG7|PAXB_PASAE Exotoxin translocation ATP-binding protein PaxB OS=Pasteurella aerogenes GN=paxB PE=3 SV=1 452 653 9.0E-09
sp|Q4KKK4|ZNUC_PSEF5 Zinc import ATP-binding protein ZnuC OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=znuC PE=3 SV=1 476 650 9.0E-09
sp|Q06034|MDR1_LEIEN Multidrug resistance protein 1 OS=Leishmania enriettii GN=MDR1 PE=3 SV=1 454 665 1.0E-08
sp|Q54VJ0|ABCC2_DICDI ABC transporter C family member 2 OS=Dictyostelium discoideum GN=abcC2 PE=3 SV=1 440 670 1.0E-08
sp|Q9M0M2|AB9B_ARATH ABC transporter B family member 9 OS=Arabidopsis thaliana GN=ABCB9 PE=3 SV=2 483 656 1.0E-08
sp|O34314|YTLC_BACSU Uncharacterized ABC transporter ATP-binding protein YtlC OS=Bacillus subtilis (strain 168) GN=ytlC PE=3 SV=1 480 650 1.0E-08
sp|Q8TSC8|Y870_METAC Putative ABC transporter ATP-binding protein MA_0870 OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=MA_0870 PE=3 SV=1 480 674 1.0E-08
sp|Q04473|RTX3B_ACTPL Toxin RTX-III translocation ATP-binding protein OS=Actinobacillus pleuropneumoniae GN=apxIIIB PE=3 SV=1 474 662 1.0E-08
sp|Q9C9W0|AB17I_ARATH ABC transporter I family member 17 OS=Arabidopsis thaliana GN=ABCI17 PE=2 SV=1 468 650 1.0E-08
sp|P16532|LKB1A_MANHA Leukotoxin translocation ATP-binding protein LktB OS=Mannheimia haemolytica GN=lktB PE=3 SV=1 453 662 1.0E-08
sp|Q93FH2|LKB13_MANHA Leukotoxin translocation ATP-binding protein LktB OS=Mannheimia haemolytica GN=lktB PE=3 SV=1 453 662 1.0E-08
sp|Q933E0|LKTB_BIBTR Leukotoxin translocation ATP-binding protein LktB OS=Bibersteinia trehalosi GN=lktB PE=3 SV=1 453 662 1.0E-08
sp|Q93FH6|LKB1B_MANHA Leukotoxin translocation ATP-binding protein LktB OS=Mannheimia haemolytica GN=lktB PE=3 SV=1 453 662 1.0E-08
sp|Q57855|Y412_METJA Uncharacterized ABC transporter ATP-binding protein MJ0412 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ0412 PE=3 SV=1 483 637 1.0E-08
sp|Q93FH0|LKB2A_MANHA Leukotoxin translocation ATP-binding protein LktB OS=Mannheimia haemolytica GN=lktB PE=3 SV=2 453 662 1.0E-08
sp|P0C086|LKTB7_MANHA Leukotoxin translocation ATP-binding protein LktB OS=Mannheimia haemolytica GN=lktB PE=3 SV=1 453 662 1.0E-08
sp|P0C087|LKB14_MANHA Leukotoxin translocation ATP-binding protein LktB OS=Mannheimia haemolytica GN=lktB PE=3 SV=1 453 662 1.0E-08
sp|Q1WVG9|METN_LACS1 Methionine import ATP-binding protein MetN OS=Lactobacillus salivarius (strain UCC118) GN=metN PE=3 SV=1 464 651 1.0E-08
sp|Q9LHK4|AB8B_ARATH Putative ABC transporter B family member 8 OS=Arabidopsis thaliana GN=ABCB8 PE=5 SV=1 456 656 1.0E-08
sp|Q92337|ABC1_SCHPO ATP-binding cassette transporter abc1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=abc1 PE=3 SV=1 480 638 1.0E-08
sp|Q9FWX8|AB12B_ARATH ABC transporter B family member 12 OS=Arabidopsis thaliana GN=ABCB12 PE=2 SV=2 483 656 1.0E-08
sp|O28881|LIVG_ARCFU Probable branched-chain amino acid transport ATP-binding protein LivG OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=livG PE=3 SV=2 483 661 1.0E-08
sp|Q8T9W2|ABCB5_DICDI ABC transporter B family member 5 OS=Dictyostelium discoideum GN=abcB5 PE=3 SV=1 407 684 1.0E-08
sp|Q8ST87|ABCCA_DICDI ABC transporter C family member 10 OS=Dictyostelium discoideum GN=abcC10 PE=3 SV=1 460 638 1.0E-08
sp|Q63120|MRP2_RAT Canalicular multispecific organic anion transporter 1 OS=Rattus norvegicus GN=Abcc2 PE=1 SV=1 474 651 1.0E-08
sp|Q5E3B8|PSTB2_VIBF1 Phosphate import ATP-binding protein PstB 2 OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=pstB2 PE=3 SV=1 496 671 1.0E-08
sp|Q9KRT4|UGPC_VIBCH sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=ugpC PE=3 SV=2 475 650 1.0E-08
sp|Q00748|MDR65_DROME Multidrug resistance protein homolog 65 OS=Drosophila melanogaster GN=Mdr65 PE=1 SV=2 69 653 2.0E-08
sp|Q3KBH4|POTA_PSEPF Spermidine/putrescine import ATP-binding protein PotA OS=Pseudomonas fluorescens (strain Pf0-1) GN=potA PE=3 SV=1 466 650 2.0E-08
sp|Q71ED1|NDVA_AGRVI Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Agrobacterium vitis GN=ndvA PE=3 SV=1 463 671 2.0E-08
sp|Q54BT3|ABCB2_DICDI ABC transporter B family member 2 OS=Dictyostelium discoideum GN=abcB2 PE=3 SV=1 463 653 2.0E-08
sp|Q6BXD7|ATM1_DEBHA Iron-sulfur clusters transporter ATM1, mitochondrial OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=ATM1 PE=3 SV=2 479 651 2.0E-08
sp|Q0WML0|AB27B_ARATH ABC transporter B family member 27 OS=Arabidopsis thaliana GN=ABCB27 PE=1 SV=1 469 656 2.0E-08
sp|Q5RKI8|ABCB8_RAT ATP-binding cassette sub-family B member 8, mitochondrial OS=Rattus norvegicus GN=Abcb8 PE=2 SV=1 463 667 2.0E-08
sp|Q665B6|SSUB_YERPS Aliphatic sulfonates import ATP-binding protein SsuB OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=ssuB PE=3 SV=1 483 650 2.0E-08
sp|Q8EUF1|ECFA_MYCPE Energy-coupling factor transporter ATP-binding protein EcfA OS=Mycoplasma penetrans (strain HF-2) GN=ecfA PE=3 SV=1 479 650 2.0E-08
sp|P96063|PHNT_SALTY Putative 2-aminoethylphosphonate import ATP-binding protein PhnT OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=phnT PE=2 SV=1 472 653 2.0E-08
sp|Q8ELR4|POTA_OCEIH Spermidine/putrescine import ATP-binding protein PotA OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=potA PE=3 SV=1 464 650 2.0E-08
sp|Q9CXJ4|ABCB8_MOUSE ATP-binding cassette sub-family B member 8, mitochondrial OS=Mus musculus GN=Abcb8 PE=1 SV=1 463 702 2.0E-08
sp|Q9CGD4|POTA_LACLA Spermidine/putrescine import ATP-binding protein PotA OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=potA PE=3 SV=1 464 653 2.0E-08
sp|Q46717|HLYB_ECO57 Alpha-hemolysin translocation ATP-binding protein HlyB OS=Escherichia coli O157:H7 GN=hlyB PE=3 SV=2 454 666 2.0E-08
sp|Q8HXQ5|MRP1_BOVIN Multidrug resistance-associated protein 1 OS=Bos taurus GN=ABCC1 PE=2 SV=1 475 637 2.0E-08
sp|Q9DC29|ABCB6_MOUSE ATP-binding cassette sub-family B member 6, mitochondrial OS=Mus musculus GN=Abcb6 PE=1 SV=1 464 653 2.0E-08
sp|Q02XM9|RBSA_LACLS Ribose import ATP-binding protein RbsA OS=Lactococcus lactis subsp. cremoris (strain SK11) GN=rbsA PE=3 SV=1 479 651 2.0E-08
sp|Q6D5H7|METN1_PECAS Methionine import ATP-binding protein MetN 1 OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=metN1 PE=3 SV=1 480 656 2.0E-08
sp|Q02Z10|POTA_LACLS Spermidine/putrescine import ATP-binding protein PotA OS=Lactococcus lactis subsp. cremoris (strain SK11) GN=potA PE=3 SV=1 464 652 2.0E-08
sp|Q57SD6|PHNT_SALCH Putative 2-aminoethylphosphonate import ATP-binding protein PhnT OS=Salmonella choleraesuis (strain SC-B67) GN=phnT PE=3 SV=1 472 653 2.0E-08
sp|Q54U44|ABCCC_DICDI ABC transporter C family member 12 OS=Dictyostelium discoideum GN=abcC12 PE=3 SV=1 480 638 2.0E-08
sp|Q28VN1|ZNUC_JANSC Zinc import ATP-binding protein ZnuC OS=Jannaschia sp. (strain CCS1) GN=znuC PE=3 SV=1 477 650 2.0E-08
sp|Q4WLN7|ATM1_ASPFU Iron-sulfur clusters transporter atm1, mitochondrial OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=atm1 PE=3 SV=1 458 667 2.0E-08
sp|O70595|ABCB6_RAT ATP-binding cassette sub-family B member 6, mitochondrial OS=Rattus norvegicus GN=Abcb6 PE=2 SV=1 464 653 2.0E-08
sp|P33594|NIKE_ECOLI Nickel import ATP-binding protein NikE OS=Escherichia coli (strain K12) GN=nikE PE=3 SV=2 483 679 2.0E-08
sp|O07550|YHEI_BACSU Probable multidrug resistance ABC transporter ATP-binding/permease protein YheI OS=Bacillus subtilis (strain 168) GN=yheI PE=1 SV=1 458 666 2.0E-08
sp|O35379|MRP1_MOUSE Multidrug resistance-associated protein 1 OS=Mus musculus GN=Abcc1 PE=1 SV=1 477 665 3.0E-08
sp|Q73F67|ECFA1_BACC1 Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=ecfA1 PE=3 SV=1 483 650 3.0E-08
sp|Q0I4A9|ZNUC_HAES1 Zinc import ATP-binding protein ZnuC OS=Haemophilus somnus (strain 129Pt) GN=znuC PE=3 SV=1 493 650 3.0E-08
sp|Q7CN92|POTA_STRP8 Spermidine/putrescine import ATP-binding protein PotA OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=potA PE=3 SV=1 464 653 3.0E-08
sp|Q99ZS8|POTA_STRP1 Spermidine/putrescine import ATP-binding protein PotA OS=Streptococcus pyogenes serotype M1 GN=potA PE=3 SV=1 464 653 3.0E-08
sp|Q54LE6|ABCC5_DICDI ABC transporter C family member 5 OS=Dictyostelium discoideum GN=abcC5 PE=3 SV=1 479 674 3.0E-08
sp|Q5LUR8|ZNUC_RUEPO Zinc import ATP-binding protein ZnuC OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=znuC PE=3 SV=1 475 650 3.0E-08
sp|Q9C7F8|AB13B_ARATH ABC transporter B family member 13 OS=Arabidopsis thaliana GN=ABCB13 PE=3 SV=1 463 653 3.0E-08
sp|O60706|ABCC9_HUMAN ATP-binding cassette sub-family C member 9 OS=Homo sapiens GN=ABCC9 PE=1 SV=2 490 708 3.0E-08
sp|P70170|ABCC9_MOUSE ATP-binding cassette sub-family C member 9 OS=Mus musculus GN=Abcc9 PE=1 SV=2 490 708 3.0E-08
sp|Q98HF7|POTA_RHILO Spermidine/putrescine import ATP-binding protein PotA OS=Rhizobium loti (strain MAFF303099) GN=potA PE=3 SV=1 464 650 3.0E-08
sp|Q9CF44|RBSA_LACLA Ribose import ATP-binding protein RbsA OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=rbsA PE=3 SV=1 479 651 3.0E-08
sp|Q8FDZ8|HLYB_ECOL6 Alpha-hemolysin translocation ATP-binding protein HlyB OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=hlyB PE=3 SV=1 463 671 3.0E-08
sp|A1B9K8|ZNUC_PARDP Zinc import ATP-binding protein ZnuC OS=Paracoccus denitrificans (strain Pd 1222) GN=znuC PE=3 SV=1 472 626 3.0E-08
sp|Q93DA2|METN_STRMU Methionine import ATP-binding protein MetN OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=metN PE=3 SV=1 480 656 3.0E-08
sp|Q93FH3|LKB16_MANHA Leukotoxin translocation ATP-binding protein LktB OS=Mannheimia haemolytica GN=lktB PE=3 SV=1 453 662 3.0E-08
sp|Q2YKZ7|Y2993_BRUA2 Putative ATP-binding protein BAB2_0493 OS=Brucella abortus (strain 2308) GN=BAB2_0493 PE=3 SV=1 483 641 3.0E-08
sp|Q578M5|Y2787_BRUAB Putative ATP-binding protein BruAb2_0487 OS=Brucella abortus biovar 1 (strain 9-941) GN=BruAb2_0487 PE=3 SV=1 483 641 3.0E-08
sp|Q4PH16|ATM1_USTMA Iron-sulfur clusters transporter ATM1, mitochondrial OS=Ustilago maydis (strain 521 / FGSC 9021) GN=ATM1 PE=3 SV=1 462 631 3.0E-08
sp|Q864R9|MRP1_MACFA Multidrug resistance-associated protein 1 OS=Macaca fascicularis GN=ABCC1 PE=2 SV=1 477 665 3.0E-08
sp|Q1MQ44|POTA_LAWIP Spermidine/putrescine import ATP-binding protein PotA OS=Lawsonia intracellularis (strain PHE/MN1-00) GN=potA PE=3 SV=1 483 650 3.0E-08
sp|Q8FVT0|Y3745_BRUSU Putative ATP-binding protein BRA0745/BS1330_II0738 OS=Brucella suis biovar 1 (strain 1330) GN=BRA0745 PE=3 SV=1 483 641 3.0E-08
sp|Q28689|MRP2_RABIT Canalicular multispecific organic anion transporter 1 OS=Oryctolagus cuniculus GN=ABCC2 PE=2 SV=1 474 651 3.0E-08
sp|P78966|MAM1_SCHPO Mating factor M secretion protein mam1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mam1 PE=3 SV=1 464 666 4.0E-08
sp|Q63120|MRP2_RAT Canalicular multispecific organic anion transporter 1 OS=Rattus norvegicus GN=Abcc2 PE=1 SV=1 474 638 4.0E-08
sp|Q5XCA4|POTA_STRP6 Spermidine/putrescine import ATP-binding protein PotA OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=potA PE=3 SV=1 464 653 4.0E-08
sp|Q8G358|CCMA_BRUSU Cytochrome c biogenesis ATP-binding export protein CcmA OS=Brucella suis biovar 1 (strain 1330) GN=ccmA PE=3 SV=1 475 631 4.0E-08
sp|Q57FS7|CCMA_BRUAB Cytochrome c biogenesis ATP-binding export protein CcmA OS=Brucella abortus biovar 1 (strain 9-941) GN=ccmA PE=3 SV=1 475 631 4.0E-08
sp|Q2YNU0|CCMA_BRUA2 Cytochrome c biogenesis ATP-binding export protein CcmA OS=Brucella abortus (strain 2308) GN=ccmA PE=3 SV=1 475 631 4.0E-08
sp|O31707|YKNU_BACSU Uncharacterized ABC transporter ATP-binding protein YknU OS=Bacillus subtilis (strain 168) GN=yknU PE=3 SV=3 483 669 4.0E-08
sp|Q02SA6|TAUB_PSEAB Taurine import ATP-binding protein TauB OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=tauB PE=3 SV=1 478 650 4.0E-08
sp|Q6UR05|MRP1_CANLF Multidrug resistance-associated protein 1 OS=Canis lupus familiaris GN=ABCC1 PE=2 SV=1 480 637 4.0E-08
sp|Q92887|MRP2_HUMAN Canalicular multispecific organic anion transporter 1 OS=Homo sapiens GN=ABCC2 PE=1 SV=3 475 638 4.0E-08
sp|Q8UII7|UGPC1_AGRFC sn-glycerol-3-phosphate import ATP-binding protein UgpC 1 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=ugpC1 PE=3 SV=1 480 650 4.0E-08
sp|Q5A762|MLT1_CANAL Multiple drug resistance-associated protein-like transporter 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MLT1 PE=1 SV=1 409 626 4.0E-08
sp|Q8YH20|NDVA_BRUME Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=ndvA PE=3 SV=1 463 692 4.0E-08
sp|P39109|YCFI_YEAST Metal resistance protein YCF1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YCF1 PE=1 SV=2 474 651 4.0E-08
sp|Q1LLP5|UGPC_CUPMC sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=ugpC PE=3 SV=1 475 661 4.0E-08
sp|Q9Z3I3|NODI_BRASS Nod factor export ATP-binding protein I OS=Bradyrhizobium sp. (strain SNU001) GN=nodI PE=3 SV=1 476 650 4.0E-08
sp|O05519|YDIF_BACSU Uncharacterized ABC transporter ATP-binding protein YdiF OS=Bacillus subtilis (strain 168) GN=ydiF PE=3 SV=2 476 652 4.0E-08
sp|Q8YEM5|CCMA_BRUME Cytochrome c biogenesis ATP-binding export protein CcmA OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=ccmA PE=3 SV=2 475 631 4.0E-08
sp|P36879|YADG_ECOLI Uncharacterized ABC transporter ATP-binding protein YadG OS=Escherichia coli (strain K12) GN=yadG PE=3 SV=1 474 650 4.0E-08
sp|Q1J6Q6|POTA_STRPF Spermidine/putrescine import ATP-binding protein PotA OS=Streptococcus pyogenes serotype M4 (strain MGAS10750) GN=potA PE=3 SV=1 464 653 4.0E-08
sp|Q1JGY7|POTA_STRPD Spermidine/putrescine import ATP-binding protein PotA OS=Streptococcus pyogenes serotype M2 (strain MGAS10270) GN=potA PE=3 SV=1 464 653 4.0E-08
sp|Q1JLT7|POTA_STRPC Spermidine/putrescine import ATP-binding protein PotA OS=Streptococcus pyogenes serotype M12 (strain MGAS9429) GN=potA PE=3 SV=1 464 653 4.0E-08
sp|Q1JBV6|POTA_STRPB Spermidine/putrescine import ATP-binding protein PotA OS=Streptococcus pyogenes serotype M12 (strain MGAS2096) GN=potA PE=3 SV=1 464 653 4.0E-08
sp|O15438|MRP3_HUMAN Canalicular multispecific organic anion transporter 2 OS=Homo sapiens GN=ABCC3 PE=1 SV=3 480 667 4.0E-08
sp|P0CZ35|POTA_STRPQ Spermidine/putrescine import ATP-binding protein PotA OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=potA PE=3 SV=1 464 653 4.0E-08
sp|Q48TP4|POTA_STRPM Spermidine/putrescine import ATP-binding protein PotA OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=potA PE=3 SV=1 464 653 4.0E-08
sp|P0CZ34|POTA_STRP3 Spermidine/putrescine import ATP-binding protein PotA OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=potA PE=3 SV=1 464 653 4.0E-08
sp|Q6UR05|MRP1_CANLF Multidrug resistance-associated protein 1 OS=Canis lupus familiaris GN=ABCC1 PE=2 SV=1 475 665 5.0E-08
sp|Q47T99|POTA_THEFY Spermidine/putrescine import ATP-binding protein PotA OS=Thermobifida fusca (strain YX) GN=potA PE=3 SV=1 480 653 5.0E-08
sp|Q7N0N3|Y3849_PHOLL Putative ABC transporter ATP-binding protein plu3849 OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=plu3849 PE=3 SV=1 478 671 5.0E-08
sp|Q6N999|LOLD1_RHOPA Lipoprotein-releasing system ATP-binding protein LolD 1 OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=lolD1 PE=3 SV=1 479 667 5.0E-08
sp|Q04F14|METN1_OENOB Methionine import ATP-binding protein MetN 1 OS=Oenococcus oeni (strain ATCC BAA-331 / PSU-1) GN=metN1 PE=3 SV=1 480 671 5.0E-08
sp|Q8G0T8|NDVA_BRUSU Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Brucella suis biovar 1 (strain 1330) GN=ndvA PE=3 SV=1 463 692 5.0E-08
sp|Q5E3S7|CCMA_VIBF1 Cytochrome c biogenesis ATP-binding export protein CcmA OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=ccmA PE=3 SV=1 478 648 5.0E-08
sp|P0C529|NDVA_BRUAB Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Brucella abortus biovar 1 (strain 9-941) GN=ndvA PE=3 SV=1 463 692 5.0E-08
sp|Q2YQ73|NDVA_BRUA2 Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Brucella abortus (strain 2308) GN=ndvA PE=1 SV=1 463 692 5.0E-08
sp|Q1CDR0|SSUB_YERPN Aliphatic sulfonates import ATP-binding protein SsuB OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=ssuB PE=3 SV=1 483 650 5.0E-08
sp|Q74PI5|SSUB_YERPE Aliphatic sulfonates import ATP-binding protein SsuB OS=Yersinia pestis GN=ssuB PE=3 SV=1 483 650 5.0E-08
sp|Q1C1S0|SSUB_YERPA Aliphatic sulfonates import ATP-binding protein SsuB OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=ssuB PE=3 SV=1 483 650 5.0E-08
sp|P37313|DPPF_ECOLI Dipeptide transport ATP-binding protein DppF OS=Escherichia coli (strain K12) GN=dppF PE=3 SV=1 479 692 5.0E-08
sp|Q1MAB5|NDVA_RHIL3 Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=ndvA PE=3 SV=1 454 671 5.0E-08
sp|A0KPH6|ZNUC_AERHH Zinc import ATP-binding protein ZnuC OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=znuC PE=3 SV=1 475 660 5.0E-08
sp|Q93FG6|LKB2B_MANHA Leukotoxin translocation ATP-binding protein LktB OS=Mannheimia haemolytica GN=lktB PE=3 SV=1 474 662 5.0E-08
sp|Q8DPC2|POTA_STRR6 Spermidine/putrescine import ATP-binding protein PotA OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=potA PE=3 SV=1 479 650 5.0E-08
sp|Q97Q42|POTA_STRPN Spermidine/putrescine import ATP-binding protein PotA OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=potA PE=3 SV=1 479 650 5.0E-08
sp|Q04JW0|POTA_STRP2 Spermidine/putrescine import ATP-binding protein PotA OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=potA PE=3 SV=1 479 650 5.0E-08
sp|Q57243|Y1272_HAEIN Uncharacterized ABC transporter ATP-binding protein HI_1272 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=HI_1272 PE=3 SV=1 476 700 5.0E-08
sp|Q92L55|CCMA_RHIME Cytochrome c biogenesis ATP-binding export protein CcmA OS=Rhizobium meliloti (strain 1021) GN=ccmA PE=3 SV=1 477 633 5.0E-08
sp|P21440|MDR3_MOUSE Phosphatidylcholine translocator ABCB4 OS=Mus musculus GN=Abcb4 PE=1 SV=2 385 665 6.0E-08
sp|P82451|ABCC9_RABIT ATP-binding cassette sub-family C member 9 OS=Oryctolagus cuniculus GN=ABCC9 PE=2 SV=1 475 708 6.0E-08
sp|Q8VI47|MRP2_MOUSE Canalicular multispecific organic anion transporter 1 OS=Mus musculus GN=Abcc2 PE=1 SV=2 480 638 6.0E-08
sp|Q1R155|ZNUC_CHRSD Zinc import ATP-binding protein ZnuC OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=znuC PE=3 SV=2 475 650 6.0E-08
sp|P37608|LCN3_LACLL Lacticin-481/lactococcin-DR transport/processing ATP-binding protein lcnDR3 OS=Lactococcus lactis subsp. lactis GN=lcnDR3 PE=3 SV=1 486 685 6.0E-08
sp|Q9N0V3|ABCBB_RABIT Bile salt export pump OS=Oryctolagus cuniculus GN=ABCB11 PE=2 SV=1 464 671 6.0E-08
sp|Q5PFQ7|PHNT_SALPA Putative 2-aminoethylphosphonate import ATP-binding protein PhnT OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=phnT PE=3 SV=1 472 653 6.0E-08
sp|Q8CG09|MRP1_RAT Multidrug resistance-associated protein 1 OS=Rattus norvegicus GN=Abcc1 PE=1 SV=2 477 665 7.0E-08
sp|Q8Z8W8|PHNT_SALTI Putative 2-aminoethylphosphonate import ATP-binding protein PhnT OS=Salmonella typhi GN=phnT PE=3 SV=1 472 653 7.0E-08
sp|Q9I1C8|METN1_PSEAE Methionine import ATP-binding protein MetN 1 OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=metN1 PE=3 SV=1 474 656 7.0E-08
sp|Q7MNI7|PSTB1_VIBVY Phosphate import ATP-binding protein PstB 1 OS=Vibrio vulnificus (strain YJ016) GN=pstB1 PE=3 SV=1 483 647 7.0E-08
sp|Q8DEW5|PSTB1_VIBVU Phosphate import ATP-binding protein PstB 1 OS=Vibrio vulnificus (strain CMCP6) GN=pstB1 PE=3 SV=1 483 647 7.0E-08
sp|Q1RGL1|ZNUC_RICBR Zinc import ATP-binding protein ZnuC OS=Rickettsia bellii (strain RML369-C) GN=znuC PE=3 SV=1 480 650 7.0E-08
sp|Q3YW48|NIKE_SHISS Nickel import ATP-binding protein NikE OS=Shigella sonnei (strain Ss046) GN=nikE PE=3 SV=1 483 679 7.0E-08
sp|Q217B2|HMUV_RHOPB Hemin import ATP-binding protein HmuV OS=Rhodopseudomonas palustris (strain BisB18) GN=hmuV PE=3 SV=1 475 650 8.0E-08
sp|Q9NP58|ABCB6_HUMAN ATP-binding cassette sub-family B member 6, mitochondrial OS=Homo sapiens GN=ABCB6 PE=1 SV=1 464 653 8.0E-08
sp|A1U776|ZNUC_MARHV Zinc import ATP-binding protein ZnuC OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=znuC PE=3 SV=1 479 641 8.0E-08
sp|Q21XJ9|SSUB_RHOFT Aliphatic sulfonates import ATP-binding protein SsuB OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) GN=ssuB PE=3 SV=1 485 650 8.0E-08
sp|O34362|YKOD_BACSU Putative HMP/thiamine import ATP-binding protein YkoD OS=Bacillus subtilis (strain 168) GN=ykoD PE=1 SV=2 483 674 9.0E-08
sp|Q7A1Z1|PHNC_STAAW Phosphonates import ATP-binding protein PhnC OS=Staphylococcus aureus (strain MW2) GN=phnC PE=3 SV=1 464 670 9.0E-08
sp|Q6GCY2|PHNC_STAAS Phosphonates import ATP-binding protein PhnC OS=Staphylococcus aureus (strain MSSA476) GN=phnC PE=3 SV=1 464 670 9.0E-08
sp|Q7A848|PHNC_STAAN Phosphonates import ATP-binding protein PhnC OS=Staphylococcus aureus (strain N315) GN=phnC PE=3 SV=1 464 670 9.0E-08
sp|Q99X73|PHNC_STAAM Phosphonates import ATP-binding protein PhnC OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=phnC PE=3 SV=1 464 670 9.0E-08
sp|Q5HJM6|PHNC_STAAC Phosphonates import ATP-binding protein PhnC OS=Staphylococcus aureus (strain COL) GN=phnC PE=3 SV=1 464 670 9.0E-08
sp|Q2G1L8|PHNC_STAA8 Phosphonates import ATP-binding protein PhnC OS=Staphylococcus aureus (strain NCTC 8325) GN=phnC PE=3 SV=1 464 670 9.0E-08
sp|Q2FKB7|PHNC_STAA3 Phosphonates import ATP-binding protein PhnC OS=Staphylococcus aureus (strain USA300) GN=phnC PE=3 SV=1 464 670 9.0E-08
sp|Q926D8|ZURA_LISIN Zinc uptake system ATP-binding protein ZurA OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=zurA PE=3 SV=1 480 696 9.0E-08
sp|P71355|Y663_HAEIN Uncharacterized ABC transporter ATP-binding protein HI_0663 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=HI_0663 PE=3 SV=1 480 651 9.0E-08
sp|Q9FHF1|AB7B_ARATH ABC transporter B family member 7 OS=Arabidopsis thaliana GN=ABCB7 PE=3 SV=1 469 648 1.0E-07
sp|P33527|MRP1_HUMAN Multidrug resistance-associated protein 1 OS=Homo sapiens GN=ABCC1 PE=1 SV=3 480 637 1.0E-07
sp|Q6GKG3|PHNC_STAAR Phosphonates import ATP-binding protein PhnC OS=Staphylococcus aureus (strain MRSA252) GN=phnC PE=3 SV=1 464 670 1.0E-07
sp|Q02ME3|METN1_PSEAB Methionine import ATP-binding protein MetN 1 OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=metN1 PE=3 SV=1 474 656 1.0E-07
sp|Q07UI9|UGPC_RHOP5 sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Rhodopseudomonas palustris (strain BisA53) GN=ugpC PE=3 SV=1 464 626 1.0E-07
sp|Q9HX79|TAUB_PSEAE Taurine import ATP-binding protein TauB OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=tauB PE=3 SV=1 478 650 1.0E-07
sp|O14286|ATM1_SCHPO Iron-sulfur clusters transporter atm1, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=atm1 PE=3 SV=2 473 658 1.0E-07
sp|O88563|MRP3_RAT Canalicular multispecific organic anion transporter 2 OS=Rattus norvegicus GN=Abcc3 PE=1 SV=1 480 667 1.0E-07
sp|A1B9Q7|UGPC_PARDP sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Paracoccus denitrificans (strain Pd 1222) GN=ugpC PE=3 SV=1 476 650 1.0E-07
sp|Q9CEW8|PSTB1_LACLA Phosphate import ATP-binding protein PstB 1 OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=pstB1 PE=3 SV=1 495 653 1.0E-07
sp|Q2SZW0|MSBA_BURTA Lipid A export ATP-binding/permease protein MsbA OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=msbA PE=3 SV=1 418 666 1.0E-07
sp|P47546|Y304_MYCGE Putative ABC transporter ATP-binding protein MG304 OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=MG304 PE=3 SV=1 479 650 1.0E-07
sp|P23702|LTXB_AGGAC Leukotoxin export ATP-binding protein LtxB OS=Aggregatibacter actinomycetemcomitans GN=ltxB PE=1 SV=1 440 665 1.0E-07
sp|Q9LJX0|AB19B_ARATH ABC transporter B family member 19 OS=Arabidopsis thaliana GN=ABCB19 PE=1 SV=1 463 653 1.0E-07
sp|Q6F9P2|METN2_ACIAD Methionine import ATP-binding protein MetN 2 OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=metN2 PE=3 SV=1 495 651 1.0E-07
sp|Q31VE6|NIKE_SHIBS Nickel import ATP-binding protein NikE OS=Shigella boydii serotype 4 (strain Sb227) GN=nikE PE=3 SV=1 483 674 1.0E-07
sp|Q4UJW5|ZNUC_RICFE Zinc import ATP-binding protein ZnuC OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=znuC PE=3 SV=1 480 650 1.0E-07
sp|Q0K998|UGPC_CUPNH sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=ugpC PE=3 SV=1 479 650 1.0E-07
sp|P21441|MDR_LEITA Multidrug resistance protein OS=Leishmania tarentolae GN=PGPA PE=3 SV=2 430 626 1.0E-07
sp|Q46ZM0|UGPC_CUPPJ sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=ugpC PE=3 SV=1 479 650 1.0E-07
sp|Q1R5D8|NIKE_ECOUT Nickel import ATP-binding protein NikE OS=Escherichia coli (strain UTI89 / UPEC) GN=nikE PE=3 SV=1 483 679 1.0E-07
sp|Q8FCM9|NIKE_ECOL6 Nickel import ATP-binding protein NikE OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=nikE PE=3 SV=1 483 679 1.0E-07
sp|Q0TBX8|NIKE_ECOL5 Nickel import ATP-binding protein NikE OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=nikE PE=3 SV=1 483 679 1.0E-07
sp|Q54EK2|ABCC7_DICDI ABC transporter C family member 7 OS=Dictyostelium discoideum GN=abcC7 PE=3 SV=1 393 626 1.0E-07
sp|P94374|YXLF_BACSU Uncharacterized ABC transporter ATP-binding protein YxlF OS=Bacillus subtilis (strain 168) GN=yxlF PE=2 SV=1 480 626 1.0E-07
sp|Q142P6|MSBA_BURXL Lipid A export ATP-binding/permease protein MsbA OS=Burkholderia xenovorans (strain LB400) GN=msbA PE=3 SV=1 447 671 1.0E-07
sp|Q9SGY1|AB10B_ARATH ABC transporter B family member 10 OS=Arabidopsis thaliana GN=ABCB10 PE=1 SV=2 490 661 2.0E-07
sp|Q54BT3|ABCB2_DICDI ABC transporter B family member 2 OS=Dictyostelium discoideum GN=abcB2 PE=3 SV=1 479 653 2.0E-07
sp|Q8HXQ5|MRP1_BOVIN Multidrug resistance-associated protein 1 OS=Bos taurus GN=ABCC1 PE=2 SV=1 477 665 2.0E-07
sp|O88563|MRP3_RAT Canalicular multispecific organic anion transporter 2 OS=Rattus norvegicus GN=Abcc3 PE=1 SV=1 474 665 2.0E-07
sp|Q54V86|ABCCD_DICDI ABC transporter C family member 13 OS=Dictyostelium discoideum GN=abcC13 PE=3 SV=1 479 670 2.0E-07
sp|Q58762|WTPC_METJA Molybdate/tungstate import ATP-binding protein WtpC OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=wtpC PE=3 SV=1 477 650 2.0E-07
sp|Q89WG0|UGPC_BRADU sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=ugpC PE=3 SV=1 480 626 2.0E-07
sp|B2RX12|MRP3_MOUSE Canalicular multispecific organic anion transporter 2 OS=Mus musculus GN=Abcc3 PE=1 SV=1 480 637 2.0E-07
sp|Q6XYZ4|ECFA1_SPIKU Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Spiroplasma kunkelii GN=ecfA1 PE=3 SV=1 474 650 2.0E-07
sp|Q8U3E0|Y528_PYRFU Putative ABC transporter ATP-binding protein PF0528 OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=PF0528 PE=3 SV=1 479 650 2.0E-07
sp|A7A063|NFT1_YEAS7 ABC transporter NFT1 OS=Saccharomyces cerevisiae (strain YJM789) GN=NFT1 PE=3 SV=1 527 654 2.0E-07
sp|Q9WYC4|Y288_THEMA Uncharacterized ABC transporter ATP-binding protein TM_0288 OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=TM_0288 PE=1 SV=1 479 667 2.0E-07
sp|C8ZCR2|NFT1_YEAS8 ABC transporter NFT1 OS=Saccharomyces cerevisiae (strain Lalvin EC1118 / Prise de mousse) GN=NFT1 PE=3 SV=1 527 654 2.0E-07
sp|P0CE70|NFT1_YEASX ABC transporter NFT1 OS=Saccharomyces cerevisiae GN=NFT1 PE=3 SV=1 527 654 2.0E-07
sp|P0CE68|NFT1_YEAST ABC transporter NFT1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NFT1 PE=3 SV=1 527 654 2.0E-07
sp|Q1MAL7|CCMA_RHIL3 Cytochrome c biogenesis ATP-binding export protein CcmA OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=ccmA PE=3 SV=1 477 640 2.0E-07
sp|Q98G42|UGPC_RHILO sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Rhizobium loti (strain MAFF303099) GN=ugpC PE=3 SV=1 479 661 2.0E-07
sp|P29959|CCMA_RHOCB Cytochrome c biogenesis ATP-binding export protein CcmA OS=Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003) GN=ccmA PE=3 SV=1 467 633 2.0E-07
sp|Q32AQ1|NIKE_SHIDS Nickel import ATP-binding protein NikE OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=nikE PE=3 SV=1 483 674 2.0E-07
sp|Q736E0|SSUB_BACC1 Aliphatic sulfonates import ATP-binding protein SsuB OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=ssuB PE=3 SV=1 479 650 2.0E-07
sp|P9WQJ0|Y1273_MYCTO Uncharacterized ABC transporter ATP-binding protein MT1311 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT1311 PE=3 SV=1 474 673 2.0E-07
sp|P0A4W5|Y1304_MYCBO Uncharacterized ABC transporter ATP-binding protein Mb1304c OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=Mb1304c PE=3 SV=1 474 673 2.0E-07
sp|P9WQJ1|Y1273_MYCTU Uncharacterized ABC transporter ATP-binding protein Rv1273c OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv1273c PE=1 SV=1 474 673 2.0E-07
sp|Q88RB3|METN2_PSEPK Methionine import ATP-binding protein MetN 2 OS=Pseudomonas putida (strain KT2440) GN=metN2 PE=3 SV=1 480 660 2.0E-07
sp|Q9VL32|SUR_DROME ATP-binding cassette sub-family C member Sur OS=Drosophila melanogaster GN=Sur PE=1 SV=4 490 629 2.0E-07
sp|P70864|NDVA_BARBA Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Bartonella bacilliformis GN=ndvA PE=3 SV=2 474 671 2.0E-07
sp|P44785|METN_HAEIN Methionine import ATP-binding protein MetN OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=metN PE=3 SV=1 483 671 2.0E-07
sp|Q5WJP0|METN2_BACSK Methionine import ATP-binding protein MetN 2 OS=Bacillus clausii (strain KSM-K16) GN=metN2 PE=3 SV=1 480 671 2.0E-07
sp|P36371|TAP2_MOUSE Antigen peptide transporter 2 OS=Mus musculus GN=Tap2 PE=1 SV=1 403 671 2.0E-07
sp|P44513|FBPC2_HAEIN Fe(3+) ions import ATP-binding protein FbpC 2 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=fbpC2 PE=1 SV=1 475 652 2.0E-07
sp|Q57554|Y089_METJA Uncharacterized ABC transporter ATP-binding protein MJ0089 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ0089 PE=3 SV=1 479 654 2.0E-07
sp|Q9M1Q9|AB21B_ARATH ABC transporter B family member 21 OS=Arabidopsis thaliana GN=ABCB21 PE=1 SV=2 479 671 3.0E-07
sp|Q9M0M2|AB9B_ARATH ABC transporter B family member 9 OS=Arabidopsis thaliana GN=ABCB9 PE=3 SV=2 482 651 5.0E-07
sp|Q28689|MRP2_RABIT Canalicular multispecific organic anion transporter 1 OS=Oryctolagus cuniculus GN=ABCC2 PE=2 SV=1 475 638 5.0E-07
sp|O80725|AB4B_ARATH ABC transporter B family member 4 OS=Arabidopsis thaliana GN=ABCB4 PE=1 SV=1 463 671 6.0E-07
sp|Q8ST87|ABCCA_DICDI ABC transporter C family member 10 OS=Dictyostelium discoideum GN=abcC10 PE=3 SV=1 477 651 6.0E-07
sp|Q54U44|ABCCC_DICDI ABC transporter C family member 12 OS=Dictyostelium discoideum GN=abcC12 PE=3 SV=1 477 651 6.0E-07
sp|B2RX12|MRP3_MOUSE Canalicular multispecific organic anion transporter 2 OS=Mus musculus GN=Abcc3 PE=1 SV=1 474 665 6.0E-07
sp|Q864R9|MRP1_MACFA Multidrug resistance-associated protein 1 OS=Macaca fascicularis GN=ABCC1 PE=2 SV=1 480 637 7.0E-07
sp|Q54V86|ABCCD_DICDI ABC transporter C family member 13 OS=Dictyostelium discoideum GN=abcC13 PE=3 SV=1 393 651 9.0E-07
sp|Q00449|MDR49_DROME Multidrug resistance protein homolog 49 OS=Drosophila melanogaster GN=Mdr49 PE=2 SV=2 474 653 1.0E-06
sp|Q9LSJ5|AB18B_ARATH ABC transporter B family member 18 OS=Arabidopsis thaliana GN=ABCB18 PE=3 SV=1 483 697 1.0E-06
sp|O15438|MRP3_HUMAN Canalicular multispecific organic anion transporter 2 OS=Homo sapiens GN=ABCC3 PE=1 SV=3 474 665 1.0E-06
sp|Q9LJX0|AB19B_ARATH ABC transporter B family member 19 OS=Arabidopsis thaliana GN=ABCB19 PE=1 SV=1 452 651 2.0E-06
sp|Q92887|MRP2_HUMAN Canalicular multispecific organic anion transporter 1 OS=Homo sapiens GN=ABCC2 PE=1 SV=3 474 651 3.0E-06
sp|O15439|MRP4_HUMAN Multidrug resistance-associated protein 4 OS=Homo sapiens GN=ABCC4 PE=1 SV=3 473 651 5.0E-06
sp|Q9LSJ8|AB16B_ARATH ABC transporter B family member 16 OS=Arabidopsis thaliana GN=ABCB16 PE=2 SV=1 483 696 5.0E-06
sp|Q6YUU5|MDR_ORYSJ Putative multidrug resistance protein OS=Oryza sativa subsp. japonica GN=Os02g0190300 PE=3 SV=1 483 653 8.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005524 ATP binding Yes
GO:0140359 ABC-type transporter activity Yes
GO:0055085 transmembrane transport Yes
GO:0016021 integral component of membrane Yes
GO:0051234 establishment of localization No
GO:0140657 ATP-dependent activity No
GO:0051179 localization No
GO:0030554 adenyl nucleotide binding No
GO:1901363 heterocyclic compound binding No
GO:0032559 adenyl ribonucleotide binding No
GO:0097159 organic cyclic compound binding No
GO:0022804 active transmembrane transporter activity No
GO:0009987 cellular process No
GO:0097367 carbohydrate derivative binding No
GO:0006810 transport No
GO:0036094 small molecule binding No
GO:0032553 ribonucleotide binding No
GO:0031224 intrinsic component of membrane No
GO:0032555 purine ribonucleotide binding No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0017076 purine nucleotide binding No
GO:0043167 ion binding No
GO:0042626 ATPase-coupled transmembrane transporter activity No
GO:0110165 cellular anatomical entity No
GO:0005575 cellular_component No
GO:0003674 molecular_function No
GO:1901265 nucleoside phosphate binding No
GO:0043168 anion binding No
GO:0008150 biological_process No
GO:0005488 binding No
GO:0000166 nucleotide binding No
GO:0005215 transporter activity No
GO:0015399 primary active transmembrane transporter activity No
GO:0022857 transmembrane transporter activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 57 0.5

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|1628
MASQSKLGRLLAGERTIRTMVADLTRLYLANRSRISRAVWITLLVALVNRVRNAVSEQKAASAHDAAQRAARRGT
VATDGEKPRAKVALDRQFFRSLMRLLRIVVPEWRSREASLLFSHSFFLVLRTLISLRVAEMDGAIVKALVKGNGR
EFLKRILGWMLIAVPATFTNSMLSYHQAQLSLKYRTRLTQHIHDNYLSQLTFYGISALDDRIKNPDQLIAVDVSK
FSNSLAELYSNLAKPILDMTIYTYSLSRSVGGEGVIFMSLLVQLSANVMRVLTPPFGKYVADEARLEGEFRFQHS
RLIDYGEEVALYGGHEAEKDTLDKGYFTLIKHVNYILRRRFYHGFMEDFVIKYFWGALGLLLCSVPVFVKMPGQA
VMNMGDRTESFVTNRRMLLSASDAFGRIMFSYREIMELAGYTSRVASLLDVMADIRAGRFQKKLVSSSGTEGNEA
VLQGRGTVHESEDITFIDVPIVSPNGDVLVQALSFSLKHGDHLLVVGPNGCGKSSLFRILGGLWPVYGGTVYKPP
FHAIFYIPQRPYLSRGSLRQQVIYPDSLRQMRAKGVTDADLLSMLRLLGLEHLVDLYDEGWDAEAEWRDVLSGGL
QQRVAMARLFYHRPKYAILDECTSSVTLETEKVMYDKAKALGVTLMTVSHRRSLWKYHSHILQFDGQGRYVFTKL
DAERRLKLEDEREELEVRLRQVPELQRRLQELETSA*
Coding >Ophun1|1628
ATGGCTTCTCAGTCCAAGCTGGGCCGTCTGCTGGCGGGCGAGCGCACCATCCGCACCATGGTCGCCGACCTGACG
AGACTCTACCTCGCCAACCGAAGCCGCATCTCGCGCGCCGTCTGGATAACGCTGCTGGTGGCGCTGGTCAATCGC
GTCCGCAACGCCGTCTCGGAGCAGAAGGCGGCCTCGGCTCACGATGCTGCTCAGCGGGCGGCTCGGCGCGGAACC
GTCGCGACGGACGGGGAGAAGCCGAGGGCCAAGGTTGCGCTGGATCGCCAGTTTTTCCGCTCGTTGATGAGGCTT
TTGCGGATTGTGGTTCCCGAGTGGAGGTCGAGGGAGGCGAGCTTGCTGTTTAGCCATAGCTTCTTTCTGGTGTTG
AGGACGCTGATCAGCTTGCGGGTTGCCGAGATGGATGGTGCTATTGTCAAGGCCTTGGTCAAGGGGAATGGGAGG
GAGTTTCTCAAGAGGATTCTTGGCTGGATGCTTATTGCTGTTCCCGCTACCTTTACCAACTCGATGCTGTCGTAT
CATCAGGCACAGCTGTCGCTCAAGTACCGGACCAGACTCACGCAGCACATCCACGACAACTACCTTTCTCAGCTG
ACCTTTTACGGCATCTCGGCACTCGACGACCGGATAAAGAACCCGGACCAGCTCATTGCCGTCGACGTGTCCAAG
TTCTCCAACAGCCTGGCCGAGCTGTACAGCAACCTGGCCAAGCCCATCCTCGACATGACCATCTACACCTACTCC
CTCTCCCGCAGCGTCGGCGGCGAGGGCGTCATCTTCATGTCCCTCCTCGTCCAGCTATCAGCCAACGTGATGCGC
GTGCTGACCCCGCCCTTTGGAAAGTACGTCGCCGACGAGGCCCGTCTAGAGGGCGAGTTCCGCTTCCAGCACTCG
CGCCTCATCGACTACGGCGAAGAGGTGGCCCTCTACGGCGGCCACGAGGCCGAAAAGGACACGCTCGACAAGGGA
TACTTCACCCTCATCAAGCACGTCAACTACATCCTCCGCCGCCGCTTCTACCACGGCTTCATGGAGGATTTCGTC
ATCAAGTACTTCTGGGGCGCGCTGGGCCTCCTGCTGTGCAGCGTGCCCGTCTTCGTCAAGATGCCGGGGCAGGCA
GTCATGAACATGGGCGACCGGACCGAGTCGTTTGTTACCAACCGTCGCATGCTGCTGTCGGCGTCGGATGCCTTT
GGTCGTATCATGTTTTCCTATCGTGAGATTATGGAGCTGGCTGGTTATACCTCGCGCGTGGCTTCCTTGCTCGAC
GTCATGGCTGATATTCGGGCTGGCCGCTTTCAGAAGAAGCTGGTTTCGTCGTCGGGGACTGAGGGGAATGAGGCT
GTGCTTCAGGGGAGGGGGACGGTCCACGAGAGCGAGGACATAACTTTTATCGACGTTCCCATCGTCTCCCCCAAC
GGCGACGTTCTCGTCCAGGCCCTCTCCTTCTCCCTCAAGCACGGAGACCACCTCCTCGTCGTCGGCCCCAACGGC
TGCGGCAAGTCGTCCCTCTTCCGCATCCTCGGCGGCCTATGGCCCGTCTACGGAGGCACCGTCTACAAGCCCCCC
TTCCACGCCATCTTCTACATCCCCCAGCGGCCGTACCTCTCCCGCGGCTCCCTCCGGCAGCAGGTCATCTACCCG
GACTCCCTGCGGCAGATGCGGGCCAAGGGCGTCACCGACGCCGACCTGCTCTCCATGCTCCGTCTCCTCGGGCTC
GAGCACCTCGTCGACCTGTACGACGAAGGCTGGGACGCAGAGGCCGAGTGGAGGGACGTCCTCTCAGGCGGTCTG
CAGCAGCGAGTCGCCATGGCCCGCCTCTTCTACCATCGGCCCAAGTACGCCATCCTCGACGAGTGCACGAGCAGC
GTCACGCTCGAGACGGAAAAGGTCATGTACGACAAGGCCAAGGCGCTGGGGGTGACGCTCATGACCGTCAGTCAC
CGGAGGAGCCTGTGGAAGTACCACAGCCATATCCTACAGTTTGACGGGCAGGGCCGCTATGTGTTTACCAAGCTG
GATGCCGAGAGACGGCTGAAGCTCGAGGATGAGAGGGAGGAGTTGGAGGTGAGACTGAGGCAGGTTCCTGAGTTG
CAGAGGAGGTTGCAGGAGCTGGAGACTTCTGCTTAG
Transcript >Ophun1|1628
ATGGCTTCTCAGTCCAAGCTGGGCCGTCTGCTGGCGGGCGAGCGCACCATCCGCACCATGGTCGCCGACCTGACG
AGACTCTACCTCGCCAACCGAAGCCGCATCTCGCGCGCCGTCTGGATAACGCTGCTGGTGGCGCTGGTCAATCGC
GTCCGCAACGCCGTCTCGGAGCAGAAGGCGGCCTCGGCTCACGATGCTGCTCAGCGGGCGGCTCGGCGCGGAACC
GTCGCGACGGACGGGGAGAAGCCGAGGGCCAAGGTTGCGCTGGATCGCCAGTTTTTCCGCTCGTTGATGAGGCTT
TTGCGGATTGTGGTTCCCGAGTGGAGGTCGAGGGAGGCGAGCTTGCTGTTTAGCCATAGCTTCTTTCTGGTGTTG
AGGACGCTGATCAGCTTGCGGGTTGCCGAGATGGATGGTGCTATTGTCAAGGCCTTGGTCAAGGGGAATGGGAGG
GAGTTTCTCAAGAGGATTCTTGGCTGGATGCTTATTGCTGTTCCCGCTACCTTTACCAACTCGATGCTGTCGTAT
CATCAGGCACAGCTGTCGCTCAAGTACCGGACCAGACTCACGCAGCACATCCACGACAACTACCTTTCTCAGCTG
ACCTTTTACGGCATCTCGGCACTCGACGACCGGATAAAGAACCCGGACCAGCTCATTGCCGTCGACGTGTCCAAG
TTCTCCAACAGCCTGGCCGAGCTGTACAGCAACCTGGCCAAGCCCATCCTCGACATGACCATCTACACCTACTCC
CTCTCCCGCAGCGTCGGCGGCGAGGGCGTCATCTTCATGTCCCTCCTCGTCCAGCTATCAGCCAACGTGATGCGC
GTGCTGACCCCGCCCTTTGGAAAGTACGTCGCCGACGAGGCCCGTCTAGAGGGCGAGTTCCGCTTCCAGCACTCG
CGCCTCATCGACTACGGCGAAGAGGTGGCCCTCTACGGCGGCCACGAGGCCGAAAAGGACACGCTCGACAAGGGA
TACTTCACCCTCATCAAGCACGTCAACTACATCCTCCGCCGCCGCTTCTACCACGGCTTCATGGAGGATTTCGTC
ATCAAGTACTTCTGGGGCGCGCTGGGCCTCCTGCTGTGCAGCGTGCCCGTCTTCGTCAAGATGCCGGGGCAGGCA
GTCATGAACATGGGCGACCGGACCGAGTCGTTTGTTACCAACCGTCGCATGCTGCTGTCGGCGTCGGATGCCTTT
GGTCGTATCATGTTTTCCTATCGTGAGATTATGGAGCTGGCTGGTTATACCTCGCGCGTGGCTTCCTTGCTCGAC
GTCATGGCTGATATTCGGGCTGGCCGCTTTCAGAAGAAGCTGGTTTCGTCGTCGGGGACTGAGGGGAATGAGGCT
GTGCTTCAGGGGAGGGGGACGGTCCACGAGAGCGAGGACATAACTTTTATCGACGTTCCCATCGTCTCCCCCAAC
GGCGACGTTCTCGTCCAGGCCCTCTCCTTCTCCCTCAAGCACGGAGACCACCTCCTCGTCGTCGGCCCCAACGGC
TGCGGCAAGTCGTCCCTCTTCCGCATCCTCGGCGGCCTATGGCCCGTCTACGGAGGCACCGTCTACAAGCCCCCC
TTCCACGCCATCTTCTACATCCCCCAGCGGCCGTACCTCTCCCGCGGCTCCCTCCGGCAGCAGGTCATCTACCCG
GACTCCCTGCGGCAGATGCGGGCCAAGGGCGTCACCGACGCCGACCTGCTCTCCATGCTCCGTCTCCTCGGGCTC
GAGCACCTCGTCGACCTGTACGACGAAGGCTGGGACGCAGAGGCCGAGTGGAGGGACGTCCTCTCAGGCGGTCTG
CAGCAGCGAGTCGCCATGGCCCGCCTCTTCTACCATCGGCCCAAGTACGCCATCCTCGACGAGTGCACGAGCAGC
GTCACGCTCGAGACGGAAAAGGTCATGTACGACAAGGCCAAGGCGCTGGGGGTGACGCTCATGACCGTCAGTCAC
CGGAGGAGCCTGTGGAAGTACCACAGCCATATCCTACAGTTTGACGGGCAGGGCCGCTATGTGTTTACCAAGCTG
GATGCCGAGAGACGGCTGAAGCTCGAGGATGAGAGGGAGGAGTTGGAGGTGAGACTGAGGCAGGTTCCTGAGTTG
CAGAGGAGGTTGCAGGAGCTGGAGACTTCTGCTTAG
Gene >Ophun1|1628
ATGGCTTCTCAGTCCAAGCTGGGCCGTCTGCTGGCGGGCGAGCGCACCATCCGCACCATGGTCGCCGACCTGACG
AGACTCTACCTCGCCAACCGAAGCCGCATCTCGCGCGCCGTCTGGATAACGCTGCTGGTGGCGCTGGTCAATCGC
GTCCGCAACGCCGTCTCGGAGCAGAAGGCGGCCTCGGCTCACGATGCTGCTCAGCGGGCGGCTCGGCGCGGAACC
GTCGCGACGGACGGGGAGAAGCCGAGGGCCAAGGTTGCGCTGGATCGCCAGTTTTTCCGCTCGTTGATGAGGCTT
TTGCGGATTGTGGTTCCCGAGTGGAGGTCGAGGGAGGCGAGCTTGCTGTTTAGCCATAGCTTCTTTCTGGTGTTG
AGGACGCTGATCAGCTTGCGGGTTGCCGAGATGGATGGTGCTATTGTCAAGGCCTTGGTCAAGGGGAATGGGAGG
GAGTTTCTCAAGAGGATTCTTGGCTGGATGCTTATTGCTGTTCCCGCTACCTTTACCAACTCGATGGTGAGAGCT
GTCGTCTGCTTTGCTTAGGCGGGATTCGCATATTGACGAGATGGGGGTTAGCTGTCGTATCATCAGGCACAGCTG
TCGCTCAAGTACCGGACCAGACTCACGCAGCACATCCACGACAACTACCTTTCTCAGCTGACCTTTTACGGCATC
TCGGCACTCGACGACCGGATAAAGAACCCGGACCAGCTCATTGCCGTCGACGTGTCCAAGTTCTCCAACAGCCTG
GCCGAGCTGTACAGCAACCTGGCCAAGCCCATCCTCGACATGGTACGCCGTCATCCATTGCGTTTCAACATGATA
TCTCTCGGGCTGACTTCTTCACCCAGACCATCTACACCTACTCCCTCTCCCGCAGCGTCGGCGGCGAGGGCGTCA
TCTTCATGTCCCTCCTCGTCCAGCTATCAGCCAACGTGATGCGCGTGCTGACCCCGCCCTTTGGAAAGTACGTCG
CCGACGAGGCCCGTCTAGAGGGCGAGTTCCGCTTCCAGCACTCGCGCCTCATCGACTACGGCGAAGAGGTGGCCC
TCTACGGCGGCCACGAGGCCGAAAAGGACACGCTCGACAAGGGATACTTCACCCTCATCAAGCACGTCAACTACA
TCCTCCGCCGCCGCTTCTACCACGGCTTCATGGAGGATTTCGTCATCAAGTACTTCTGGGGCGCGCTGGGCCTCC
TGCTGTGCAGCGTGCCCGTCTTCGTCAAGATGCCGGGGCAGGCAGTCATGAACATGGGCGACCGGACCGAGTCGT
TTGTTACCAACCGTCGCATGCTGCTGTCGGCGTCGGATGCCTTTGGTCGTATCATGTTTTCCTATCGTGAGATTA
TGGAGCTGGCTGGTTATACCTCGCGCGTGGCTTCCTTGCTCGACGTCATGGCTGATATTCGGGCTGGCCGCTTTC
AGAAGAAGCTGGTTTCGTCGTCGGGGACTGAGGGGAATGAGGCTGTGCTTCAGGGGAGGGGGACGGTCCACGAGA
GCGAGGACATAACTTTTATCGACGTGTACGTCTCTGTTTCTCTCTGTCACTCTCTCTGTCACTCTCTCTGTCACT
CTCTCTTCTCTCTCTCTCTCTCTCTCTATCTGTCACTCTCTGTCACTCTCTGTCTGTCACTGTTTCTCTCCCCCC
CTCTCCCCCCCTCTCGCCTGTACTCCCGCTGACTTCCCTTCAGTCCCATCGTCTCCCCCAACGGCGACGTTCTCG
TCCAGGCCCTCTCCTTCTCCCTCAAGCACGGAGACCACCTCCTCGTCGTCGGCCCCAACGGCTGCGGCAAGTCGT
CCCTCTTCCGCATCCTCGGCGGCCTATGGCCCGTCTACGGAGGCACCGTCTACAAGCCCCCCTTCCACGCCATCT
TCTACATCCCCCAGCGGCCGTACCTCTCCCGCGGCTCCCTCCGGCAGCAGGTCATCTACCCGGACTCCCTGCGGC
AGATGCGGGCCAAGGGCGTCACCGACGCCGACCTGCTCTCCATGCTCCGTCTCCTCGGGCTCGAGCACCTCGTCG
ACCTGTACGACGAAGGCTGGGACGCAGAGGCCGAGTGGAGGGACGTCCTCTCAGGCGGTCTGCAGCAGCGAGTCG
CCATGGCCCGCCTCTTCTACCATCGGCCCAAGTACGCCATCCTCGACGAGTGCACGAGCAGCGTCACGCTCGAGA
CGGAAAAGGTCATGTACGACAAGGCCAAGGCGCTGGGGGTGACGCTCATGACCGTCAGTCACCGGAGGAGCCTGT
GGAAGTACCACAGCCATATCCTACAGTTTGACGGGCAGGGCCGCTATGTGTTTACCAAGCTGGATGCCGAGAGAC
GGCTGAAGCTCGAGGATGAGAGGGAGGAGTTGGAGGTGAGACTGAGGCAGGTTCCTGAGTTGCAGAGGAGGTTGC
AGGAGCTGGAGACTTCTGCTTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail