Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|1627
Gene name
LocationContig_17:39644..39890
Strand-
Gene length (bp)246
Transcript length (bp)246
Coding sequence length (bp)246
Protein length (aa) 82

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05207 zf-CSL CSL zinc finger 1.6E-22 12 66

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q4I9U7|DPH3_GIBZE Diphthamide biosynthesis protein 3 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=DPH3 PE=3 SV=1 3 72 1.0E-31
sp|Q4WPU8|DPH3_ASPFU Diphthamide biosynthesis protein 3 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=dph3 PE=3 SV=1 8 68 9.0E-31
sp|P0C0V4|DPH3_EMENI Diphthamide biosynthesis protein 3 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=dph3 PE=3 SV=1 8 76 9.0E-30
sp|Q7SC15|DPH3_NEUCR Diphthamide biosynthesis protein 3 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=dph-3 PE=3 SV=1 5 72 1.0E-29
sp|Q6CMG4|DPH3_KLULA Diphthamide biosynthesis protein 3 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=DPH3 PE=3 SV=1 11 66 1.0E-25
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q4I9U7|DPH3_GIBZE Diphthamide biosynthesis protein 3 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=DPH3 PE=3 SV=1 3 72 1.0E-31
sp|Q4WPU8|DPH3_ASPFU Diphthamide biosynthesis protein 3 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=dph3 PE=3 SV=1 8 68 9.0E-31
sp|P0C0V4|DPH3_EMENI Diphthamide biosynthesis protein 3 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=dph3 PE=3 SV=1 8 76 9.0E-30
sp|Q7SC15|DPH3_NEUCR Diphthamide biosynthesis protein 3 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=dph-3 PE=3 SV=1 5 72 1.0E-29
sp|Q6CMG4|DPH3_KLULA Diphthamide biosynthesis protein 3 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=DPH3 PE=3 SV=1 11 66 1.0E-25
sp|Q6BTW5|DPH3_DEBHA Diphthamide biosynthesis protein 3 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=DPH3 PE=3 SV=1 10 66 7.0E-25
sp|Q74Z32|DPH3_ASHGO Diphthamide biosynthesis protein 3 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=DPH3 PE=3 SV=1 10 67 2.0E-24
sp|Q6C0G3|DPH3_YARLI Diphthamide biosynthesis protein 3 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=DPH3 PE=3 SV=1 8 66 4.0E-24
sp|Q3E840|DPH3_YEAST Diphthamide biosynthesis protein 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KTI11 PE=1 SV=1 11 66 1.0E-22
sp|P0CN22|DPH3_CRYNJ Diphthamide biosynthesis protein 3 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=DPH3 PE=3 SV=1 11 66 4.0E-22
sp|P0CN23|DPH3_CRYNB Diphthamide biosynthesis protein 3 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=DPH3 PE=3 SV=1 11 66 4.0E-22
sp|Q6FXS6|DPH3_CANGA Diphthamide biosynthesis protein 3 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=DPH3 PE=3 SV=1 8 66 1.0E-21
sp|Q9UT33|DPH3_SCHPO Diphthamide biosynthesis protein 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dph3 PE=3 SV=1 8 66 3.0E-21
sp|Q4P8G2|DPH3_USTMA Diphthamide biosynthesis protein 3 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=DPH3 PE=3 SV=1 8 68 8.0E-21
sp|Q6VUC1|DPH3_CRIGR DPH3 homolog OS=Cricetulus griseus GN=DPH3 PE=3 SV=1 10 77 1.0E-17
sp|Q5R7N8|DPH3_PONAB DPH3 homolog OS=Pongo abelii GN=DPH3 PE=3 SV=1 10 77 2.0E-17
sp|Q4R312|DPH3_MACFA DPH3 homolog OS=Macaca fascicularis GN=DPH3 PE=3 SV=1 10 77 2.0E-17
sp|Q96FX2|DPH3_HUMAN DPH3 homolog OS=Homo sapiens GN=DPH3 PE=1 SV=1 10 77 2.0E-17
sp|Q8K0W9|DPH3_MOUSE DPH3 homolog OS=Mus musculus GN=Dph3 PE=1 SV=1 10 77 2.0E-17
sp|Q1LZC9|DPH3_BOVIN DPH3 homolog OS=Bos taurus GN=DPH3 PE=3 SV=1 10 77 5.0E-17
sp|Q8STR6|DPH3_ENCCU Diphthamide biosynthesis protein 3 OS=Encephalitozoon cuniculi (strain GB-M1) GN=DPH3 PE=3 SV=1 6 67 2.0E-15
sp|Q9H4G8|DPH3B_HUMAN Putative DPH3 homolog B OS=Homo sapiens GN=DPH3P1 PE=5 SV=1 10 66 3.0E-14
sp|Q21102|DPH3_CAEEL DPH3 homolog OS=Caenorhabditis elegans GN=K01H12.1 PE=3 SV=1 27 66 7.0E-13
sp|Q9VGQ9|DPH3_DROME DPH3 homolog OS=Drosophila melanogaster GN=CG14701 PE=3 SV=1 31 66 5.0E-11
sp|Q54CI5|DPH4_DICDI DPH4 homolog OS=Dictyostelium discoideum GN=dph4 PE=3 SV=1 9 67 6.0E-09
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup5059
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2220
Ophiocordyceps australis map64 (Brazil) OphauB2|1146
Ophiocordyceps camponoti-floridani Ophcf2|05730
Ophiocordyceps camponoti-rufipedis Ophun1|1627 (this protein)
Ophiocordyceps kimflemingae Ophio5|8588
Ophiocordyceps subramaniannii Hirsu2|2782

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|1627
MSTDNDDIPIYDEIEIEDMTFDPALHIYHYPCPCGDRFQIALDDLRDEQDIAVCPSCSLMIRVIFDVVRAPRLDA
RLQSAR*
Coding >Ophun1|1627
ATGTCAACCGACAACGACGACATCCCCATCTACGACGAAATCGAAATCGAAGACATGACCTTTGACCCCGCCCTG
CACATCTACCACTACCCCTGTCCCTGCGGCGACCGCTTCCAAATCGCCCTCGACGACCTCCGCGACGAGCAAGAC
ATTGCCGTCTGTCCCAGCTGCAGCCTGATGATCCGCGTCATCTTCGACGTCGTACGCGCTCCCCGTCTCGACGCC
CGGTTGCAAAGCGCACGCTGA
Transcript >Ophun1|1627
ATGTCAACCGACAACGACGACATCCCCATCTACGACGAAATCGAAATCGAAGACATGACCTTTGACCCCGCCCTG
CACATCTACCACTACCCCTGTCCCTGCGGCGACCGCTTCCAAATCGCCCTCGACGACCTCCGCGACGAGCAAGAC
ATTGCCGTCTGTCCCAGCTGCAGCCTGATGATCCGCGTCATCTTCGACGTCGTACGCGCTCCCCGTCTCGACGCC
CGGTTGCAAAGCGCACGCTGA
Gene >Ophun1|1627
ATGTCAACCGACAACGACGACATCCCCATCTACGACGAAATCGAAATCGAAGACATGACCTTTGACCCCGCCCTG
CACATCTACCACTACCCCTGTCCCTGCGGCGACCGCTTCCAAATCGCCCTCGACGACCTCCGCGACGAGCAAGAC
ATTGCCGTCTGTCCCAGCTGCAGCCTGATGATCCGCGTCATCTTCGACGTCGTACGCGCTCCCCGTCTCGACGCC
CGGTTGCAAAGCGCACGCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail