Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|1625
Gene name
LocationContig_17:33491..36926
Strand+
Gene length (bp)3435
Transcript length (bp)3378
Coding sequence length (bp)3378
Protein length (aa) 1126

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00133 tRNA-synt_1 tRNA synthetases class I (I, L, M and V) 8.8E-08 69 135
PF00133 tRNA-synt_1 tRNA synthetases class I (I, L, M and V) 7.1E-27 225 798
PF09334 tRNA-synt_1g tRNA synthetases class I (M) 1.8E-08 719 801
PF08264 Anticodon_1 Anticodon-binding domain of tRNA ligase 1.6E-09 842 965
PF01406 tRNA-synt_1e tRNA synthetases class I (C) catalytic domain 1.9E-07 712 787

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P10857|SYLC_NEUCR Leucine--tRNA ligase, cytoplasmic OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=leu-6 PE=3 SV=2 1 1125 0.0E+00
sp|Q10490|SYLC_SCHPO Putative leucine--tRNA ligase, cytoplasmic OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=lrs1 PE=1 SV=1 10 1125 0.0E+00
sp|P26637|SYLC_YEAST Leucine--tRNA ligase, cytoplasmic OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CDC60 PE=1 SV=1 24 1125 0.0E+00
sp|Q9P2J5|SYLC_HUMAN Leucine--tRNA ligase, cytoplasmic OS=Homo sapiens GN=LARS PE=1 SV=2 23 1084 0.0E+00
sp|Q8BMJ2|SYLC_MOUSE Leucine--tRNA ligase, cytoplasmic OS=Mus musculus GN=Lars PE=1 SV=2 25 1118 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P10857|SYLC_NEUCR Leucine--tRNA ligase, cytoplasmic OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=leu-6 PE=3 SV=2 1 1125 0.0E+00
sp|Q10490|SYLC_SCHPO Putative leucine--tRNA ligase, cytoplasmic OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=lrs1 PE=1 SV=1 10 1125 0.0E+00
sp|P26637|SYLC_YEAST Leucine--tRNA ligase, cytoplasmic OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CDC60 PE=1 SV=1 24 1125 0.0E+00
sp|Q9P2J5|SYLC_HUMAN Leucine--tRNA ligase, cytoplasmic OS=Homo sapiens GN=LARS PE=1 SV=2 23 1084 0.0E+00
sp|Q8BMJ2|SYLC_MOUSE Leucine--tRNA ligase, cytoplasmic OS=Mus musculus GN=Lars PE=1 SV=2 25 1118 0.0E+00
sp|Q5R614|SYLC_PONAB Leucine--tRNA ligase, cytoplasmic OS=Pongo abelii GN=LARS PE=2 SV=1 23 1084 0.0E+00
sp|Q09996|SYLC_CAEEL Leucine--tRNA ligase OS=Caenorhabditis elegans GN=lrs-1 PE=3 SV=2 25 1120 0.0E+00
sp|F4I116|SYLC_ARATH Leucine--tRNA ligase, cytoplasmic OS=Arabidopsis thaliana GN=At1g09620 PE=1 SV=1 23 1122 0.0E+00
sp|Q54N83|SYLC_DICDI Leucine--tRNA ligase, cytoplasmic OS=Dictyostelium discoideum GN=leuS PE=3 SV=1 26 1120 0.0E+00
sp|Q9YD97|SYL_AERPE Leucine--tRNA ligase OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=leuS PE=3 SV=1 31 935 3.0E-145
sp|Q8NKR7|SYL_THEKO Leucine--tRNA ligase OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=leuS PE=3 SV=2 35 1092 3.0E-126
sp|B6YST9|SYL_THEON Leucine--tRNA ligase OS=Thermococcus onnurineus (strain NA1) GN=leuS PE=3 SV=1 35 1092 2.0E-125
sp|Q8U2E6|SYL_PYRFU Leucine--tRNA ligase OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=leuS PE=3 SV=1 35 1123 1.0E-123
sp|Q8Q054|SYL_METMA Leucine--tRNA ligase OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=leuS PE=3 SV=2 36 1078 3.0E-123
sp|Q8TVM4|SYL_METKA Leucine--tRNA ligase OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=leuS PE=3 SV=1 37 964 7.0E-123
sp|O27552|SYL_METTH Leucine--tRNA ligase OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=leuS PE=1 SV=1 36 1050 5.0E-122
sp|O30250|SYL_ARCFU Leucine--tRNA ligase OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=leuS PE=3 SV=1 36 969 6.0E-122
sp|A3DKS1|SYL_STAMF Leucine--tRNA ligase OS=Staphylothermus marinus (strain ATCC 43588 / DSM 3639 / JCM 9404 / F1) GN=leuS PE=3 SV=1 28 937 1.0E-121
sp|Q8TQD3|SYL_METAC Leucine--tRNA ligase OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=leuS PE=3 SV=1 36 1078 2.0E-120
sp|A6VK04|SYL_METM7 Leucine--tRNA ligase OS=Methanococcus maripaludis (strain C7 / ATCC BAA-1331) GN=leuS PE=3 SV=1 33 1006 2.0E-119
sp|Q9V0B9|SYL_PYRAB Leucine--tRNA ligase OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=leuS PE=3 SV=1 35 1123 3.0E-119
sp|A4FYA3|SYL_METM5 Leucine--tRNA ligase OS=Methanococcus maripaludis (strain C5 / ATCC BAA-1333) GN=leuS PE=3 SV=1 33 1006 3.0E-119
sp|Q6LZD2|SYL_METMP Leucine--tRNA ligase OS=Methanococcus maripaludis (strain S2 / LL) GN=leuS PE=3 SV=1 33 1006 1.0E-118
sp|Q46AW0|SYL_METBF Leucine--tRNA ligase OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=leuS PE=3 SV=1 36 1080 3.0E-118
sp|Q58050|SYL_METJA Leucine--tRNA ligase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=leuS PE=3 SV=2 36 1006 6.0E-116
sp|A6USJ5|SYL_METVS Leucine--tRNA ligase OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=leuS PE=3 SV=1 33 991 2.0E-115
sp|Q970Z6|SYL2_SULTO Leucine--tRNA ligase 2 OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=leuS2 PE=3 SV=2 33 936 2.0E-114
sp|A4YI28|SYL2_METS5 Leucine--tRNA ligase 2 OS=Metallosphaera sedula (strain ATCC 51363 / DSM 5348) GN=leuS2 PE=3 SV=1 28 991 5.0E-114
sp|A6UTK3|SYL_META3 Leucine--tRNA ligase OS=Methanococcus aeolicus (strain Nankai-3 / ATCC BAA-1280) GN=leuS PE=3 SV=1 33 957 3.0E-112
sp|Q4J8J7|SYL2_SULAC Leucine--tRNA ligase 2 OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=leuS2 PE=3 SV=2 34 1093 2.0E-111
sp|Q12WA2|SYL_METBU Leucine--tRNA ligase OS=Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M) GN=leuS PE=3 SV=1 36 997 5.0E-111
sp|Q8ZXT6|SYL_PYRAE Leucine--tRNA ligase OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=leuS PE=3 SV=1 27 964 9.0E-111
sp|O58698|SYL_PYRHO Leucine--tRNA ligase OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=leuS PE=1 SV=1 201 1123 1.0E-109
sp|A0B7B7|SYL_METTP Leucine--tRNA ligase OS=Methanosaeta thermophila (strain DSM 6194 / JCM 14653 / NBRC 101360 / PT) GN=leuS PE=3 SV=1 36 1042 1.0E-108
sp|A4WHK6|SYL_PYRAR Leucine--tRNA ligase OS=Pyrobaculum arsenaticum (strain DSM 13514 / JCM 11321) GN=leuS PE=3 SV=1 33 963 1.0E-106
sp|B1YAS9|SYL_PYRNV Leucine--tRNA ligase OS=Pyrobaculum neutrophilum (strain DSM 2338 / JCM 9278 / V24Sta) GN=leuS PE=3 SV=1 33 964 6.0E-106
sp|A1RTX9|SYL_PYRIL Leucine--tRNA ligase OS=Pyrobaculum islandicum (strain DSM 4184 / JCM 9189 / GEO3) GN=leuS PE=3 SV=1 33 1089 1.0E-105
sp|A8A8T2|SYL_IGNH4 Leucine--tRNA ligase OS=Ignicoccus hospitalis (strain KIN4/I / DSM 18386 / JCM 14125) GN=leuS PE=3 SV=1 65 1069 5.0E-104
sp|O33768|SYL2_SULSO Leucine--tRNA ligase 2 OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=leuS2 PE=3 SV=2 39 1004 4.0E-103
sp|A3MU00|SYL_PYRCJ Leucine--tRNA ligase OS=Pyrobaculum calidifontis (strain JCM 11548 / VA1) GN=leuS PE=3 SV=1 33 991 9.0E-103
sp|Q974N4|SYL1_SULTO Leucine--tRNA ligase 1 OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=leuS1 PE=3 SV=1 39 971 2.0E-99
sp|A4YE96|SYL1_METS5 Leucine--tRNA ligase 1 OS=Metallosphaera sedula (strain ATCC 51363 / DSM 5348) GN=leuS1 PE=3 SV=1 36 1091 2.0E-97
sp|Q9HK31|SYL_THEAC Leucine--tRNA ligase OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=leuS PE=3 SV=1 34 919 4.0E-88
sp|Q97AN8|SYL_THEVO Leucine--tRNA ligase OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=leuS PE=3 SV=1 26 810 7.0E-84
sp|Q4JBP0|SYL1_SULAC Leucine--tRNA ligase 1 OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=leuS1 PE=3 SV=1 31 968 8.0E-81
sp|P58176|SYL1_SULSO Leucine--tRNA ligase 1 OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=leuS1 PE=3 SV=1 31 971 2.0E-80
sp|Q8SRS8|SYLC_ENCCU Probable leucine--tRNA ligase, cytoplasmic OS=Encephalitozoon cuniculi (strain GB-M1) GN=ECU06_0280 PE=3 SV=1 523 881 2.0E-74
sp|C4V8L1|SYLC_NOSCE Probable leucine--tRNA ligase, cytoplasmic OS=Nosema ceranae (strain BRL01) GN=NCER_100842 PE=3 SV=1 547 874 1.0E-72
sp|P61760|SYL_NANEQ Leucine--tRNA ligase OS=Nanoarchaeum equitans (strain Kin4-M) GN=leuS PE=3 SV=1 390 799 7.0E-71
sp|B7XHP6|SYLC_ENTBH Probable leucine--tRNA ligase, cytoplasmic OS=Enterocytozoon bieneusi (strain H348) GN=EBI_21702 PE=3 SV=1 547 815 5.0E-65
sp|C4V8L1|SYLC_NOSCE Probable leucine--tRNA ligase, cytoplasmic OS=Nosema ceranae (strain BRL01) GN=NCER_100842 PE=3 SV=1 74 433 2.0E-48
sp|Q8SRS8|SYLC_ENCCU Probable leucine--tRNA ligase, cytoplasmic OS=Encephalitozoon cuniculi (strain GB-M1) GN=ECU06_0280 PE=3 SV=1 66 348 5.0E-45
sp|B7XHP6|SYLC_ENTBH Probable leucine--tRNA ligase, cytoplasmic OS=Enterocytozoon bieneusi (strain H348) GN=EBI_21702 PE=3 SV=1 63 296 1.0E-42
sp|P61760|SYL_NANEQ Leucine--tRNA ligase OS=Nanoarchaeum equitans (strain Kin4-M) GN=leuS PE=3 SV=1 76 365 1.0E-29
sp|O58698|SYL_PYRHO Leucine--tRNA ligase OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=leuS PE=1 SV=1 35 137 6.0E-13
sp|Q3SSP4|SYV_NITWN Valine--tRNA ligase OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=valS PE=3 SV=1 36 787 3.0E-11
sp|A3DEU0|SYL_CLOTH Leucine--tRNA ligase OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=leuS PE=3 SV=1 704 936 1.0E-10
sp|Q9HMG9|SYV_HALSA Valine--tRNA ligase OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=valS PE=3 SV=1 516 948 2.0E-10
sp|B0R841|SYV_HALS3 Valine--tRNA ligase OS=Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1) GN=valS PE=3 SV=1 516 948 2.0E-10
sp|A6VZE7|SYL_MARMS Leucine--tRNA ligase OS=Marinomonas sp. (strain MWYL1) GN=leuS PE=3 SV=1 696 937 1.0E-09
sp|A6TQK3|SYL_ALKMQ Leucine--tRNA ligase OS=Alkaliphilus metalliredigens (strain QYMF) GN=leuS PE=3 SV=1 751 935 5.0E-09
sp|B8HM05|SYL_CYAP4 Leucine--tRNA ligase OS=Cyanothece sp. (strain PCC 7425 / ATCC 29141) GN=leuS PE=3 SV=1 28 134 6.0E-09
sp|B8CXR8|SYL_HALOH Leucine--tRNA ligase OS=Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562) GN=leuS PE=3 SV=1 749 935 1.0E-08
sp|Q24SP5|SYL_DESHY Leucine--tRNA ligase OS=Desulfitobacterium hafniense (strain Y51) GN=leuS PE=3 SV=1 751 937 1.0E-08
sp|B8FUR3|SYL_DESHD Leucine--tRNA ligase OS=Desulfitobacterium hafniense (strain DCB-2 / DSM 10664) GN=leuS PE=3 SV=1 751 937 1.0E-08
sp|A5GT82|SYL_SYNR3 Leucine--tRNA ligase OS=Synechococcus sp. (strain RCC307) GN=leuS PE=3 SV=1 24 151 2.0E-08
sp|Q1AR71|SYL_RUBXD Leucine--tRNA ligase OS=Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129) GN=leuS PE=3 SV=1 35 134 4.0E-08
sp|Q049B7|SYL_LACDB Leucine--tRNA ligase OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC BAA-365) GN=leuS PE=3 SV=1 710 936 4.0E-08
sp|Q1G971|SYL_LACDA Leucine--tRNA ligase OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / JCM 1002 / NBRC 13953 / NCIMB 11778) GN=leuS PE=3 SV=1 710 936 4.0E-08
sp|B7KCI7|SYL_CYAP7 Leucine--tRNA ligase OS=Cyanothece sp. (strain PCC 7424) GN=leuS PE=3 SV=1 35 132 6.0E-08
sp|Q114V5|SYL_TRIEI Leucine--tRNA ligase OS=Trichodesmium erythraeum (strain IMS101) GN=leuS PE=3 SV=1 34 132 8.0E-08
sp|Q4J8X1|SYV_SULAC Valine--tRNA ligase OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=valS PE=3 SV=1 704 962 9.0E-08
sp|Q6LZP0|SYV_METMP Valine--tRNA ligase OS=Methanococcus maripaludis (strain S2 / LL) GN=valS PE=3 SV=1 29 137 1.0E-07
sp|A1VEL2|SYL_DESVV Leucine--tRNA ligase OS=Desulfovibrio vulgaris subsp. vulgaris (strain DP4) GN=leuS PE=3 SV=1 35 134 1.0E-07
sp|Q72CT7|SYL_DESVH Leucine--tRNA ligase OS=Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) GN=leuS PE=3 SV=1 35 134 1.0E-07
sp|A8MJY6|SYL_ALKOO Leucine--tRNA ligase OS=Alkaliphilus oremlandii (strain OhILAs) GN=leuS PE=3 SV=1 704 935 1.0E-07
sp|Q5FHG5|SYL_EHRRG Leucine--tRNA ligase OS=Ehrlichia ruminantium (strain Gardel) GN=leuS PE=3 SV=1 757 926 1.0E-07
sp|B3WCD5|SYL_LACCB Leucine--tRNA ligase OS=Lactobacillus casei (strain BL23) GN=leuS PE=3 SV=1 710 936 2.0E-07
sp|Q03AT8|SYL_LACC3 Leucine--tRNA ligase OS=Lactobacillus casei (strain ATCC 334) GN=leuS PE=3 SV=1 710 936 2.0E-07
sp|A2BR45|SYL_PROMS Leucine--tRNA ligase OS=Prochlorococcus marinus (strain AS9601) GN=leuS PE=3 SV=1 36 132 2.0E-07
sp|Q5JGN7|SYV_THEKO Valine--tRNA ligase OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=valS PE=3 SV=1 36 134 2.0E-07
sp|P73274|SYL_SYNY3 Leucine--tRNA ligase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=leuS PE=3 SV=1 36 132 2.0E-07
sp|Q31AX4|SYL_PROM9 Leucine--tRNA ligase OS=Prochlorococcus marinus (strain MIT 9312) GN=leuS PE=3 SV=1 36 132 2.0E-07
sp|A4XHE2|SYC_CALS8 Cysteine--tRNA ligase OS=Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331) GN=cysS PE=3 SV=1 713 889 2.0E-07
sp|A8YWU4|SYL_LACH4 Leucine--tRNA ligase OS=Lactobacillus helveticus (strain DPC 4571) GN=leuS PE=3 SV=1 710 936 2.0E-07
sp|Q3AF30|SYL_CARHZ Leucine--tRNA ligase OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=leuS PE=3 SV=1 749 986 3.0E-07
sp|B9MMM6|SYC_CALBD Cysteine--tRNA ligase OS=Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / Z-1320) GN=cysS PE=3 SV=1 713 889 3.0E-07
sp|Q58413|SYV_METJA Valine--tRNA ligase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=valS PE=3 SV=1 30 135 3.0E-07
sp|B1XP90|SYL_SYNP2 Leucine--tRNA ligase OS=Synechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6) GN=leuS PE=3 SV=1 28 151 4.0E-07
sp|B7JYA9|SYL_CYAP8 Leucine--tRNA ligase OS=Cyanothece sp. (strain PCC 8801) GN=leuS PE=3 SV=1 35 132 4.0E-07
sp|A5G677|SYL_GEOUR Leucine--tRNA ligase OS=Geobacter uraniireducens (strain Rf4) GN=leuS PE=3 SV=1 751 935 4.0E-07
sp|A8G4T7|SYL_PROM2 Leucine--tRNA ligase OS=Prochlorococcus marinus (strain MIT 9215) GN=leuS PE=3 SV=1 36 132 4.0E-07
sp|Q97ZK9|SYV_SULSO Valine--tRNA ligase OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=valS PE=3 SV=1 707 943 4.0E-07
sp|Q88XA9|SYL_LACPL Leucine--tRNA ligase OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=leuS PE=3 SV=1 706 936 4.0E-07
sp|A0AJB5|SYL_LISW6 Leucine--tRNA ligase OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=leuS PE=3 SV=1 710 936 4.0E-07
sp|C3PLG3|SYV_RICAE Valine--tRNA ligase OS=Rickettsia africae (strain ESF-5) GN=valS PE=3 SV=1 37 149 4.0E-07
sp|Q9HMG9|SYV_HALSA Valine--tRNA ligase OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=valS PE=3 SV=1 35 167 5.0E-07
sp|B0R841|SYV_HALS3 Valine--tRNA ligase OS=Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1) GN=valS PE=3 SV=1 35 167 5.0E-07
sp|B0C1R1|SYL_ACAM1 Leucine--tRNA ligase OS=Acaryochloris marina (strain MBIC 11017) GN=leuS PE=3 SV=1 28 132 5.0E-07
sp|Q8YS09|SYL_NOSS1 Leucine--tRNA ligase OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=leuS PE=3 SV=1 35 132 5.0E-07
sp|Q3M3A3|SYL_ANAVT Leucine--tRNA ligase OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=leuS PE=3 SV=1 36 132 5.0E-07
sp|C4K2L1|SYV_RICPU Valine--tRNA ligase OS=Rickettsia peacockii (strain Rustic) GN=valS PE=3 SV=1 37 149 5.0E-07
sp|B1WSK6|SYL_CYAA5 Leucine--tRNA ligase OS=Cyanothece sp. (strain ATCC 51142) GN=leuS PE=3 SV=1 36 132 5.0E-07
sp|A3PCW8|SYL_PROM0 Leucine--tRNA ligase OS=Prochlorococcus marinus (strain MIT 9301) GN=leuS PE=3 SV=1 36 132 5.0E-07
sp|A8GVS7|SYV_RICB8 Valine--tRNA ligase OS=Rickettsia bellii (strain OSU 85-389) GN=valS PE=3 SV=1 24 134 6.0E-07
sp|Q1RJ74|SYV_RICBR Valine--tRNA ligase OS=Rickettsia bellii (strain RML369-C) GN=valS PE=3 SV=1 24 134 6.0E-07
sp|Q045L5|SYL_LACGA Leucine--tRNA ligase OS=Lactobacillus gasseri (strain ATCC 33323 / DSM 20243 / JCM 1131 / NCIMB 11718 / AM63) GN=leuS PE=3 SV=1 710 935 6.0E-07
sp|Q92GR9|SYV_RICCN Valine--tRNA ligase OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=valS PE=3 SV=1 37 149 6.0E-07
sp|Q8DH61|SYL_THEEB Leucine--tRNA ligase OS=Thermosynechococcus elongatus (strain BP-1) GN=leuS PE=3 SV=1 36 132 7.0E-07
sp|Q03GG4|SYL_PEDPA Leucine--tRNA ligase OS=Pediococcus pentosaceus (strain ATCC 25745 / 183-1w) GN=leuS PE=3 SV=1 710 936 7.0E-07
sp|B1HXY7|SYL_LYSSC Leucine--tRNA ligase OS=Lysinibacillus sphaericus (strain C3-41) GN=leuS PE=3 SV=1 36 132 8.0E-07
sp|Q24SP5|SYL_DESHY Leucine--tRNA ligase OS=Desulfitobacterium hafniense (strain Y51) GN=leuS PE=3 SV=1 36 134 1.0E-06
sp|B8FUR3|SYL_DESHD Leucine--tRNA ligase OS=Desulfitobacterium hafniense (strain DCB-2 / DSM 10664) GN=leuS PE=3 SV=1 36 134 1.0E-06
sp|Q38VP5|SYL_LACSS Leucine--tRNA ligase OS=Lactobacillus sakei subsp. sakei (strain 23K) GN=leuS PE=3 SV=1 710 993 1.0E-06
sp|A9AZ11|SYL_HERA2 Leucine--tRNA ligase OS=Herpetosiphon aurantiacus (strain ATCC 23779 / DSM 785) GN=leuS PE=3 SV=1 36 134 1.0E-06
sp|Q837N5|SYL_ENTFA Leucine--tRNA ligase OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=leuS PE=3 SV=1 700 936 2.0E-06
sp|Q49YI8|SYL_STAS1 Leucine--tRNA ligase OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=leuS PE=3 SV=1 706 986 2.0E-06
sp|B0TBJ3|SYL_HELMI Leucine--tRNA ligase OS=Heliobacterium modesticaldum (strain ATCC 51547 / Ice1) GN=leuS PE=3 SV=1 36 134 2.0E-06
sp|Q2RWK2|SYC_RHORT Cysteine--tRNA ligase OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) GN=cysS PE=3 SV=1 676 786 2.0E-06
sp|Q67SB4|SYL_SYMTH Leucine--tRNA ligase OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=leuS PE=3 SV=1 28 132 2.0E-06
sp|Q74KS1|SYL_LACJO Leucine--tRNA ligase OS=Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533) GN=leuS PE=3 SV=1 710 935 3.0E-06
sp|B8GV13|SYL_THISH Leucine--tRNA ligase OS=Thioalkalivibrio sulfidiphilus (strain HL-EbGR7) GN=leuS PE=3 SV=1 750 937 3.0E-06
sp|B2G8G2|SYL_LACRJ Leucine--tRNA ligase OS=Lactobacillus reuteri (strain JCM 1112) GN=leuS PE=3 SV=1 696 936 4.0E-06
sp|A5VL28|SYL_LACRD Leucine--tRNA ligase OS=Lactobacillus reuteri (strain DSM 20016) GN=leuS PE=3 SV=1 696 936 4.0E-06
sp|B8DFR1|SYL_LISMH Leucine--tRNA ligase OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=leuS PE=3 SV=1 710 936 4.0E-06
sp|Q71Z07|SYL_LISMF Leucine--tRNA ligase OS=Listeria monocytogenes serotype 4b (strain F2365) GN=leuS PE=3 SV=1 710 936 4.0E-06
sp|C1KVV9|SYL_LISMC Leucine--tRNA ligase OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=leuS PE=3 SV=1 710 936 4.0E-06
sp|Q8Y6M4|SYL_LISMO Leucine--tRNA ligase OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=leuS PE=3 SV=1 710 936 5.0E-06
sp|Q5FIP3|SYL_LACAC Leucine--tRNA ligase OS=Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM) GN=leuS PE=3 SV=1 710 936 5.0E-06
sp|Q92AZ9|SYL_LISIN Leucine--tRNA ligase OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=leuS PE=3 SV=1 710 936 5.0E-06
sp|Q7P0R1|SYL_CHRVO Leucine--tRNA ligase OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=leuS PE=3 SV=1 748 937 6.0E-06
sp|Q8RDD1|SYM_CALS4 Methionine--tRNA ligase OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=metG PE=3 SV=1 706 783 6.0E-06
sp|Q182K8|SYL_PEPD6 Leucine--tRNA ligase OS=Peptoclostridium difficile (strain 630) GN=leuS PE=3 SV=1 745 935 8.0E-06
sp|Q1WUT3|SYL_LACS1 Leucine--tRNA ligase OS=Lactobacillus salivarius (strain UCC118) GN=leuS PE=3 SV=1 710 936 8.0E-06
sp|A4XYW8|SYL_PSEMY Leucine--tRNA ligase OS=Pseudomonas mendocina (strain ymp) GN=leuS PE=3 SV=2 758 937 9.0E-06
sp|A7GU19|SYL_BACCN Leucine--tRNA ligase OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=leuS PE=3 SV=1 710 936 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0000166 nucleotide binding Yes
GO:0004812 aminoacyl-tRNA ligase activity Yes
GO:0005524 ATP binding Yes
GO:0006418 tRNA aminoacylation for protein translation Yes
GO:0043038 amino acid activation No
GO:0140098 catalytic activity, acting on RNA No
GO:0030554 adenyl nucleotide binding No
GO:0090304 nucleic acid metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0032559 adenyl ribonucleotide binding No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0140101 catalytic activity, acting on a tRNA No
GO:0043436 oxoacid metabolic process No
GO:0097159 organic cyclic compound binding No
GO:0019752 carboxylic acid metabolic process No
GO:0043167 ion binding No
GO:0008152 metabolic process No
GO:0140640 catalytic activity, acting on a nucleic acid No
GO:0009987 cellular process No
GO:0097367 carbohydrate derivative binding No
GO:0003824 catalytic activity No
GO:0036094 small molecule binding No
GO:1901363 heterocyclic compound binding No
GO:0032555 purine ribonucleotide binding No
GO:0044237 cellular metabolic process No
GO:0008150 biological_process No
GO:0016875 ligase activity, forming carbon-oxygen bonds No
GO:0006807 nitrogen compound metabolic process No
GO:0006399 tRNA metabolic process No
GO:0016070 RNA metabolic process No
GO:0016874 ligase activity No
GO:0071704 organic substance metabolic process No
GO:0044281 small molecule metabolic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0044238 primary metabolic process No
GO:0043039 tRNA aminoacylation No
GO:0005488 binding No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0046483 heterocycle metabolic process No
GO:0043168 anion binding No
GO:1901265 nucleoside phosphate binding No
GO:1901564 organonitrogen compound metabolic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0006520 cellular amino acid metabolic process No
GO:0003674 molecular_function No
GO:0034660 ncRNA metabolic process No
GO:0032553 ribonucleotide binding No
GO:0006082 organic acid metabolic process No
GO:0017076 purine nucleotide binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 18 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|1625
MASSGAVPKAMEALTISQPKTKELKGTEKRDALIAVEKKYQQKWADDGLFQQDAPSIKDVPLRSISAAELREKEP
KFFGCMPYPYMNGVLHAGHTFSASKIEFAAGVARMQGKRALFPMGFHCTGMPIKACADKLVNEIKLFGRDFSGYR
EDDGQPDVIDEAATKQKKKEDVTKFSTNKSKANAKTVKMKYQFQIMKSIGIPQDEIHRFADPQHWLEFFPPLVIR
DLSALGCRIDWRRSFVTTDANPYYDAFVRWQMNRLRELDKIKFGKRYTIYSIKDGQPCMDHDRAEGEAVNPQEYT
ALKLKVVEWAPKAAEAIKGKIPDGADVFLVAATLRPETMYGQTCCFVGPKISYGVFKAGEKAYYLVTERAARNMA
YQGILAQEGVVEKACEVMGVDVVGTLVKAPLALHKDGVRVLPMETVLPTKGTGVVTSVPSDSPDDYATVTELAKK
ADYYGIKREWAELEIFPVIETPSYGDLCAPFLVKKLKIASPKDTKQLEEAKELAYKEGYYQGIMKAGDFAGEKVE
TAKPKVRAQLLEAGDAFAYSEPERKVVSRSGDDCIVALMDQWYLDYGESSWKRTALDWVTKADGQGLETWTTETR
NAFEGVLNWLNQWACARTYGLGSRLPWDEQFLVESLSDSTIYMAYYTVCHYLHADLFGREKGVGDVGPEQMVDGV
WDYIFCRGELSDEVLSTSKIPRSTLESMRREFEYFYPLDMRSSGKDLIPNHLTFFLYVHLALFPPEYWPRGVRAN
GHLMLNGEKMSKSTGNFMTLRDLVEKYGADAARIAMADAGDGVSDANLEEDVADNSILRLFTLREWCEEVMKEHR
QGLLRTGQTNGFQDALLDNELNGLAREAVEQYRQTNYKLALKAALYELTGARDFYREACAAAGIKMHGALVQRYV
ELQSLLLAVIAPHWSEHVWREVLGKGSSIQEARFPTVADVDAGLSAKRDYVRTTASNVHSVEALQAKKKAKGKEV
TFDAGRPKKLTIYTTDKFPGWQAKYVHLLGELWRAETGTVDERELSGRMAKMGEMKKAMPFVQGLKKRLQAGEAT
STVLERRLAFDERETLRQMVPGLCRTAGLASCRIVAVDEGGKTGVDVEDGGVVTGLAAVAEQAVPGVPTLLLENV
*
Coding >Ophun1|1625
ATGGCTTCGTCCGGCGCCGTTCCCAAGGCCATGGAAGCCCTCACCATCTCGCAGCCAAAGACCAAGGAGCTCAAA
GGGACCGAGAAGCGAGACGCCCTCATCGCCGTCGAGAAAAAGTACCAGCAGAAATGGGCAGACGACGGCCTCTTC
CAGCAGGATGCTCCCTCCATCAAGGACGTGCCGCTGCGGTCCATCTCGGCCGCCGAGCTGCGGGAGAAGGAGCCC
AAGTTCTTTGGCTGCATGCCGTACCCGTATATGAATGGCGTTCTGCACGCCGGCCATACCTTTTCCGCCAGCAAG
ATCGAGTTCGCCGCCGGCGTGGCCCGTATGCAGGGCAAGCGCGCTCTCTTCCCCATGGGCTTTCACTGCACGGGC
ATGCCCATCAAGGCCTGTGCGGATAAGCTGGTCAACGAGATCAAGCTGTTCGGACGGGACTTTTCTGGCTATCGG
GAGGATGACGGACAGCCAGACGTCATCGACGAGGCTGCGACGAAGCAGAAGAAGAAGGAGGACGTTACCAAGTTT
TCGACGAACAAGAGCAAGGCCAATGCCAAGACGGTCAAGATGAAGTATCAGTTCCAGATCATGAAGTCCATCGGG
ATACCCCAGGACGAGATCCATCGGTTTGCCGATCCGCAGCACTGGCTCGAGTTCTTCCCTCCGCTCGTCATCCGC
GACCTGTCGGCTCTGGGATGTAGGATCGACTGGCGGAGATCGTTTGTCACCACCGACGCCAATCCGTACTATGAC
GCCTTTGTCCGCTGGCAGATGAACCGCCTGAGGGAACTGGACAAGATCAAGTTTGGCAAGCGTTACACCATCTAT
TCCATCAAGGACGGTCAGCCCTGTATGGATCACGACCGTGCCGAGGGCGAGGCCGTCAACCCTCAGGAGTACACG
GCCCTGAAGCTCAAGGTCGTCGAGTGGGCCCCCAAGGCGGCCGAAGCCATCAAGGGCAAGATTCCCGACGGCGCC
GACGTCTTTCTGGTGGCCGCGACGCTACGGCCCGAGACCATGTACGGGCAGACGTGCTGCTTTGTCGGGCCCAAG
ATCAGCTACGGCGTCTTCAAGGCGGGCGAAAAGGCCTACTACCTCGTCACCGAGAGGGCGGCTCGCAACATGGCC
TACCAGGGCATCCTGGCCCAGGAGGGCGTCGTGGAGAAGGCGTGCGAGGTGATGGGCGTCGACGTCGTTGGCACG
TTGGTCAAAGCACCCCTGGCGCTTCACAAGGATGGCGTCCGGGTGCTGCCGATGGAGACGGTGCTGCCGACCAAG
GGCACGGGCGTCGTGACATCGGTGCCTTCGGACAGTCCCGACGACTACGCTACCGTGACGGAGCTGGCGAAAAAA
GCAGACTACTACGGCATCAAGCGAGAATGGGCTGAGCTCGAGATCTTCCCCGTCATCGAGACGCCGTCGTACGGT
GACCTCTGCGCGCCTTTCCTCGTCAAGAAGCTCAAGATTGCTTCGCCCAAGGACACCAAACAGCTCGAGGAGGCC
AAGGAGCTGGCTTACAAGGAGGGCTACTACCAGGGCATCATGAAGGCCGGCGACTTTGCAGGCGAAAAGGTGGAG
ACGGCCAAGCCCAAGGTCCGGGCCCAGCTGCTGGAGGCGGGCGACGCCTTTGCCTACTCGGAGCCGGAGCGAAAG
GTGGTCAGCCGATCGGGCGATGACTGCATCGTGGCCCTCATGGACCAGTGGTACCTCGACTACGGCGAGTCGTCG
TGGAAGCGGACCGCGCTGGACTGGGTGACCAAGGCGGACGGCCAGGGCCTGGAGACGTGGACGACGGAGACGCGC
AACGCCTTCGAGGGCGTCCTCAACTGGCTCAATCAGTGGGCGTGCGCGCGGACGTACGGCCTGGGCTCGAGGCTG
CCGTGGGACGAGCAGTTCCTGGTGGAGAGCCTCAGCGACTCGACCATCTACATGGCCTACTACACCGTCTGCCAC
TACCTCCATGCCGATCTGTTCGGCCGCGAGAAGGGCGTGGGCGACGTCGGGCCGGAGCAGATGGTGGACGGCGTT
TGGGACTACATCTTTTGCCGGGGCGAGCTGAGCGACGAGGTGCTCTCGACCAGCAAGATCCCGCGATCGACGCTC
GAGAGCATGAGGCGCGAGTTTGAGTACTTTTACCCGCTCGACATGCGCAGCTCGGGCAAGGATCTGATTCCCAAC
CACCTGACCTTTTTCCTCTACGTGCATCTGGCCCTGTTCCCGCCCGAGTACTGGCCGCGGGGCGTGCGAGCCAAC
GGGCACCTGATGCTCAACGGCGAGAAGATGAGCAAGAGCACGGGCAACTTTATGACGCTGCGGGACCTGGTGGAA
AAGTACGGAGCGGACGCGGCGCGCATCGCCATGGCGGACGCGGGCGACGGGGTCAGCGACGCCAACCTGGAGGAG
GACGTGGCTGACAACAGCATCCTGCGGCTGTTTACGCTGCGCGAGTGGTGCGAGGAGGTGATGAAGGAGCATCGA
CAGGGGCTGCTGCGGACGGGGCAGACAAACGGCTTCCAGGACGCGCTGTTGGACAACGAGCTCAACGGGCTGGCG
CGCGAGGCGGTGGAGCAGTACAGGCAGACCAACTACAAGCTGGCGCTCAAGGCGGCGCTGTACGAGCTGACGGGG
GCGCGCGACTTTTACCGCGAGGCCTGCGCGGCGGCAGGCATCAAGATGCACGGGGCGCTGGTGCAGCGGTACGTG
GAGCTGCAGAGCCTCCTGCTGGCCGTCATCGCGCCTCACTGGTCGGAGCACGTGTGGCGCGAGGTGCTGGGCAAG
GGCTCGTCGATCCAGGAGGCGCGGTTCCCGACGGTGGCGGACGTGGACGCGGGTCTGTCGGCCAAGAGAGACTAC
GTGCGGACGACGGCGAGCAACGTGCATTCGGTGGAGGCGCTGCAGGCCAAGAAGAAGGCCAAGGGCAAGGAGGTG
ACGTTTGACGCCGGGCGGCCCAAGAAGCTGACGATTTACACGACGGACAAGTTCCCGGGCTGGCAGGCCAAGTAC
GTGCATCTACTGGGCGAGCTGTGGAGGGCGGAGACGGGGACGGTGGACGAGCGGGAGCTGAGCGGACGGATGGCC
AAGATGGGGGAGATGAAGAAGGCGATGCCGTTCGTGCAGGGGCTCAAGAAGAGGCTGCAGGCGGGGGAGGCTACG
TCGACGGTGCTGGAGCGGCGGCTGGCCTTTGACGAGCGGGAGACGCTGCGGCAGATGGTGCCGGGCTTGTGCCGG
ACGGCGGGACTGGCGTCGTGCCGGATCGTGGCGGTGGACGAGGGGGGGAAGACGGGGGTTGACGTTGAGGACGGG
GGGGTGGTGACGGGGCTGGCGGCGGTTGCGGAGCAGGCGGTTCCGGGGGTGCCGACGCTGTTGCTGGAGAATGTG
TAG
Transcript >Ophun1|1625
ATGGCTTCGTCCGGCGCCGTTCCCAAGGCCATGGAAGCCCTCACCATCTCGCAGCCAAAGACCAAGGAGCTCAAA
GGGACCGAGAAGCGAGACGCCCTCATCGCCGTCGAGAAAAAGTACCAGCAGAAATGGGCAGACGACGGCCTCTTC
CAGCAGGATGCTCCCTCCATCAAGGACGTGCCGCTGCGGTCCATCTCGGCCGCCGAGCTGCGGGAGAAGGAGCCC
AAGTTCTTTGGCTGCATGCCGTACCCGTATATGAATGGCGTTCTGCACGCCGGCCATACCTTTTCCGCCAGCAAG
ATCGAGTTCGCCGCCGGCGTGGCCCGTATGCAGGGCAAGCGCGCTCTCTTCCCCATGGGCTTTCACTGCACGGGC
ATGCCCATCAAGGCCTGTGCGGATAAGCTGGTCAACGAGATCAAGCTGTTCGGACGGGACTTTTCTGGCTATCGG
GAGGATGACGGACAGCCAGACGTCATCGACGAGGCTGCGACGAAGCAGAAGAAGAAGGAGGACGTTACCAAGTTT
TCGACGAACAAGAGCAAGGCCAATGCCAAGACGGTCAAGATGAAGTATCAGTTCCAGATCATGAAGTCCATCGGG
ATACCCCAGGACGAGATCCATCGGTTTGCCGATCCGCAGCACTGGCTCGAGTTCTTCCCTCCGCTCGTCATCCGC
GACCTGTCGGCTCTGGGATGTAGGATCGACTGGCGGAGATCGTTTGTCACCACCGACGCCAATCCGTACTATGAC
GCCTTTGTCCGCTGGCAGATGAACCGCCTGAGGGAACTGGACAAGATCAAGTTTGGCAAGCGTTACACCATCTAT
TCCATCAAGGACGGTCAGCCCTGTATGGATCACGACCGTGCCGAGGGCGAGGCCGTCAACCCTCAGGAGTACACG
GCCCTGAAGCTCAAGGTCGTCGAGTGGGCCCCCAAGGCGGCCGAAGCCATCAAGGGCAAGATTCCCGACGGCGCC
GACGTCTTTCTGGTGGCCGCGACGCTACGGCCCGAGACCATGTACGGGCAGACGTGCTGCTTTGTCGGGCCCAAG
ATCAGCTACGGCGTCTTCAAGGCGGGCGAAAAGGCCTACTACCTCGTCACCGAGAGGGCGGCTCGCAACATGGCC
TACCAGGGCATCCTGGCCCAGGAGGGCGTCGTGGAGAAGGCGTGCGAGGTGATGGGCGTCGACGTCGTTGGCACG
TTGGTCAAAGCACCCCTGGCGCTTCACAAGGATGGCGTCCGGGTGCTGCCGATGGAGACGGTGCTGCCGACCAAG
GGCACGGGCGTCGTGACATCGGTGCCTTCGGACAGTCCCGACGACTACGCTACCGTGACGGAGCTGGCGAAAAAA
GCAGACTACTACGGCATCAAGCGAGAATGGGCTGAGCTCGAGATCTTCCCCGTCATCGAGACGCCGTCGTACGGT
GACCTCTGCGCGCCTTTCCTCGTCAAGAAGCTCAAGATTGCTTCGCCCAAGGACACCAAACAGCTCGAGGAGGCC
AAGGAGCTGGCTTACAAGGAGGGCTACTACCAGGGCATCATGAAGGCCGGCGACTTTGCAGGCGAAAAGGTGGAG
ACGGCCAAGCCCAAGGTCCGGGCCCAGCTGCTGGAGGCGGGCGACGCCTTTGCCTACTCGGAGCCGGAGCGAAAG
GTGGTCAGCCGATCGGGCGATGACTGCATCGTGGCCCTCATGGACCAGTGGTACCTCGACTACGGCGAGTCGTCG
TGGAAGCGGACCGCGCTGGACTGGGTGACCAAGGCGGACGGCCAGGGCCTGGAGACGTGGACGACGGAGACGCGC
AACGCCTTCGAGGGCGTCCTCAACTGGCTCAATCAGTGGGCGTGCGCGCGGACGTACGGCCTGGGCTCGAGGCTG
CCGTGGGACGAGCAGTTCCTGGTGGAGAGCCTCAGCGACTCGACCATCTACATGGCCTACTACACCGTCTGCCAC
TACCTCCATGCCGATCTGTTCGGCCGCGAGAAGGGCGTGGGCGACGTCGGGCCGGAGCAGATGGTGGACGGCGTT
TGGGACTACATCTTTTGCCGGGGCGAGCTGAGCGACGAGGTGCTCTCGACCAGCAAGATCCCGCGATCGACGCTC
GAGAGCATGAGGCGCGAGTTTGAGTACTTTTACCCGCTCGACATGCGCAGCTCGGGCAAGGATCTGATTCCCAAC
CACCTGACCTTTTTCCTCTACGTGCATCTGGCCCTGTTCCCGCCCGAGTACTGGCCGCGGGGCGTGCGAGCCAAC
GGGCACCTGATGCTCAACGGCGAGAAGATGAGCAAGAGCACGGGCAACTTTATGACGCTGCGGGACCTGGTGGAA
AAGTACGGAGCGGACGCGGCGCGCATCGCCATGGCGGACGCGGGCGACGGGGTCAGCGACGCCAACCTGGAGGAG
GACGTGGCTGACAACAGCATCCTGCGGCTGTTTACGCTGCGCGAGTGGTGCGAGGAGGTGATGAAGGAGCATCGA
CAGGGGCTGCTGCGGACGGGGCAGACAAACGGCTTCCAGGACGCGCTGTTGGACAACGAGCTCAACGGGCTGGCG
CGCGAGGCGGTGGAGCAGTACAGGCAGACCAACTACAAGCTGGCGCTCAAGGCGGCGCTGTACGAGCTGACGGGG
GCGCGCGACTTTTACCGCGAGGCCTGCGCGGCGGCAGGCATCAAGATGCACGGGGCGCTGGTGCAGCGGTACGTG
GAGCTGCAGAGCCTCCTGCTGGCCGTCATCGCGCCTCACTGGTCGGAGCACGTGTGGCGCGAGGTGCTGGGCAAG
GGCTCGTCGATCCAGGAGGCGCGGTTCCCGACGGTGGCGGACGTGGACGCGGGTCTGTCGGCCAAGAGAGACTAC
GTGCGGACGACGGCGAGCAACGTGCATTCGGTGGAGGCGCTGCAGGCCAAGAAGAAGGCCAAGGGCAAGGAGGTG
ACGTTTGACGCCGGGCGGCCCAAGAAGCTGACGATTTACACGACGGACAAGTTCCCGGGCTGGCAGGCCAAGTAC
GTGCATCTACTGGGCGAGCTGTGGAGGGCGGAGACGGGGACGGTGGACGAGCGGGAGCTGAGCGGACGGATGGCC
AAGATGGGGGAGATGAAGAAGGCGATGCCGTTCGTGCAGGGGCTCAAGAAGAGGCTGCAGGCGGGGGAGGCTACG
TCGACGGTGCTGGAGCGGCGGCTGGCCTTTGACGAGCGGGAGACGCTGCGGCAGATGGTGCCGGGCTTGTGCCGG
ACGGCGGGACTGGCGTCGTGCCGGATCGTGGCGGTGGACGAGGGGGGGAAGACGGGGGTTGACGTTGAGGACGGG
GGGGTGGTGACGGGGCTGGCGGCGGTTGCGGAGCAGGCGGTTCCGGGGGTGCCGACGCTGTTGCTGGAGAATGTG
TAG
Gene >Ophun1|1625
ATGGCTTCGTCCGGCGCCGTTCCCAAGGCCATGGAAGCCCTCACCATCTCGCAGCCAAAGACCAAGGAGCTCAAA
GGGGTAGGTCATCGACCATTAACCGCAAGAACTGGCTGTTTCTGACCGTCTCTTCGATAGACCGAGAAGCGAGAC
GCCCTCATCGCCGTCGAGAAAAAGTACCAGCAGAAATGGGCAGACGACGGCCTCTTCCAGCAGGATGCTCCCTCC
ATCAAGGACGTGCCGCTGCGGTCCATCTCGGCCGCCGAGCTGCGGGAGAAGGAGCCCAAGTTCTTTGGCTGCATG
CCGTACCCGTATATGAATGGCGTTCTGCACGCCGGCCATACCTTTTCCGCCAGCAAGATCGAGTTCGCCGCCGGC
GTGGCCCGTATGCAGGGCAAGCGCGCTCTCTTCCCCATGGGCTTTCACTGCACGGGCATGCCCATCAAGGCCTGT
GCGGATAAGCTGGTCAACGAGATCAAGCTGTTCGGACGGGACTTTTCTGGCTATCGGGAGGATGACGGACAGCCA
GACGTCATCGACGAGGCTGCGACGAAGCAGAAGAAGAAGGAGGACGTTACCAAGTTTTCGACGAACAAGAGCAAG
GCCAATGCCAAGACGGTCAAGATGAAGTATCAGTTCCAGATCATGAAGTCCATCGGGATACCCCAGGACGAGATC
CATCGGTTTGCCGATCCGCAGCACTGGCTCGAGTTCTTCCCTCCGCTCGTCATCCGCGACCTGTCGGCTCTGGGA
TGTAGGATCGACTGGCGGAGATCGTTTGTCACCACCGACGCCAATCCGTACTATGACGCCTTTGTCCGCTGGCAG
ATGAACCGCCTGAGGGAACTGGACAAGATCAAGTTTGGCAAGCGTTACACCATCTATTCCATCAAGGACGGTCAG
CCCTGTATGGATCACGACCGTGCCGAGGGCGAGGCCGTCAACCCTCAGGAGTACACGGCCCTGAAGCTCAAGGTC
GTCGAGTGGGCCCCCAAGGCGGCCGAAGCCATCAAGGGCAAGATTCCCGACGGCGCCGACGTCTTTCTGGTGGCC
GCGACGCTACGGCCCGAGACCATGTACGGGCAGACGTGCTGCTTTGTCGGGCCCAAGATCAGCTACGGCGTCTTC
AAGGCGGGCGAAAAGGCCTACTACCTCGTCACCGAGAGGGCGGCTCGCAACATGGCCTACCAGGGCATCCTGGCC
CAGGAGGGCGTCGTGGAGAAGGCGTGCGAGGTGATGGGCGTCGACGTCGTTGGCACGTTGGTCAAAGCACCCCTG
GCGCTTCACAAGGATGGCGTCCGGGTGCTGCCGATGGAGACGGTGCTGCCGACCAAGGGCACGGGCGTCGTGACA
TCGGTGCCTTCGGACAGTCCCGACGACTACGCTACCGTGACGGAGCTGGCGAAAAAAGCAGACTACTACGGCATC
AAGCGAGAATGGGCTGAGCTCGAGATCTTCCCCGTCATCGAGACGCCGTCGTACGGTGACCTCTGCGCGCCTTTC
CTCGTCAAGAAGCTCAAGATTGCTTCGCCCAAGGACACCAAACAGCTCGAGGAGGCCAAGGAGCTGGCTTACAAG
GAGGGCTACTACCAGGGCATCATGAAGGCCGGCGACTTTGCAGGCGAAAAGGTGGAGACGGCCAAGCCCAAGGTC
CGGGCCCAGCTGCTGGAGGCGGGCGACGCCTTTGCCTACTCGGAGCCGGAGCGAAAGGTGGTCAGCCGATCGGGC
GATGACTGCATCGTGGCCCTCATGGACCAGTGGTACCTCGACTACGGCGAGTCGTCGTGGAAGCGGACCGCGCTG
GACTGGGTGACCAAGGCGGACGGCCAGGGCCTGGAGACGTGGACGACGGAGACGCGCAACGCCTTCGAGGGCGTC
CTCAACTGGCTCAATCAGTGGGCGTGCGCGCGGACGTACGGCCTGGGCTCGAGGCTGCCGTGGGACGAGCAGTTC
CTGGTGGAGAGCCTCAGCGACTCGACCATCTACATGGCCTACTACACCGTCTGCCACTACCTCCATGCCGATCTG
TTCGGCCGCGAGAAGGGCGTGGGCGACGTCGGGCCGGAGCAGATGGTGGACGGCGTTTGGGACTACATCTTTTGC
CGGGGCGAGCTGAGCGACGAGGTGCTCTCGACCAGCAAGATCCCGCGATCGACGCTCGAGAGCATGAGGCGCGAG
TTTGAGTACTTTTACCCGCTCGACATGCGCAGCTCGGGCAAGGATCTGATTCCCAACCACCTGACCTTTTTCCTC
TACGTGCATCTGGCCCTGTTCCCGCCCGAGTACTGGCCGCGGGGCGTGCGAGCCAACGGGCACCTGATGCTCAAC
GGCGAGAAGATGAGCAAGAGCACGGGCAACTTTATGACGCTGCGGGACCTGGTGGAAAAGTACGGAGCGGACGCG
GCGCGCATCGCCATGGCGGACGCGGGCGACGGGGTCAGCGACGCCAACCTGGAGGAGGACGTGGCTGACAACAGC
ATCCTGCGGCTGTTTACGCTGCGCGAGTGGTGCGAGGAGGTGATGAAGGAGCATCGACAGGGGCTGCTGCGGACG
GGGCAGACAAACGGCTTCCAGGACGCGCTGTTGGACAACGAGCTCAACGGGCTGGCGCGCGAGGCGGTGGAGCAG
TACAGGCAGACCAACTACAAGCTGGCGCTCAAGGCGGCGCTGTACGAGCTGACGGGGGCGCGCGACTTTTACCGC
GAGGCCTGCGCGGCGGCAGGCATCAAGATGCACGGGGCGCTGGTGCAGCGGTACGTGGAGCTGCAGAGCCTCCTG
CTGGCCGTCATCGCGCCTCACTGGTCGGAGCACGTGTGGCGCGAGGTGCTGGGCAAGGGCTCGTCGATCCAGGAG
GCGCGGTTCCCGACGGTGGCGGACGTGGACGCGGGTCTGTCGGCCAAGAGAGACTACGTGCGGACGACGGCGAGC
AACGTGCATTCGGTGGAGGCGCTGCAGGCCAAGAAGAAGGCCAAGGGCAAGGAGGTGACGTTTGACGCCGGGCGG
CCCAAGAAGCTGACGATTTACACGACGGACAAGTTCCCGGGCTGGCAGGCCAAGTACGTGCATCTACTGGGCGAG
CTGTGGAGGGCGGAGACGGGGACGGTGGACGAGCGGGAGCTGAGCGGACGGATGGCCAAGATGGGGGAGATGAAG
AAGGCGATGCCGTTCGTGCAGGGGCTCAAGAAGAGGCTGCAGGCGGGGGAGGCTACGTCGACGGTGCTGGAGCGG
CGGCTGGCCTTTGACGAGCGGGAGACGCTGCGGCAGATGGTGCCGGGCTTGTGCCGGACGGCGGGACTGGCGTCG
TGCCGGATCGTGGCGGTGGACGAGGGGGGGAAGACGGGGGTTGACGTTGAGGACGGGGGGGTGGTGACGGGGCTG
GCGGCGGTTGCGGAGCAGGCGGTTCCGGGGGTGCCGACGCTGTTGCTGGAGAATGTGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail