Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|1622
Gene name
LocationContig_17:30872..31560
Strand-
Gene length (bp)688
Transcript length (bp)594
Coding sequence length (bp)594
Protein length (aa) 198

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01491 Frataxin_Cyay Frataxin-like domain 3.5E-36 72 185

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q07540|FRDA_YEAST Frataxin homolog, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YFH1 PE=1 SV=1 19 182 3.0E-28
sp|Q05B87|FRDA_BOVIN Frataxin, mitochondrial OS=Bos taurus GN=FXN PE=2 SV=1 71 181 2.0E-25
sp|Q16595|FRDA_HUMAN Frataxin, mitochondrial OS=Homo sapiens GN=FXN PE=1 SV=2 71 181 4.0E-24
sp|O35943|FRDA_MOUSE Frataxin, mitochondrial OS=Mus musculus GN=Fxn PE=1 SV=1 71 181 8.0E-24
sp|Q8HXX9|FRDA_MACFA Frataxin, mitochondrial OS=Macaca fascicularis GN=FXN PE=2 SV=1 71 181 7.0E-23
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q07540|FRDA_YEAST Frataxin homolog, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YFH1 PE=1 SV=1 19 182 3.0E-28
sp|Q05B87|FRDA_BOVIN Frataxin, mitochondrial OS=Bos taurus GN=FXN PE=2 SV=1 71 181 2.0E-25
sp|Q16595|FRDA_HUMAN Frataxin, mitochondrial OS=Homo sapiens GN=FXN PE=1 SV=2 71 181 4.0E-24
sp|O35943|FRDA_MOUSE Frataxin, mitochondrial OS=Mus musculus GN=Fxn PE=1 SV=1 71 181 8.0E-24
sp|Q8HXX9|FRDA_MACFA Frataxin, mitochondrial OS=Macaca fascicularis GN=FXN PE=2 SV=1 71 181 7.0E-23
sp|Q9W385|FRDA_DROME Frataxin homolog, mitochondrial OS=Drosophila melanogaster GN=fh PE=2 SV=1 71 181 4.0E-20
sp|D3ZYW7|FRDA_RAT Frataxin, mitochondrial OS=Rattus norvegicus GN=Fxn PE=1 SV=1 71 181 8.0E-20
sp|O74831|FRDA_SCHPO Frataxin homolog, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1183.03c PE=3 SV=1 72 169 1.0E-19
sp|Q9TY03|FRDA_CAEEL Frataxin, mitochondrial OS=Caenorhabditis elegans GN=frh-1 PE=2 SV=1 66 181 1.0E-19
sp|Q54C45|FRDA_DICDI Frataxin, mitochondrial OS=Dictyostelium discoideum GN=fxn PE=3 SV=1 52 181 1.0E-18
sp|Q9ZR07|FRDA_ARATH Frataxin, mitochondrial OS=Arabidopsis thaliana GN=FH PE=1 SV=2 72 192 2.0E-18
sp|Q8SWI3|FRDA_ENCCU Frataxin, mitosomal OS=Encephalitozoon cuniculi (strain GB-M1) GN=YFH1 PE=3 SV=1 77 165 1.0E-10
sp|Q1RIC4|CYAY_RICBR Protein CyaY OS=Rickettsia bellii (strain RML369-C) GN=cyaY PE=3 SV=1 72 184 1.0E-09
sp|C4K1X9|CYAY_RICPU Protein CyaY OS=Rickettsia peacockii (strain Rustic) GN=cyaY PE=3 SV=1 72 183 1.0E-09
sp|A8GRM5|CYAY_RICRS Protein CyaY OS=Rickettsia rickettsii (strain Sheila Smith) GN=cyaY PE=3 SV=1 72 183 2.0E-09
sp|A8GN05|CYAY_RICAH Protein CyaY OS=Rickettsia akari (strain Hartford) GN=cyaY PE=3 SV=1 72 184 2.0E-09
sp|C3PN35|CYAY_RICAE Protein CyaY OS=Rickettsia africae (strain ESF-5) GN=cyaY PE=3 SV=1 72 144 2.0E-09
sp|Q92IH7|CYAY_RICCN Protein CyaY OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=cyaY PE=3 SV=1 72 144 2.0E-09
sp|B0BX32|CYAY_RICRO Protein CyaY OS=Rickettsia rickettsii (strain Iowa) GN=cyaY PE=3 SV=1 72 183 2.0E-09
sp|P40128|CYAY_DICCH Protein CyaY OS=Dickeya chrysanthemi GN=cyaY PE=3 SV=1 72 170 3.0E-09
sp|C5BBD2|CYAY_EDWI9 Protein CyaY OS=Edwardsiella ictaluri (strain 93-146) GN=cyaY PE=3 SV=1 72 173 4.0E-09
sp|Q4UM50|CYAY_RICFE Protein CyaY OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=cyaY PE=3 SV=1 72 144 4.0E-09
sp|A0KFH9|CYAY_AERHH Protein CyaY OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=cyaY PE=3 SV=1 72 190 4.0E-09
sp|Q15Z11|CYAY_PSEA6 Protein CyaY OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=cyaY PE=3 SV=1 72 188 6.0E-09
sp|Q87KJ1|CYAY_VIBPA Protein CyaY OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=cyaY PE=3 SV=1 72 140 6.0E-09
sp|Q7MYN3|CYAY_PHOLL Protein CyaY OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=cyaY PE=3 SV=1 72 170 7.0E-09
sp|A4SRW7|CYAY_AERS4 Protein CyaY OS=Aeromonas salmonicida (strain A449) GN=cyaY PE=3 SV=1 72 177 2.0E-08
sp|A7N0W3|CYAY_VIBCB Protein CyaY OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=cyaY PE=3 SV=1 72 144 2.0E-08
sp|B7VMD7|CYAY_VIBTL Protein CyaY OS=Vibrio tasmaniensis (strain LGP32) GN=cyaY PE=3 SV=1 72 182 3.0E-08
sp|Q7MQC4|CYAY_VIBVY Protein CyaY OS=Vibrio vulnificus (strain YJ016) GN=cyaY PE=3 SV=1 72 182 3.0E-08
sp|Q8DD83|CYAY_VIBVU Protein CyaY OS=Vibrio vulnificus (strain CMCP6) GN=cyaY PE=3 SV=1 72 182 3.0E-08
sp|Q6CZG6|CYAY_PECAS Protein CyaY OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=cyaY PE=3 SV=1 72 140 5.0E-08
sp|Q3IEW0|CYAY_PSEHT Protein CyaY OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=cyaY PE=3 SV=1 72 140 6.0E-08
sp|C6DHB9|CYAY_PECCP Protein CyaY OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=cyaY PE=3 SV=1 72 140 9.0E-08
sp|B4TB34|CYAY_SALHS Protein CyaY OS=Salmonella heidelberg (strain SL476) GN=cyaY PE=3 SV=1 72 145 9.0E-08
sp|Q68X49|CYAY_RICTY Protein CyaY OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=cyaY PE=3 SV=2 72 144 1.0E-07
sp|A4VGW8|CYAY_PSEU5 Protein CyaY OS=Pseudomonas stutzeri (strain A1501) GN=cyaY PE=3 SV=1 70 146 1.0E-07
sp|Q8Z3A4|CYAY_SALTI Protein CyaY OS=Salmonella typhi GN=cyaY PE=3 SV=1 72 145 2.0E-07
sp|B4TNV5|CYAY_SALSV Protein CyaY OS=Salmonella schwarzengrund (strain CVM19633) GN=cyaY PE=3 SV=1 72 145 2.0E-07
sp|A9MY64|CYAY_SALPB Protein CyaY OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=cyaY PE=3 SV=1 72 145 2.0E-07
sp|B5FNU2|CYAY_SALDC Protein CyaY OS=Salmonella dublin (strain CT_02021853) GN=cyaY PE=3 SV=1 72 145 2.0E-07
sp|B5QVJ3|CYAY_SALEP Protein CyaY OS=Salmonella enteritidis PT4 (strain P125109) GN=cyaY PE=3 SV=1 72 145 2.0E-07
sp|B5RFQ2|CYAY_SALG2 Protein CyaY OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=cyaY PE=3 SV=1 72 145 2.0E-07
sp|Q9ZDK5|CYAY_RICPR Protein CyaY OS=Rickettsia prowazekii (strain Madrid E) GN=cyaY PE=3 SV=1 72 144 2.0E-07
sp|Q5PKM9|CYAY_SALPA Protein CyaY OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=cyaY PE=3 SV=1 72 145 3.0E-07
sp|B5BIV3|CYAY_SALPK Protein CyaY OS=Salmonella paratyphi A (strain AKU_12601) GN=cyaY PE=3 SV=1 72 145 3.0E-07
sp|Q57HR5|CYAY_SALCH Protein CyaY OS=Salmonella choleraesuis (strain SC-B67) GN=cyaY PE=3 SV=1 72 145 3.0E-07
sp|C0Q3B5|CYAY_SALPC Protein CyaY OS=Salmonella paratyphi C (strain RKS4594) GN=cyaY PE=3 SV=1 72 145 3.0E-07
sp|C3LPW5|CYAY_VIBCM Protein CyaY OS=Vibrio cholerae serotype O1 (strain M66-2) GN=cyaY PE=3 SV=1 72 188 3.0E-07
sp|A5F4I9|CYAY_VIBC3 Protein CyaY OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=cyaY PE=3 SV=1 72 188 3.0E-07
sp|B0KQ38|CYAY_PSEPG Protein CyaY OS=Pseudomonas putida (strain GB-1) GN=cyaY PE=3 SV=1 70 146 3.0E-07
sp|Q9KVL8|CYAY_VIBCH Protein CyaY OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=cyaY PE=3 SV=1 72 188 3.0E-07
sp|P56978|CYAY_SALTY Protein CyaY OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=cyaY PE=3 SV=1 72 145 3.0E-07
sp|A4XNX7|CYAY_PSEMY Protein CyaY OS=Pseudomonas mendocina (strain ymp) GN=cyaY PE=3 SV=1 70 146 3.0E-07
sp|B4SZ48|CYAY_SALNS Protein CyaY OS=Salmonella newport (strain SL254) GN=cyaY PE=3 SV=1 72 145 3.0E-07
sp|Q88CF6|CYAY_PSEPK Protein CyaY OS=Pseudomonas putida (strain KT2440) GN=cyaY PE=3 SV=1 70 146 4.0E-07
sp|A5WAU2|CYAY_PSEP1 Protein CyaY OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=cyaY PE=3 SV=1 70 146 4.0E-07
sp|A1JI88|CYAY_YERE8 Protein CyaY OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=cyaY PE=3 SV=1 72 146 4.0E-07
sp|A9MJ08|CYAY_SALAR Protein CyaY OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=cyaY PE=3 SV=1 72 177 4.0E-07
sp|A9R8K3|CYAY_YERPG Protein CyaY OS=Yersinia pestis bv. Antiqua (strain Angola) GN=cyaY PE=3 SV=1 72 146 5.0E-07
sp|Q1CBM8|CYAY_YERPA Protein CyaY OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=cyaY PE=3 SV=1 72 146 5.0E-07
sp|P46356|CYAY_YERPE Protein CyaY OS=Yersinia pestis GN=cyaY PE=3 SV=1 72 146 5.0E-07
sp|Q1CNI0|CYAY_YERPN Protein CyaY OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=cyaY PE=3 SV=1 72 146 5.0E-07
sp|A4TRA5|CYAY_YERPP Protein CyaY OS=Yersinia pestis (strain Pestoides F) GN=cyaY PE=3 SV=1 72 146 5.0E-07
sp|C1DJ52|CYAY_AZOVD Protein CyaY OS=Azotobacter vinelandii (strain DJ / ATCC BAA-1303) GN=cyaY PE=3 SV=1 70 177 5.0E-07
sp|C4LDV0|CYAY_TOLAT Protein CyaY OS=Tolumonas auensis (strain DSM 9187 / TA4) GN=cyaY PE=3 SV=1 72 179 7.0E-07
sp|B1JPE3|CYAY_YERPY Protein CyaY OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=cyaY PE=3 SV=1 72 146 8.0E-07
sp|Q66FZ7|CYAY_YERPS Protein CyaY OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=cyaY PE=3 SV=1 72 140 8.0E-07
sp|B2K070|CYAY_YERPB Protein CyaY OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=cyaY PE=3 SV=1 72 140 8.0E-07
sp|A7FD72|CYAY_YERP3 Protein CyaY OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=cyaY PE=3 SV=1 72 140 8.0E-07
sp|Q88B06|CYAY_PSESM Protein CyaY OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=cyaY PE=3 SV=1 70 146 1.0E-06
sp|A7MQK4|CYAY_CROS8 Protein CyaY OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=cyaY PE=3 SV=1 72 177 1.0E-06
sp|A8A6R1|CYAY_ECOHS Protein CyaY OS=Escherichia coli O9:H4 (strain HS) GN=cyaY PE=3 SV=1 72 145 1.0E-06
sp|Q500B9|CYAY_PSEU2 Protein CyaY OS=Pseudomonas syringae pv. syringae (strain B728a) GN=cyaY PE=3 SV=1 70 146 1.0E-06
sp|Q3K4S1|CYAY_PSEPF Protein CyaY OS=Pseudomonas fluorescens (strain Pf0-1) GN=cyaY PE=3 SV=1 70 146 1.0E-06
sp|A1RPD5|CYAY_SHESW Protein CyaY OS=Shewanella sp. (strain W3-18-1) GN=cyaY PE=3 SV=1 70 140 2.0E-06
sp|A4YBG0|CYAY_SHEPC Protein CyaY OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=cyaY PE=3 SV=1 70 140 2.0E-06
sp|Q8E9H2|CYAY_SHEON Protein CyaY OS=Shewanella oneidensis (strain MR-1) GN=cyaY PE=3 SV=2 70 140 2.0E-06
sp|Q0HQI9|CYAY_SHESR Protein CyaY OS=Shewanella sp. (strain MR-7) GN=cyaY PE=3 SV=1 70 170 3.0E-06
sp|Q0HN97|CYAY_SHESM Protein CyaY OS=Shewanella sp. (strain MR-4) GN=cyaY PE=3 SV=1 70 170 3.0E-06
sp|A0KS62|CYAY_SHESA Protein CyaY OS=Shewanella sp. (strain ANA-3) GN=cyaY PE=3 SV=1 70 170 3.0E-06
sp|B1J1U3|CYAY_PSEPW Protein CyaY OS=Pseudomonas putida (strain W619) GN=cyaY PE=3 SV=1 70 146 3.0E-06
sp|Q13TK9|CYAY_BURXL Protein CyaY OS=Burkholderia xenovorans (strain LB400) GN=cyaY PE=3 SV=1 72 159 3.0E-06
sp|A9L5F8|CYAY_SHEB9 Protein CyaY OS=Shewanella baltica (strain OS195) GN=cyaY PE=3 SV=1 70 140 4.0E-06
sp|A3D9Q3|CYAY_SHEB5 Protein CyaY OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=cyaY PE=3 SV=1 70 140 4.0E-06
sp|A6WTF8|CYAY_SHEB8 Protein CyaY OS=Shewanella baltica (strain OS185) GN=cyaY PE=3 SV=1 70 140 4.0E-06
sp|Q39KC9|CYAY_BURL3 Protein CyaY OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=cyaY PE=3 SV=1 72 159 4.0E-06
sp|B2T711|CYAY_BURPP Protein CyaY OS=Burkholderia phytofirmans (strain DSM 17436 / PsJN) GN=cyaY PE=3 SV=1 72 159 5.0E-06
sp|Q12FF7|CYAY_POLSJ Protein CyaY OS=Polaromonas sp. (strain JS666 / ATCC BAA-500) GN=cyaY PE=3 SV=1 72 140 5.0E-06
sp|Q6LLN3|CYAY_PHOPR Protein CyaY OS=Photobacterium profundum GN=cyaY PE=3 SV=1 72 183 6.0E-06
sp|Q48AW7|CYAY_COLP3 Protein CyaY OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=cyaY PE=3 SV=1 72 140 6.0E-06
sp|B4E5Z6|CYAY_BURCJ Protein CyaY OS=Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610) GN=cyaY PE=1 SV=1 72 159 7.0E-06
sp|A0K3R3|CYAY_BURCH Protein CyaY OS=Burkholderia cenocepacia (strain HI2424) GN=cyaY PE=3 SV=1 72 159 7.0E-06
sp|B1JU60|CYAY_BURCC Protein CyaY OS=Burkholderia cenocepacia (strain MC0-3) GN=cyaY PE=3 SV=1 72 159 7.0E-06
sp|Q1BRY6|CYAY_BURCA Protein CyaY OS=Burkholderia cenocepacia (strain AU 1054) GN=cyaY PE=3 SV=1 72 159 7.0E-06
sp|A4JAS8|CYAY_BURVG Protein CyaY OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=cyaY PE=3 SV=1 72 159 8.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016226 iron-sulfur cluster assembly Yes
GO:0008199 ferric iron binding Yes
GO:0008150 biological_process No
GO:0044237 cellular metabolic process No
GO:0046914 transition metal ion binding No
GO:0005488 binding No
GO:0043167 ion binding No
GO:0043169 cation binding No
GO:0009987 cellular process No
GO:0071840 cellular component organization or biogenesis No
GO:0005506 iron ion binding No
GO:0016043 cellular component organization No
GO:0031163 metallo-sulfur cluster assembly No
GO:0008152 metabolic process No
GO:0003674 molecular_function No
GO:0006790 sulfur compound metabolic process No
GO:0022607 cellular component assembly No
GO:0046872 metal ion binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|1622
MSRNSLPRLVSRAAASFSRRAGLPLARPGLVVPRRWLVVPTPARRRGIMPHSENPSKAEVAKSEPSYGVLTLSDN
EYHELADAYLDAVLAKFEQLQDTREDIDVEFSAGVMTIAVAGRGTYVINKQPPNRQIWLSSPISGPKRFDWCIVG
EGQGEKEGTGSGSWIYTREGVGLNDLILDELEVDVAGPAQTSSVLTR*
Coding >Ophun1|1622
ATGTCCCGCAACAGCCTCCCTCGCCTCGTCTCCCGCGCCGCCGCCAGCTTCTCCCGTCGCGCCGGACTCCCCTTG
GCGCGGCCCGGCCTCGTCGTCCCGCGCCGATGGCTGGTGGTCCCCACGCCGGCCCGACGCCGGGGCATCATGCCA
CACTCGGAGAACCCCAGCAAGGCTGAGGTGGCCAAGTCGGAGCCCTCGTATGGCGTCTTGACGCTCTCCGATAAC
GAGTACCACGAGCTGGCAGACGCCTATCTCGATGCCGTGCTGGCCAAGTTTGAGCAGCTGCAAGACACCAGGGAG
GACATTGACGTCGAATTCTCGGCCGGCGTCATGACCATCGCCGTCGCCGGCAGAGGCACCTACGTCATCAACAAG
CAGCCGCCCAACCGCCAGATCTGGCTCTCGTCCCCCATCTCAGGCCCGAAGCGCTTCGACTGGTGCATCGTCGGC
GAGGGCCAGGGCGAAAAGGAAGGCACCGGCTCCGGCAGCTGGATCTACACGCGCGAAGGCGTCGGCCTCAACGAC
CTCATCTTGGACGAGCTCGAGGTGGACGTCGCCGGGCCGGCTCAGACGAGTTCAGTCTTGACGAGATAG
Transcript >Ophun1|1622
ATGTCCCGCAACAGCCTCCCTCGCCTCGTCTCCCGCGCCGCCGCCAGCTTCTCCCGTCGCGCCGGACTCCCCTTG
GCGCGGCCCGGCCTCGTCGTCCCGCGCCGATGGCTGGTGGTCCCCACGCCGGCCCGACGCCGGGGCATCATGCCA
CACTCGGAGAACCCCAGCAAGGCTGAGGTGGCCAAGTCGGAGCCCTCGTATGGCGTCTTGACGCTCTCCGATAAC
GAGTACCACGAGCTGGCAGACGCCTATCTCGATGCCGTGCTGGCCAAGTTTGAGCAGCTGCAAGACACCAGGGAG
GACATTGACGTCGAATTCTCGGCCGGCGTCATGACCATCGCCGTCGCCGGCAGAGGCACCTACGTCATCAACAAG
CAGCCGCCCAACCGCCAGATCTGGCTCTCGTCCCCCATCTCAGGCCCGAAGCGCTTCGACTGGTGCATCGTCGGC
GAGGGCCAGGGCGAAAAGGAAGGCACCGGCTCCGGCAGCTGGATCTACACGCGCGAAGGCGTCGGCCTCAACGAC
CTCATCTTGGACGAGCTCGAGGTGGACGTCGCCGGGCCGGCTCAGACGAGTTCAGTCTTGACGAGATAG
Gene >Ophun1|1622
ATGTCCCGCAACAGCCTCCCTCGCCTCGTCTCCCGCGCCGCCGCCAGCTTCTCCCGTCGCGCCGGACTCCCCTTG
GCGCGGCCCGGCCTCGTCGTCCCGCGCCGATGGCTGGTGGTCCCCACGCCGGCCCGACGCCGGGGCATCATGCCA
CACTCGGAGAACCCCAGCAAGGCTGAGGTGGCCAAGTCGGAGCCCTCGTATGGCGTCTTGACGCTCTCCGATAAC
GAGTACCACGAGCTGGCAGACGCCTATCTCGATGCCGTGCTGGCCAAGTTTGAGCAGCTGCAAGACACCAGGGAG
GACATTGACGTCGAATTCTCGGTGCGTCCCCATACTCTTCTTTCCCTAAATCTCTCTTCATTGATTCTTGCGTCA
TGCGCACGCGTGAGCATGAAATGCTAACCATACTCCTTAGGCCGGCGTCATGACCATCGCCGTCGCCGGCAGAGG
CACCTACGTCATCAACAAGCAGCCGCCCAACCGCCAGATCTGGCTCTCGTCCCCCATCTCAGGCCCGAAGCGCTT
CGACTGGTGCATCGTCGGCGAGGGCCAGGGCGAAAAGGAAGGCACCGGCTCCGGCAGCTGGATCTACACGCGCGA
AGGCGTCGGCCTCAACGACCTCATCTTGGACGAGCTCGAGGTGGACGTCGCCGGGCCGGCTCAGACGAGTTCAGT
CTTGACGAGATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail