Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|1617
Gene name
LocationContig_17:20347..21586
Strand+
Gene length (bp)1239
Transcript length (bp)1239
Coding sequence length (bp)1239
Protein length (aa) 413

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00903 Glyoxalase Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily 2.2E-04 32 159
PF00903 Glyoxalase Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily 8.8E-15 220 365

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q96X22|HPPD_MAGO7 4-hydroxyphenylpyruvate dioxygenase OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=HPD4 PE=3 SV=1 1 412 0.0E+00
sp|Q872T7|HPPD_NEUCR 4-hydroxyphenylpyruvate dioxygenase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=B23G1.170 PE=3 SV=1 1 412 0.0E+00
sp|O42764|HPPD_ZYMTR 4-hydroxyphenylpyruvate dioxygenase OS=Zymoseptoria tritici GN=HPPD PE=3 SV=1 28 412 0.0E+00
sp|Q4WHU1|HPPD1_ASPFU Probable 4-hydroxyphenylpyruvate dioxygenase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=AFUA_2G04200 PE=3 SV=1 1 412 4.0E-175
sp|E9CWP5|HPPD_COCPS 4-hydroxyphenylpyruvate dioxygenase OS=Coccidioides posadasii (strain RMSCC 757 / Silveira) GN=TCRP PE=3 SV=1 1 412 7.0E-175
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q96X22|HPPD_MAGO7 4-hydroxyphenylpyruvate dioxygenase OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=HPD4 PE=3 SV=1 1 412 0.0E+00
sp|Q872T7|HPPD_NEUCR 4-hydroxyphenylpyruvate dioxygenase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=B23G1.170 PE=3 SV=1 1 412 0.0E+00
sp|O42764|HPPD_ZYMTR 4-hydroxyphenylpyruvate dioxygenase OS=Zymoseptoria tritici GN=HPPD PE=3 SV=1 28 412 0.0E+00
sp|Q4WHU1|HPPD1_ASPFU Probable 4-hydroxyphenylpyruvate dioxygenase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=AFUA_2G04200 PE=3 SV=1 1 412 4.0E-175
sp|E9CWP5|HPPD_COCPS 4-hydroxyphenylpyruvate dioxygenase OS=Coccidioides posadasii (strain RMSCC 757 / Silveira) GN=TCRP PE=3 SV=1 1 412 7.0E-175
sp|P0CW94|HPPD_COCP7 4-hydroxyphenylpyruvate dioxygenase OS=Coccidioides posadasii (strain C735) GN=TCRP PE=2 SV=1 1 412 7.0E-175
sp|Q1E803|HPPD_COCIM 4-hydroxyphenylpyruvate dioxygenase OS=Coccidioides immitis (strain RS) GN=TCRP PE=3 SV=1 1 412 2.0E-174
sp|Q6CDR5|HPPD_YARLI 4-hydroxyphenylpyruvate dioxygenase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0B21846g PE=3 SV=1 1 412 2.0E-172
sp|Q4WPV8|HPPD2_ASPFU Probable 4-hydroxyphenylpyruvate dioxygenase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=AFUA_4G10620 PE=3 SV=1 29 412 3.0E-156
sp|Q76NV5|HPPD_DICDI 4-hydroxyphenylpyruvate dioxygenase OS=Dictyostelium discoideum GN=hpd PE=1 SV=1 31 412 3.0E-140
sp|Q5EA20|HPPD_BOVIN 4-hydroxyphenylpyruvate dioxygenase OS=Bos taurus GN=HPD PE=2 SV=3 27 412 4.0E-137
sp|Q27203|HPPD_TETTH 4-hydroxyphenylpyruvate dioxygenase OS=Tetrahymena thermophila GN=TFA PE=3 SV=1 25 412 5.0E-136
sp|Q5BKL0|HPPD_XENTR 4-hydroxyphenylpyruvate dioxygenase OS=Xenopus tropicalis GN=hpd PE=2 SV=1 25 412 3.0E-135
sp|P32755|HPPD_RAT 4-hydroxyphenylpyruvate dioxygenase OS=Rattus norvegicus GN=Hpd PE=1 SV=3 27 412 6.0E-135
sp|P32754|HPPD_HUMAN 4-hydroxyphenylpyruvate dioxygenase OS=Homo sapiens GN=HPD PE=1 SV=2 27 412 4.0E-134
sp|P49429|HPPD_MOUSE 4-hydroxyphenylpyruvate dioxygenase OS=Mus musculus GN=Hpd PE=1 SV=3 27 412 1.0E-133
sp|Q6TGZ5|HPPD_DANRE 4-hydroxyphenylpyruvate dioxygenase OS=Danio rerio GN=hpd PE=2 SV=1 27 412 1.0E-132
sp|Q22633|HPPD_CAEEL 4-hydroxyphenylpyruvate dioxygenase OS=Caenorhabditis elegans GN=hpd-1 PE=3 SV=1 27 412 2.0E-130
sp|Q60Y65|HPPD_CAEBR 4-hydroxyphenylpyruvate dioxygenase OS=Caenorhabditis briggsae GN=hpd-1 PE=3 SV=1 27 412 3.0E-130
sp|Q02110|HPPD_PIG 4-hydroxyphenylpyruvate dioxygenase OS=Sus scrofa GN=HPD PE=1 SV=4 27 412 2.0E-123
sp|Q53586|HPPD_STRAW 4-hydroxyphenylpyruvate dioxygenase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=hpd PE=1 SV=2 31 412 1.0E-103
sp|Q9S2F4|HPPD_STRCO 4-hydroxyphenylpyruvate dioxygenase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=hpd PE=3 SV=1 31 412 4.0E-103
sp|Q18347|YBWL_CAEEL Putative protein C31H2.4 OS=Caenorhabditis elegans GN=C31H2.4 PE=3 SV=1 27 412 5.0E-86
sp|P93836|HPPD_ARATH 4-hydroxyphenylpyruvate dioxygenase OS=Arabidopsis thaliana GN=HPD PE=1 SV=2 32 384 8.0E-53
sp|O23920|HPPD_DAUCA 4-hydroxyphenylpyruvate dioxygenase OS=Daucus carota PE=2 SV=1 32 384 9.0E-53
sp|Q9ARF9|HPPD_PLESU 4-hydroxyphenylpyruvate dioxygenase OS=Plectranthus scutellarioides PE=2 SV=1 32 384 5.0E-52
sp|O52791|HMAS_AMYOR 4-hydroxymandelate synthase OS=Amycolatopsis orientalis PE=1 SV=1 82 406 9.0E-46
sp|O48604|HPPD_HORVU 4-hydroxyphenylpyruvate dioxygenase OS=Hordeum vulgare PE=2 SV=1 32 384 9.0E-45
sp|O06695|VLLY_VIBVU Hemolysin VllY OS=Vibrio vulnificus (strain CMCP6) GN=vllY PE=3 SV=2 118 412 7.0E-41
sp|Q5ZT84|LLY_LEGPH 4-hydroxyphenylpyruvate dioxygenase OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=lly PE=1 SV=2 113 412 1.0E-38
sp|P23996|MELA_SHECO Protein MelA OS=Shewanella colwelliana GN=melA PE=2 SV=1 118 412 2.0E-38
sp|P69053|LLY_LEGPC 4-hydroxyphenylpyruvate dioxygenase OS=Legionella pneumophila (strain Corby) GN=lly PE=3 SV=2 113 412 5.0E-38
sp|P80064|HPPD_PSEUJ 4-hydroxyphenylpyruvate dioxygenase OS=Pseudomonas sp. (strain P.J. 874) GN=hpd PE=1 SV=1 117 412 4.0E-35
sp|Q9I576|HPPD_PSEAE 4-hydroxyphenylpyruvate dioxygenase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=hpd PE=3 SV=1 117 410 1.0E-34
sp|Q96IR7|HPDL_HUMAN 4-hydroxyphenylpyruvate dioxygenase-like protein OS=Homo sapiens GN=HPDL PE=1 SV=1 34 407 2.0E-33
sp|Q5XIH9|HPDL_RAT 4-hydroxyphenylpyruvate dioxygenase-like protein OS=Rattus norvegicus GN=Hpdl PE=2 SV=1 34 407 6.0E-31
sp|Q55810|Y090_SYNY3 Uncharacterized protein slr0090 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=slr0090 PE=3 SV=1 114 403 7.0E-31
sp|Q8K248|HPDL_MOUSE 4-hydroxyphenylpyruvate dioxygenase-like protein OS=Mus musculus GN=Hpdl PE=2 SV=1 34 407 2.0E-30
sp|Q557J8|HPDL_DICDI Uncharacterized 4-hydroxyphenylpyruvate dioxygenase-like protein OS=Dictyostelium discoideum GN=hpdl-1 PE=3 SV=1 27 407 5.0E-30
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup2446
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2912
Ophiocordyceps australis map64 (Brazil) OphauB2|1156
Ophiocordyceps camponoti-floridani Ophcf2|05720
Ophiocordyceps camponoti-rufipedis Ophun1|1617 (this protein)
Ophiocordyceps kimflemingae Ophio5|3052
Ophiocordyceps subramaniannii Hirsu2|3498

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|1617
MAPSAVSPVQRAVDVPSRQYNGSDAAGNFTGYDHVTWWVGNAKQAASYYTSLFGFHPVAYRGLETGSRYFASHVV
ANNDVRFVFTSPLRSAEHLAADEPITDEERKLLVDMYAHLEKHGDAVKDVAFEVDNVEGVYQRAVKGGAVAVRAP
EAQRDGDLGSVVTAVICTYGDTTHTLLDRSRYSGPFMPGFRAAQPSGASVTLPDVGLARVDHCVGNQDWNEMESA
CDFYENCLSFHRFWSVDDSQICTDFSALNSIVMASPNNLVKMPINEPAAGKKKSQIEEYVIFNSGPGVQHIALLT
TDIIDAVSALRARGVDFIRVPDTYYATLRQRLKSERRGWELQEDLDTLQRLNILIDYDEAGYLLQLFTKPLMDRP
TVFIEIIQRNNFDGFGAGNFKSLFEAIEREQAERGNL*
Coding >Ophun1|1617
ATGGCCCCTTCAGCCGTATCACCTGTCCAGCGAGCGGTCGACGTCCCTTCACGCCAGTACAACGGCTCGGACGCG
GCTGGCAACTTCACGGGGTACGACCACGTAACGTGGTGGGTGGGAAACGCCAAGCAGGCGGCGTCATATTACACC
AGTCTCTTCGGCTTCCATCCCGTCGCCTACCGCGGGCTCGAGACGGGCAGCCGATACTTTGCGTCTCATGTCGTG
GCCAACAATGACGTCCGCTTCGTCTTCACCTCGCCGTTGCGGTCGGCCGAGCACCTGGCGGCGGACGAGCCCATT
ACCGACGAAGAGAGGAAGTTGCTGGTCGACATGTACGCCCACCTCGAGAAGCACGGTGACGCCGTCAAGGACGTG
GCTTTTGAAGTGGACAATGTCGAGGGCGTCTATCAACGGGCCGTCAAGGGAGGTGCCGTGGCCGTGCGGGCGCCC
GAAGCCCAGCGAGACGGCGACCTCGGCAGCGTCGTGACGGCCGTCATCTGCACCTACGGCGACACGACACACACG
CTCCTCGACCGATCCCGGTATTCAGGCCCTTTTATGCCGGGCTTCCGGGCGGCTCAGCCATCGGGAGCCTCGGTG
ACGCTACCAGACGTCGGGCTGGCACGCGTCGATCACTGTGTCGGCAATCAGGATTGGAACGAGATGGAGTCTGCT
TGCGACTTTTACGAGAACTGCCTGTCGTTCCATCGGTTCTGGTCCGTCGACGACTCGCAGATCTGCACCGACTTC
TCGGCCCTCAACTCCATCGTCATGGCCTCGCCCAACAACCTGGTCAAGATGCCCATCAACGAGCCGGCAGCAGGC
AAGAAGAAGTCGCAGATTGAGGAATACGTCATCTTCAACTCGGGCCCGGGCGTCCAGCACATCGCCCTCCTGACA
ACAGACATCATCGACGCCGTCTCGGCGCTGCGAGCCCGCGGCGTAGACTTCATCCGCGTCCCAGACACGTACTAC
GCCACCCTGCGGCAGCGTCTCAAGTCGGAACGTCGCGGCTGGGAGCTGCAAGAGGATCTCGATACCCTGCAGCGG
CTCAACATCCTCATCGACTACGACGAGGCCGGCTACCTGCTCCAGCTATTCACCAAGCCTCTCATGGACCGCCCC
ACCGTCTTCATCGAGATTATCCAGCGCAACAACTTTGACGGCTTCGGCGCGGGCAATTTCAAGAGTTTGTTTGAG
GCTATTGAGCGGGAGCAGGCCGAGCGTGGGAACCTCTGA
Transcript >Ophun1|1617
ATGGCCCCTTCAGCCGTATCACCTGTCCAGCGAGCGGTCGACGTCCCTTCACGCCAGTACAACGGCTCGGACGCG
GCTGGCAACTTCACGGGGTACGACCACGTAACGTGGTGGGTGGGAAACGCCAAGCAGGCGGCGTCATATTACACC
AGTCTCTTCGGCTTCCATCCCGTCGCCTACCGCGGGCTCGAGACGGGCAGCCGATACTTTGCGTCTCATGTCGTG
GCCAACAATGACGTCCGCTTCGTCTTCACCTCGCCGTTGCGGTCGGCCGAGCACCTGGCGGCGGACGAGCCCATT
ACCGACGAAGAGAGGAAGTTGCTGGTCGACATGTACGCCCACCTCGAGAAGCACGGTGACGCCGTCAAGGACGTG
GCTTTTGAAGTGGACAATGTCGAGGGCGTCTATCAACGGGCCGTCAAGGGAGGTGCCGTGGCCGTGCGGGCGCCC
GAAGCCCAGCGAGACGGCGACCTCGGCAGCGTCGTGACGGCCGTCATCTGCACCTACGGCGACACGACACACACG
CTCCTCGACCGATCCCGGTATTCAGGCCCTTTTATGCCGGGCTTCCGGGCGGCTCAGCCATCGGGAGCCTCGGTG
ACGCTACCAGACGTCGGGCTGGCACGCGTCGATCACTGTGTCGGCAATCAGGATTGGAACGAGATGGAGTCTGCT
TGCGACTTTTACGAGAACTGCCTGTCGTTCCATCGGTTCTGGTCCGTCGACGACTCGCAGATCTGCACCGACTTC
TCGGCCCTCAACTCCATCGTCATGGCCTCGCCCAACAACCTGGTCAAGATGCCCATCAACGAGCCGGCAGCAGGC
AAGAAGAAGTCGCAGATTGAGGAATACGTCATCTTCAACTCGGGCCCGGGCGTCCAGCACATCGCCCTCCTGACA
ACAGACATCATCGACGCCGTCTCGGCGCTGCGAGCCCGCGGCGTAGACTTCATCCGCGTCCCAGACACGTACTAC
GCCACCCTGCGGCAGCGTCTCAAGTCGGAACGTCGCGGCTGGGAGCTGCAAGAGGATCTCGATACCCTGCAGCGG
CTCAACATCCTCATCGACTACGACGAGGCCGGCTACCTGCTCCAGCTATTCACCAAGCCTCTCATGGACCGCCCC
ACCGTCTTCATCGAGATTATCCAGCGCAACAACTTTGACGGCTTCGGCGCGGGCAATTTCAAGAGTTTGTTTGAG
GCTATTGAGCGGGAGCAGGCCGAGCGTGGGAACCTCTGA
Gene >Ophun1|1617
ATGGCCCCTTCAGCCGTATCACCTGTCCAGCGAGCGGTCGACGTCCCTTCACGCCAGTACAACGGCTCGGACGCG
GCTGGCAACTTCACGGGGTACGACCACGTAACGTGGTGGGTGGGAAACGCCAAGCAGGCGGCGTCATATTACACC
AGTCTCTTCGGCTTCCATCCCGTCGCCTACCGCGGGCTCGAGACGGGCAGCCGATACTTTGCGTCTCATGTCGTG
GCCAACAATGACGTCCGCTTCGTCTTCACCTCGCCGTTGCGGTCGGCCGAGCACCTGGCGGCGGACGAGCCCATT
ACCGACGAAGAGAGGAAGTTGCTGGTCGACATGTACGCCCACCTCGAGAAGCACGGTGACGCCGTCAAGGACGTG
GCTTTTGAAGTGGACAATGTCGAGGGCGTCTATCAACGGGCCGTCAAGGGAGGTGCCGTGGCCGTGCGGGCGCCC
GAAGCCCAGCGAGACGGCGACCTCGGCAGCGTCGTGACGGCCGTCATCTGCACCTACGGCGACACGACACACACG
CTCCTCGACCGATCCCGGTATTCAGGCCCTTTTATGCCGGGCTTCCGGGCGGCTCAGCCATCGGGAGCCTCGGTG
ACGCTACCAGACGTCGGGCTGGCACGCGTCGATCACTGTGTCGGCAATCAGGATTGGAACGAGATGGAGTCTGCT
TGCGACTTTTACGAGAACTGCCTGTCGTTCCATCGGTTCTGGTCCGTCGACGACTCGCAGATCTGCACCGACTTC
TCGGCCCTCAACTCCATCGTCATGGCCTCGCCCAACAACCTGGTCAAGATGCCCATCAACGAGCCGGCAGCAGGC
AAGAAGAAGTCGCAGATTGAGGAATACGTCATCTTCAACTCGGGCCCGGGCGTCCAGCACATCGCCCTCCTGACA
ACAGACATCATCGACGCCGTCTCGGCGCTGCGAGCCCGCGGCGTAGACTTCATCCGCGTCCCAGACACGTACTAC
GCCACCCTGCGGCAGCGTCTCAAGTCGGAACGTCGCGGCTGGGAGCTGCAAGAGGATCTCGATACCCTGCAGCGG
CTCAACATCCTCATCGACTACGACGAGGCCGGCTACCTGCTCCAGCTATTCACCAAGCCTCTCATGGACCGCCCC
ACCGTCTTCATCGAGATTATCCAGCGCAACAACTTTGACGGCTTCGGCGCGGGCAATTTCAAGAGTTTGTTTGAG
GCTATTGAGCGGGAGCAGGCCGAGCGTGGGAACCTCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail