Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|1614
Gene name
LocationContig_17:15648..17046
Strand+
Gene length (bp)1398
Transcript length (bp)1215
Coding sequence length (bp)1215
Protein length (aa) 405

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03151 TPT Triose-phosphate Transporter family 1.3E-23 42 329

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9SKJ7|PT225_ARATH Probable sugar phosphate/phosphate translocator At2g25520 OS=Arabidopsis thaliana GN=At2g25520 PE=1 SV=1 44 354 1.0E-57
sp|Q9LFN3|PT511_ARATH Probable sugar phosphate/phosphate translocator At5g11230 OS=Arabidopsis thaliana GN=At5g11230 PE=2 SV=1 44 330 4.0E-57
sp|Q3E6T0|PT525_ARATH Probable sugar phosphate/phosphate translocator At5g25400 OS=Arabidopsis thaliana GN=At5g25400 PE=2 SV=1 44 330 4.0E-57
sp|Q9SUV2|PT432_ARATH Probable sugar phosphate/phosphate translocator At4g32390 OS=Arabidopsis thaliana GN=At4g32390 PE=3 SV=1 44 330 4.0E-56
sp|Q9LRP2|PT317_ARATH Probable sugar phosphate/phosphate translocator At3g17430 OS=Arabidopsis thaliana GN=At3g17430 PE=1 SV=1 52 330 1.0E-55
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9SKJ7|PT225_ARATH Probable sugar phosphate/phosphate translocator At2g25520 OS=Arabidopsis thaliana GN=At2g25520 PE=1 SV=1 44 354 1.0E-57
sp|Q9LFN3|PT511_ARATH Probable sugar phosphate/phosphate translocator At5g11230 OS=Arabidopsis thaliana GN=At5g11230 PE=2 SV=1 44 330 4.0E-57
sp|Q3E6T0|PT525_ARATH Probable sugar phosphate/phosphate translocator At5g25400 OS=Arabidopsis thaliana GN=At5g25400 PE=2 SV=1 44 330 4.0E-57
sp|Q9SUV2|PT432_ARATH Probable sugar phosphate/phosphate translocator At4g32390 OS=Arabidopsis thaliana GN=At4g32390 PE=3 SV=1 44 330 4.0E-56
sp|Q9LRP2|PT317_ARATH Probable sugar phosphate/phosphate translocator At3g17430 OS=Arabidopsis thaliana GN=At3g17430 PE=1 SV=1 52 330 1.0E-55
sp|Q9C8M1|PT153_ARATH Probable sugar phosphate/phosphate translocator At1g53660 OS=Arabidopsis thaliana GN=At1g53660 PE=3 SV=2 45 330 5.0E-55
sp|Q94EI9|PT314_ARATH Probable sugar phosphate/phosphate translocator At3g14410 OS=Arabidopsis thaliana GN=At3g14410 PE=2 SV=1 44 330 1.0E-49
sp|Q9LNH5|PT148_ARATH Probable sugar phosphate/phosphate translocator At1g48230 OS=Arabidopsis thaliana GN=At1g48230 PE=2 SV=2 52 330 2.0E-49
sp|Q9SFE9|GONS5_ARATH GDP-mannose transporter GONST5 OS=Arabidopsis thaliana GN=GONST5 PE=2 SV=1 43 333 3.0E-26
sp|Q9C521|UGAL1_ARATH UDP-galactose transporter 1 OS=Arabidopsis thaliana GN=UDP-GALT1 PE=2 SV=1 43 333 1.0E-23
sp|Q8H184|PT106_ARATH Probable sugar phosphate/phosphate translocator At1g06470 OS=Arabidopsis thaliana GN=At1g06470 PE=2 SV=1 14 346 5.0E-23
sp|Q6DBP3|PT505_ARATH Probable sugar phosphate/phosphate translocator At5g05820 OS=Arabidopsis thaliana GN=At5g05820 PE=2 SV=1 45 338 5.0E-23
sp|Q5XF09|PT311_ARATH Probable sugar phosphate/phosphate translocator At3g11320 OS=Arabidopsis thaliana GN=At3g11320 PE=2 SV=1 45 337 4.0E-21
sp|Q9LDH3|PT112_ARATH Probable sugar phosphate/phosphate translocator At1g12500 OS=Arabidopsis thaliana GN=At1g12500 PE=1 SV=1 23 337 2.0E-17
sp|Q9FYE5|PT504_ARATH Probable sugar phosphate/phosphate translocator At5g04160 OS=Arabidopsis thaliana GN=At5g04160 PE=2 SV=1 31 329 4.0E-17
sp|Q9SS40|PT310_ARATH Probable sugar phosphate/phosphate translocator At3g10290 OS=Arabidopsis thaliana GN=At3g10290 PE=3 SV=1 34 329 3.0E-16
sp|Q9NQQ7|S35C2_HUMAN Solute carrier family 35 member C2 OS=Homo sapiens GN=SLC35C2 PE=1 SV=2 45 326 1.0E-15
sp|Q8VCX2|S35C2_MOUSE Solute carrier family 35 member C2 OS=Mus musculus GN=Slc35c2 PE=1 SV=1 36 326 2.0E-12
sp|Q10354|YDB1_SCHPO Uncharacterized transporter C22E12.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC22E12.01 PE=3 SV=2 43 346 4.0E-11
sp|Q6ICL7|S35E4_HUMAN Solute carrier family 35 member E4 OS=Homo sapiens GN=SLC35E4 PE=2 SV=1 20 330 6.0E-10
sp|P49132|TPT_FLATR Triose phosphate/phosphate translocator, chloroplastic OS=Flaveria trinervia GN=TPT PE=2 SV=1 68 346 9.0E-10
sp|Q550W6|FUCT1_DICDI GDP-fucose transporter 1 OS=Dictyostelium discoideum GN=slc35c1 PE=3 SV=1 52 331 5.0E-09
sp|P21727|TPT_PEA Triose phosphate/phosphate translocator, chloroplastic OS=Pisum sativum PE=1 SV=1 25 346 1.0E-08
sp|Q84QU8|PPT2_ORYSJ Phosphoenolpyruvate/phosphate translocator 2, chloroplastic OS=Oryza sativa subsp. japonica GN=PPT2 PE=2 SV=1 48 337 2.0E-08
sp|Q69VR7|PPT1_ORYSJ Phosphoenolpyruvate/phosphate translocator 1, chloroplastic OS=Oryza sativa subsp. japonica GN=PPT1 PE=2 SV=1 48 337 2.0E-08
sp|Q5VQL3|PPT3_ORYSJ Phosphoenolpyruvate/phosphate translocator 3, chloroplastic OS=Oryza sativa subsp. japonica GN=PPT3 PE=2 SV=1 45 330 5.0E-08
sp|Q9ZSR7|TPT_ARATH Triose phosphate/phosphate translocator TPT, chloroplastic OS=Arabidopsis thaliana GN=TPT PE=1 SV=1 68 346 1.0E-07
sp|P49131|TPT_FLAPR Triose phosphate/phosphate translocator, chloroplastic OS=Flaveria pringlei GN=TPT PE=2 SV=1 68 345 1.0E-07
sp|P11869|TPT_SPIOL Triose phosphate/phosphate translocator, chloroplastic OS=Spinacia oleracea PE=1 SV=1 68 346 3.0E-07
sp|Q8RXN3|PPT1_ARATH Phosphoenolpyruvate/phosphate translocator 1, chloroplastic OS=Arabidopsis thaliana GN=PPT1 PE=1 SV=1 48 329 6.0E-07
sp|Q5RKL7|S35E4_RAT Solute carrier family 35 member E4 OS=Rattus norvegicus GN=Slc35e4 PE=2 SV=1 1 330 7.0E-07
sp|P49133|TPT_MAIZE Triose phosphate/phosphate translocator, chloroplastic OS=Zea mays GN=TPT PE=1 SV=1 68 346 7.0E-07
sp|Q9FTT3|TPT_ORYSJ Triose phosphate/phosphate translocator TPT, chloroplastic OS=Oryza sativa subsp. japonica GN=TPT PE=2 SV=1 20 345 3.0E-06
sp|P52178|TPT2_BRAOB Triose phosphate/phosphate translocator, non-green plastid, chloroplastic OS=Brassica oleracea var. botrytis GN=NGTPT PE=2 SV=1 48 329 8.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 40 0.5

Transmembrane Domains

Domain # Start End Length
1 41 63 22
2 73 95 22
3 108 127 19
4 137 159 22
5 166 183 17
6 187 209 22
7 222 244 22
8 259 281 22
9 286 308 22
10 312 329 17
11 360 382 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|1614
MQSEEKSRISGDVSRSDAMPTLPTVSPLAEKSQPPKAALHPALYVITWIGFSSSVILFNKWLLDTLNFRYPVILT
TYHLTFATIVTQVMARWTTLLDGRKSVKMTGRVYLRAVVPIGIFFSLSLICGNLTYLYLSVAFIQMLKATTPVAV
LISGWTLGVSQPNLKQFLNVSAIVVGVIIASIGEIHFVPIGVLYQIGGIIFEALRLTMVQRLLSSADFKMDPLVS
LYYFAPICAVMNGVVALIWEFPKVSMVDVYNVGLFTFFLNGLCAFMLNVSVVFLIGKTSAVVLTLCGVLKDIMLV
AASMAIWGTQVTPIQFFGYSIALGGMVYYKLGYEQLKGYIGEGNRQWAEFGARKPVLRKIAIITMSAFVLFTFFG
TLAPNYAPSYDPTKLTNEVTSRFGKVHAQ*
Coding >Ophun1|1614
ATGCAGTCCGAGGAAAAGAGTCGCATCTCGGGCGACGTCTCCCGTTCCGACGCCATGCCGACTCTGCCCACCGTC
AGCCCCTTGGCCGAGAAATCTCAGCCGCCCAAGGCTGCTCTGCACCCGGCTCTCTACGTCATCACCTGGATCGGC
TTCAGCTCCTCCGTCATCCTCTTCAACAAATGGCTCCTCGACACGCTCAATTTCCGCTACCCCGTCATCCTCACC
ACCTACCACCTTACCTTTGCCACCATCGTCACCCAGGTCATGGCCCGATGGACCACGCTGCTCGACGGTCGCAAG
TCTGTCAAGATGACGGGTCGCGTCTACCTGCGCGCCGTCGTCCCCATCGGCATCTTCTTTAGTCTGAGTCTCATC
TGCGGCAACCTGACATACCTTTACCTCTCCGTTGCCTTTATTCAGATGCTCAAGGCCACCACTCCCGTCGCTGTC
CTCATTTCCGGCTGGACTCTGGGAGTTTCGCAGCCCAACTTGAAGCAGTTCCTCAACGTCTCTGCCATTGTCGTC
GGTGTCATCATCGCTTCCATCGGCGAGATTCACTTCGTTCCCATCGGCGTTCTCTACCAGATCGGAGGCATCATC
TTCGAAGCCCTGCGCCTCACCATGGTTCAGCGCCTCCTGAGCTCGGCCGATTTCAAGATGGATCCTCTCGTCTCG
CTTTACTACTTTGCTCCCATCTGCGCCGTTATGAACGGAGTCGTTGCCCTCATCTGGGAGTTTCCCAAGGTCTCC
ATGGTTGACGTCTACAACGTTGGCCTCTTCACCTTCTTCCTCAACGGACTCTGCGCCTTTATGCTCAACGTCTCC
GTCGTCTTCTTGATTGGCAAGACGTCGGCTGTCGTCCTCACTCTCTGTGGCGTCCTCAAGGATATCATGCTTGTC
GCCGCCTCCATGGCCATCTGGGGTACTCAGGTGACACCCATACAGTTCTTCGGCTACTCGATCGCTCTGGGCGGC
ATGGTCTACTACAAGCTTGGCTACGAACAGCTCAAGGGCTACATTGGCGAGGGCAACCGCCAGTGGGCCGAATTT
GGAGCTCGCAAGCCCGTGCTGCGCAAGATTGCCATCATAACCATGTCAGCCTTTGTGCTCTTCACATTCTTCGGC
ACGCTTGCACCCAACTACGCTCCCAGCTATGACCCTACCAAGCTCACGAATGAGGTGACGAGCCGTTTCGGCAAG
GTTCACGCTCAATAA
Transcript >Ophun1|1614
ATGCAGTCCGAGGAAAAGAGTCGCATCTCGGGCGACGTCTCCCGTTCCGACGCCATGCCGACTCTGCCCACCGTC
AGCCCCTTGGCCGAGAAATCTCAGCCGCCCAAGGCTGCTCTGCACCCGGCTCTCTACGTCATCACCTGGATCGGC
TTCAGCTCCTCCGTCATCCTCTTCAACAAATGGCTCCTCGACACGCTCAATTTCCGCTACCCCGTCATCCTCACC
ACCTACCACCTTACCTTTGCCACCATCGTCACCCAGGTCATGGCCCGATGGACCACGCTGCTCGACGGTCGCAAG
TCTGTCAAGATGACGGGTCGCGTCTACCTGCGCGCCGTCGTCCCCATCGGCATCTTCTTTAGTCTGAGTCTCATC
TGCGGCAACCTGACATACCTTTACCTCTCCGTTGCCTTTATTCAGATGCTCAAGGCCACCACTCCCGTCGCTGTC
CTCATTTCCGGCTGGACTCTGGGAGTTTCGCAGCCCAACTTGAAGCAGTTCCTCAACGTCTCTGCCATTGTCGTC
GGTGTCATCATCGCTTCCATCGGCGAGATTCACTTCGTTCCCATCGGCGTTCTCTACCAGATCGGAGGCATCATC
TTCGAAGCCCTGCGCCTCACCATGGTTCAGCGCCTCCTGAGCTCGGCCGATTTCAAGATGGATCCTCTCGTCTCG
CTTTACTACTTTGCTCCCATCTGCGCCGTTATGAACGGAGTCGTTGCCCTCATCTGGGAGTTTCCCAAGGTCTCC
ATGGTTGACGTCTACAACGTTGGCCTCTTCACCTTCTTCCTCAACGGACTCTGCGCCTTTATGCTCAACGTCTCC
GTCGTCTTCTTGATTGGCAAGACGTCGGCTGTCGTCCTCACTCTCTGTGGCGTCCTCAAGGATATCATGCTTGTC
GCCGCCTCCATGGCCATCTGGGGTACTCAGGTGACACCCATACAGTTCTTCGGCTACTCGATCGCTCTGGGCGGC
ATGGTCTACTACAAGCTTGGCTACGAACAGCTCAAGGGCTACATTGGCGAGGGCAACCGCCAGTGGGCCGAATTT
GGAGCTCGCAAGCCCGTGCTGCGCAAGATTGCCATCATAACCATGTCAGCCTTTGTGCTCTTCACATTCTTCGGC
ACGCTTGCACCCAACTACGCTCCCAGCTATGACCCTACCAAGCTCACGAATGAGGTGACGAGCCGTTTCGGCAAG
GTTCACGCTCAATAA
Gene >Ophun1|1614
ATGCAGTCCGAGGAAAAGAGTCGCATCTCGGGCGACGTCTCCCGTTCCGACGCCATGCCGACTCTGCCCACCGTC
AGCCCCTTGGCCGAGAAATCTCAGCCGCCCAAGGCTGCTCTGCACCCGGCTCTCTACGTCATGTGAGTTTCTTCT
CTCGACATTACCCGTCGCCCGACGCCATTCAACTGACGCGTTCTCTGCAGCACCTGGATCGGCTTCAGCTCCTCC
GTCATCCTCTTCAACAAATGGCTCCTCGACACGCTCAATTTCCGTACGTGCACGAGAACCCCCTTCGACGCGCTC
GCTCCCGGCTAACGCTCCGCCTCAGGCTACCCCGTCATCCTCACCACCTACCACCTTACCTTTGCCACCATCGTC
ACCCAGGTCATGGCCCGATGGACCACGCTGCTCGACGGTCGCAAGTCTGTCAAGATGACGGGTCGCGTCTACCTG
CGCGCCGTCGTCCCCATCGGCATCTTCTTTAGTCTGAGTCTCATCTGCGGCAACCTGACATACCTTTACCTCTCC
GTTGCCTTTATTCAGATGCTCAAGGCCACCACTCCCGTCGCTGTCCTCATTTCCGGCTGGACTCTGGGAGTTTCG
CAGCCCAACTTGAAGCAGTTCCTCAACGTCTCTGCCATTGTCGTCGGTGTCATCATCGCTTCCATCGGCGAGATT
CACTTCGTTCCCATCGGCGTTCTCTACCAGATCGGAGGCATCATCTTCGAAGCCCTGCGCCTCACCATGGTTCAG
CGCCTCCTGAGCTCGGCCGATTTCAAGATGGATCCTCTCGTCTCGCTTTACTACTTTGCTCCCATCTGCGCCGTT
ATGAACGGAGTCGTTGCCCTCATCTGGGAGTTTCCCAAGGTCTCCATGGTTGACGTCTACAACGTTGGCCTCTTC
ACCTTCTTCCTCAACGGACTCTGCGCCTTTATGCTCAACGTCTCCGTCGTCTTCTTGGTGCGATGGCCCTCTTAT
TCCACCCACCTGAACAGTGCTGACCTCCTTTACCCAATAATGCAGATTGGCAAGACGTCGGCTGTCGTCCTCACT
CTCTGTGGCGTCCTCAAGGATATCATGCTTGTCGCCGCCTCCATGGCCATCTGGGGTACTCAGGTGACACCCATA
CAGTTCTTCGGCTACTCGATCGCTCTGGGCGGCATGGTCTACTACAAGCTTGGCTACGAACAGCTCAAGGGCTAC
ATTGGCGAGGGCAACCGCCAGTGGGCCGAATTTGGAGCTCGCAAGCCCGTGCTGCGCAAGATTGCCATCATAACC
ATGTCAGCCTTTGTGCTCTTCACATTCTTCGGCACGCTTGCACCCAACTACGCTCCCAGCTATGACCCTACCAAG
CTCACGAATGAGGTGACGAGCCGTTTCGGCAAGGTTCACGCTCAATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail