Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|1610
Gene name
LocationContig_1695:15..717
Strand+
Gene length (bp)702
Transcript length (bp)702
Coding sequence length (bp)702
Protein length (aa) 234

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup474
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5945
Ophiocordyceps australis map64 (Brazil) OphauB2|7945
Ophiocordyceps camponoti-floridani Ophcf2|06480
Ophiocordyceps camponoti-rufipedis Ophun1|1610 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|2376
Ophiocordyceps kimflemingae Ophio5|8585
Ophiocordyceps subramaniannii Hirsu2|10454

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|1610
MDEVGLSTRTAGPGGREGGGNGHADQQQQQQQQQQQQQQQQQQRQRPASRHAGVNGGHHGQQGHGGGKPFFASMN
PGFDVGYGPPRNDGAADPGAMAGFQPYGQGVVFGSPAGHVQQMQYQQGLMGRATPPMNYSFPPLQPGYGAYGGPA
SAVDQFRQQNMPNGSPIQPSSSSPQVPQMPGGQGPPPLGPPGFGLSMGGSYGYGGLAGMPNMGGYMPQEQQTSAR
RGRVRFCL*
Coding >Ophun1|1610
ATGGACGAGGTCGGCCTCTCCACCAGGACGGCCGGGCCGGGCGGCCGCGAAGGGGGTGGCAACGGTCACGCCGAC
CAGCAGCAGCAGCAACAACAACAACAGCAGCAGCAGCAGCAGCAGCAGCAGCAGAGGCAGCGGCCGGCTTCGAGG
CACGCCGGCGTCAATGGTGGCCACCACGGACAGCAGGGCCACGGCGGTGGCAAGCCCTTCTTCGCCTCCATGAAT
CCCGGCTTCGACGTGGGCTACGGGCCTCCCCGGAACGACGGCGCCGCCGATCCGGGCGCCATGGCCGGCTTCCAG
CCCTACGGTCAGGGCGTCGTCTTCGGCTCCCCGGCGGGACACGTGCAGCAGATGCAGTACCAGCAGGGCCTCATG
GGCAGGGCCACTCCGCCCATGAACTACAGCTTCCCGCCGCTCCAGCCCGGCTACGGGGCCTACGGCGGTCCGGCC
TCGGCGGTGGACCAGTTCCGGCAGCAGAACATGCCCAACGGGAGCCCCATACAGCCGTCTTCGTCTTCGCCGCAG
GTGCCCCAGATGCCGGGCGGCCAGGGACCTCCGCCGCTCGGGCCCCCGGGCTTCGGGCTCTCGATGGGCGGCTCG
TACGGATACGGCGGCCTGGCCGGCATGCCCAACATGGGCGGTTACATGCCACAGGAGCAGCAGACGAGTGCGAGG
CGCGGTCGTGTACGTTTTTGTCTTTGA
Transcript >Ophun1|1610
ATGGACGAGGTCGGCCTCTCCACCAGGACGGCCGGGCCGGGCGGCCGCGAAGGGGGTGGCAACGGTCACGCCGAC
CAGCAGCAGCAGCAACAACAACAACAGCAGCAGCAGCAGCAGCAGCAGCAGCAGAGGCAGCGGCCGGCTTCGAGG
CACGCCGGCGTCAATGGTGGCCACCACGGACAGCAGGGCCACGGCGGTGGCAAGCCCTTCTTCGCCTCCATGAAT
CCCGGCTTCGACGTGGGCTACGGGCCTCCCCGGAACGACGGCGCCGCCGATCCGGGCGCCATGGCCGGCTTCCAG
CCCTACGGTCAGGGCGTCGTCTTCGGCTCCCCGGCGGGACACGTGCAGCAGATGCAGTACCAGCAGGGCCTCATG
GGCAGGGCCACTCCGCCCATGAACTACAGCTTCCCGCCGCTCCAGCCCGGCTACGGGGCCTACGGCGGTCCGGCC
TCGGCGGTGGACCAGTTCCGGCAGCAGAACATGCCCAACGGGAGCCCCATACAGCCGTCTTCGTCTTCGCCGCAG
GTGCCCCAGATGCCGGGCGGCCAGGGACCTCCGCCGCTCGGGCCCCCGGGCTTCGGGCTCTCGATGGGCGGCTCG
TACGGATACGGCGGCCTGGCCGGCATGCCCAACATGGGCGGTTACATGCCACAGGAGCAGCAGACGAGTGCGAGG
CGCGGTCGTGTACGTTTTTGTCTTTGA
Gene >Ophun1|1610
ATGGACGAGGTCGGCCTCTCCACCAGGACGGCCGGGCCGGGCGGCCGCGAAGGGGGTGGCAACGGTCACGCCGAC
CAGCAGCAGCAGCAACAACAACAACAGCAGCAGCAGCAGCAGCAGCAGCAGCAGAGGCAGCGGCCGGCTTCGAGG
CACGCCGGCGTCAATGGTGGCCACCACGGACAGCAGGGCCACGGCGGTGGCAAGCCCTTCTTCGCCTCCATGAAT
CCCGGCTTCGACGTGGGCTACGGGCCTCCCCGGAACGACGGCGCCGCCGATCCGGGCGCCATGGCCGGCTTCCAG
CCCTACGGTCAGGGCGTCGTCTTCGGCTCCCCGGCGGGACACGTGCAGCAGATGCAGTACCAGCAGGGCCTCATG
GGCAGGGCCACTCCGCCCATGAACTACAGCTTCCCGCCGCTCCAGCCCGGCTACGGGGCCTACGGCGGTCCGGCC
TCGGCGGTGGACCAGTTCCGGCAGCAGAACATGCCCAACGGGAGCCCCATACAGCCGTCTTCGTCTTCGCCGCAG
GTGCCCCAGATGCCGGGCGGCCAGGGACCTCCGCCGCTCGGGCCCCCGGGCTTCGGGCTCTCGATGGGCGGCTCG
TACGGATACGGCGGCCTGGCCGGCATGCCCAACATGGGCGGTTACATGCCACAGGAGCAGCAGACGAGTGCGAGG
CGCGGTCGTGTACGTTTTTGTCTTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail