Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|1601
Gene name
LocationContig_169:17371..20003
Strand-
Gene length (bp)2632
Transcript length (bp)1575
Coding sequence length (bp)1575
Protein length (aa) 525

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02146 SIR2 Sir2 family 1.5E-56 182 362
PF00808 CBFD_NFYB_HMF Histone-like transcription factor (CBF/NF-Y) and archaeal histone 3.4E-16 13 79

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q5AW69|HST21_EMENI NAD-dependent protein deacetylase hst2-1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=AN7461 PE=3 SV=1 140 421 4.0E-124
sp|Q9USN7|HST2_SCHPO NAD-dependent protein deacetylase hst2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=hst2 PE=3 SV=1 158 420 9.0E-89
sp|Q7ZVK3|SIR2_DANRE NAD-dependent protein deacetylase sirtuin-2 OS=Danio rerio GN=sirt2 PE=2 SV=1 157 418 9.0E-85
sp|Q54QE6|SIR2A_DICDI NAD-dependent deacetylase sir2A OS=Dictyostelium discoideum GN=sir2A PE=2 SV=1 157 423 1.0E-82
sp|Q8R104|SIR3_MOUSE NAD-dependent protein deacetylase sirtuin-3 OS=Mus musculus GN=Sirt3 PE=1 SV=2 161 420 6.0E-82
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q5AW69|HST21_EMENI NAD-dependent protein deacetylase hst2-1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=AN7461 PE=3 SV=1 140 421 4.0E-124
sp|Q9USN7|HST2_SCHPO NAD-dependent protein deacetylase hst2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=hst2 PE=3 SV=1 158 420 9.0E-89
sp|Q7ZVK3|SIR2_DANRE NAD-dependent protein deacetylase sirtuin-2 OS=Danio rerio GN=sirt2 PE=2 SV=1 157 418 9.0E-85
sp|Q54QE6|SIR2A_DICDI NAD-dependent deacetylase sir2A OS=Dictyostelium discoideum GN=sir2A PE=2 SV=1 157 423 1.0E-82
sp|Q8R104|SIR3_MOUSE NAD-dependent protein deacetylase sirtuin-3 OS=Mus musculus GN=Sirt3 PE=1 SV=2 161 420 6.0E-82
sp|Q5RBF1|SIR2_PONAB NAD-dependent protein deacetylase sirtuin-2 OS=Pongo abelii GN=SIRT2 PE=2 SV=1 157 422 7.0E-82
sp|Q4R834|SIR2_MACFA NAD-dependent protein deacetylase sirtuin-2 OS=Macaca fascicularis GN=SIRT2 PE=2 SV=1 157 422 9.0E-82
sp|Q8IXJ6|SIR2_HUMAN NAD-dependent protein deacetylase sirtuin-2 OS=Homo sapiens GN=SIRT2 PE=1 SV=2 157 422 1.0E-81
sp|Q8VDQ8|SIR2_MOUSE NAD-dependent protein deacetylase sirtuin-2 OS=Mus musculus GN=Sirt2 PE=1 SV=2 157 422 2.0E-81
sp|P0CS88|HST22_EMENI NAD-dependent protein deacetylase hst2-2 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=AN11873 PE=3 SV=1 155 472 3.0E-81
sp|Q9NTG7|SIR3_HUMAN NAD-dependent protein deacetylase sirtuin-3, mitochondrial OS=Homo sapiens GN=SIRT3 PE=1 SV=2 161 420 4.0E-81
sp|Q5RJQ4|SIR2_RAT NAD-dependent protein deacetylase sirtuin-2 OS=Rattus norvegicus GN=Sirt2 PE=1 SV=1 157 422 6.0E-79
sp|Q9I7I7|SIRT2_DROME NAD-dependent protein deacetylase Sirt2 OS=Drosophila melanogaster GN=Sirt2 PE=3 SV=1 175 447 1.0E-75
sp|Q5A985|HST2_CANAL NAD-dependent protein deacetylase HST2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=HST2 PE=3 SV=1 162 421 2.0E-75
sp|P53686|HST2_YEAST NAD-dependent protein deacetylase HST2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HST2 PE=1 SV=1 151 432 1.0E-72
sp|Q57V41|SIR2_TRYB2 NAD-dependent protein deacetylase SIR2rp1 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) GN=SIR2rp1 PE=1 SV=1 161 385 1.0E-65
sp|Q54P49|SIR2C_DICDI NAD-dependent deacetylase sir2C OS=Dictyostelium discoideum GN=sir2C PE=2 SV=1 175 420 2.0E-63
sp|Q25337|SIR2_LEIMA NAD-dependent protein deacetylase SIR2rp1 OS=Leishmania major GN=SIR2rp1 PE=2 SV=2 155 393 5.0E-60
sp|Q54GV7|SIR2D_DICDI NAD-dependent deacetylase sir2D OS=Dictyostelium discoideum GN=sir2D PE=2 SV=1 156 413 1.0E-56
sp|Q60L58|SIR2_CAEBR NAD-dependent protein deacetylase sir-2.1 OS=Caenorhabditis briggsae GN=sir-2.1 PE=3 SV=1 174 412 4.0E-53
sp|Q21921|SIR2_CAEEL NAD-dependent protein deacetylase sir-2.1 OS=Caenorhabditis elegans GN=sir-2.1 PE=1 SV=1 174 412 8.0E-53
sp|Q923E4|SIR1_MOUSE NAD-dependent protein deacetylase sirtuin-1 OS=Mus musculus GN=Sirt1 PE=1 SV=2 150 464 1.0E-52
sp|Q96EB6|SIR1_HUMAN NAD-dependent protein deacetylase sirtuin-1 OS=Homo sapiens GN=SIRT1 PE=1 SV=2 150 464 4.0E-52
sp|Q9VK34|SIR2_DROME NAD-dependent histone deacetylase Sir2 OS=Drosophila melanogaster GN=Sir2 PE=1 SV=1 158 428 2.0E-46
sp|O59923|SIR2_CANAL NAD-dependent histone deacetylase SIR2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SIR2 PE=1 SV=2 143 413 5.0E-46
sp|C8V3W5|HST1_EMENI NAD-dependent protein deacetylase hst1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=AN10449 PE=3 SV=1 175 413 1.0E-44
sp|O94640|SIR2_SCHPO NAD-dependent histone deacetylase sir2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sir2 PE=1 SV=2 175 420 2.0E-42
sp|Q757M7|SIR2_ASHGO NAD-dependent histone deacetylase SIR2 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=SIR2 PE=3 SV=1 175 432 5.0E-42
sp|O14348|NC2B_SCHPO Negative cofactor 2 complex subunit beta OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ncb2 PE=3 SV=1 8 115 1.0E-39
sp|Q73KE1|NPD_TREDE NAD-dependent protein deacetylase OS=Treponema denticola (strain ATCC 35405 / CIP 103919 / DSM 14222) GN=cobB PE=3 SV=1 175 396 5.0E-39
sp|P53685|HST1_YEAST NAD-dependent protein deacetylase HST1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HST1 PE=1 SV=1 175 413 6.0E-39
sp|P06700|SIR2_YEAST NAD-dependent histone deacetylase SIR2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SIR2 PE=1 SV=1 175 413 7.0E-39
sp|Q9WYW0|NPD_THEMA NAD-dependent protein deacetylase OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=cobB PE=1 SV=1 175 381 3.0E-37
sp|Q6FWI7|SIR2_CANGA NAD-dependent histone deacetylase SIR2 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=SIR2 PE=3 SV=1 176 413 5.0E-37
sp|P33294|SIR2_KLULA NAD-dependent histone deacetylase SIR2 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=SIR2 PE=3 SV=2 175 432 1.0E-36
sp|Q5AQ47|HST1_CANAL NAD-dependent protein deacetylase HST1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=HST1 PE=3 SV=1 175 432 3.0E-36
sp|Q54LF0|SIR2B_DICDI NAD-dependent deacetylase sir2B OS=Dictyostelium discoideum GN=sir2B PE=2 SV=1 162 392 5.0E-33
sp|Q8R984|NPD2_CALS4 NAD-dependent protein deacetylase 2 OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=cobB2 PE=3 SV=1 158 370 7.0E-32
sp|Q97VX5|NPD_SULSO NAD-dependent protein deacetylase OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=cobB PE=1 SV=1 178 395 1.0E-31
sp|B5YJW3|NPD_THEYD NAD-dependent protein deacetylase OS=Thermodesulfovibrio yellowstonii (strain ATCC 51303 / DSM 11347 / YP87) GN=cobB PE=3 SV=1 178 411 4.0E-31
sp|Q639M6|NPD_BACCZ NAD-dependent protein deacetylase OS=Bacillus cereus (strain ZK / E33L) GN=cobB PE=3 SV=1 175 386 1.0E-30
sp|Q735N7|NPD_BACC1 NAD-dependent protein deacetylase OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=cobB PE=3 SV=1 175 386 2.0E-30
sp|Q81NT6|NPD_BACAN NAD-dependent protein deacetylase OS=Bacillus anthracis GN=cobB PE=3 SV=1 175 386 3.0E-30
sp|Q8XNS6|NPD_CLOPE NAD-dependent protein deacetylase OS=Clostridium perfringens (strain 13 / Type A) GN=cobB PE=3 SV=1 175 396 4.0E-30
sp|Q81BT4|NPD_BACCR NAD-dependent protein deacetylase OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=cobB PE=3 SV=1 175 386 4.0E-30
sp|Q4JBN2|NPD_SULAC NAD-dependent protein deacetylase OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=cobB PE=3 SV=2 178 367 6.0E-30
sp|Q974M6|NPD_SULTO NAD-dependent protein deacetylase OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=cobB PE=3 SV=2 178 382 7.0E-30
sp|Q6A5T5|NPD_PROAC NAD-dependent protein deacetylase OS=Propionibacterium acnes (strain KPA171202 / DSM 16379) GN=cobB PE=3 SV=1 178 395 1.0E-29
sp|O30124|NPD2_ARCFU NAD-dependent protein deacylase 2 OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=cobB2 PE=1 SV=1 175 396 5.0E-29
sp|Q7P1B9|NPD_CHRVO NAD-dependent protein deacetylase OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=cobB PE=3 SV=1 175 380 6.0E-29
sp|Q6HH09|NPD_BACHK NAD-dependent protein deacetylase OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=cobB PE=3 SV=1 175 386 6.0E-29
sp|Q8ZU41|NPD1_PYRAE NAD-dependent protein deacetylase 1 OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=cobB1 PE=3 SV=1 178 380 1.0E-28
sp|Q5JG47|NPD_THEKO NAD-dependent protein deacylase OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=cobB PE=3 SV=1 178 385 3.0E-28
sp|Q5L014|NPD1_GEOKA NAD-dependent protein deacetylase 1 OS=Geobacillus kaustophilus (strain HTA426) GN=cobB1 PE=3 SV=1 175 382 8.0E-28
sp|O07595|NPD_BACSU NAD-dependent protein deacetylase OS=Bacillus subtilis (strain 168) GN=cobB PE=3 SV=1 175 382 9.0E-28
sp|A8MBU4|NPD_CALMQ NAD-dependent protein deacetylase OS=Caldivirga maquilingensis (strain ATCC 700844 / DSM 13496 / JCM 10307 / IC-167) GN=cobB PE=3 SV=1 175 382 2.0E-27
sp|A0R2N3|NDP_MYCS2 NAD-dependent protein deacylase Sir2 OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=sir2 PE=1 SV=1 176 383 2.0E-27
sp|Q67KQ0|NPD_SYMTH NAD-dependent protein deacetylase OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=cobB PE=3 SV=1 175 381 4.0E-27
sp|Q899G3|NPD_CLOTE NAD-dependent protein deacetylase OS=Clostridium tetani (strain Massachusetts / E88) GN=cobB PE=3 SV=1 176 380 4.0E-27
sp|Q97MB4|NPD_CLOAB NAD-dependent protein deacetylase OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=cobB PE=3 SV=1 177 380 2.0E-26
sp|Q8U1Q1|NPD_PYRFU NAD-dependent protein deacylase OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=cobB PE=3 SV=2 178 372 4.0E-26
sp|Q8NSM4|NPD_CORGL NAD-dependent protein deacylase OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=cobB PE=3 SV=1 175 384 4.0E-26
sp|Q8ZT00|NPD2_PYRAE NAD-dependent protein deacylase 2 OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=cobB2 PE=3 SV=1 175 382 3.0E-25
sp|Q8ELR0|NPD_OCEIH NAD-dependent protein deacetylase OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=cobB PE=3 SV=1 177 382 3.0E-25
sp|Q9UZE7|NPD_PYRAB NAD-dependent protein deacylase OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=cobB PE=3 SV=1 175 372 4.0E-25
sp|C6A243|NPD_THESM NAD-dependent protein deacylase OS=Thermococcus sibiricus (strain MM 739 / DSM 12597) GN=cobB PE=3 SV=1 177 411 6.0E-25
sp|P9WGG3|NPD_MYCTU NAD-dependent protein deacylase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=cobB PE=1 SV=1 176 369 8.0E-25
sp|P9WGG2|NPD_MYCTO NAD-dependent protein deacylase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=cobB PE=3 SV=1 176 369 8.0E-25
sp|P66814|NPD_MYCBO NAD-dependent protein deacylase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=cobB PE=3 SV=1 176 369 8.0E-25
sp|B0RM75|NPD_XANCB NAD-dependent protein deacetylase OS=Xanthomonas campestris pv. campestris (strain B100) GN=cobB PE=3 SV=1 175 397 1.0E-24
sp|P49592|NC2B_ARATH Protein Dr1 homolog OS=Arabidopsis thaliana GN=DR1 PE=2 SV=1 8 99 1.0E-24
sp|Q8PDM9|NPD_XANCP NAD-dependent protein deacetylase OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=cobB PE=3 SV=1 175 397 1.0E-24
sp|Q4UZX0|NPD_XANC8 NAD-dependent protein deacetylase OS=Xanthomonas campestris pv. campestris (strain 8004) GN=cobB PE=3 SV=1 175 397 1.0E-24
sp|Q73WM7|NPD_MYCPA NAD-dependent protein deacylase OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=cobB PE=3 SV=1 176 369 2.0E-24
sp|O58669|NPD_PYRHO NAD-dependent protein deacylase OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=cobB PE=3 SV=1 175 385 2.0E-24
sp|Q55DJ5|NC2B_DICDI Protein Dr1 homolog OS=Dictyostelium discoideum GN=dr1 PE=3 SV=1 10 99 5.0E-24
sp|Q8Y015|NPD_RALSO NAD-dependent protein deacylase OS=Ralstonia solanacearum (strain GMI1000) GN=cobB PE=3 SV=1 175 379 1.0E-23
sp|O28597|NPD1_ARCFU NAD-dependent protein deacylase 1 OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=cobB1 PE=1 SV=1 175 372 2.0E-23
sp|A0QC96|NPD2_MYCA1 NAD-dependent protein deacylase 2 OS=Mycobacterium avium (strain 104) GN=cobB2 PE=3 SV=1 179 369 2.0E-23
sp|Q9Y6E7|SIR4_HUMAN NAD-dependent protein lipoamidase sirtuin-4, mitochondrial OS=Homo sapiens GN=SIRT4 PE=1 SV=1 175 394 2.0E-23
sp|Q1JQC6|SIR4_BOVIN NAD-dependent protein lipoamidase sirtuin-4, mitochondrial OS=Bos taurus GN=SIRT4 PE=2 SV=1 175 397 4.0E-23
sp|Q5XI68|NC2B_RAT Protein Dr1 OS=Rattus norvegicus GN=Dr1 PE=2 SV=1 7 114 5.0E-23
sp|Q91WV0|NC2B_MOUSE Protein Dr1 OS=Mus musculus GN=Dr1 PE=1 SV=1 7 114 5.0E-23
sp|Q01658|NC2B_HUMAN Protein Dr1 OS=Homo sapiens GN=DR1 PE=1 SV=1 7 114 5.0E-23
sp|Q5ZMV3|NC2B_CHICK Protein Dr1 OS=Gallus gallus GN=DR1 PE=2 SV=1 7 114 5.0E-23
sp|Q89EA6|NPD2_BRADU NAD-dependent protein deacetylase 2 OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=cobB2 PE=3 SV=2 175 397 6.0E-23
sp|Q8PQK3|NPD_XANAC NAD-dependent protein deacetylase OS=Xanthomonas axonopodis pv. citri (strain 306) GN=cobB PE=3 SV=2 175 397 9.0E-23
sp|Q8CNF4|NPD_STAES NAD-dependent protein deacetylase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=cobB PE=3 SV=1 175 366 2.0E-22
sp|Q6N6U0|NPD_RHOPA NAD-dependent protein deacetylase OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=cobB PE=3 SV=1 177 382 2.0E-22
sp|Q9CBW6|NPD_MYCLE NAD-dependent protein deacylase OS=Mycobacterium leprae (strain TN) GN=cobB PE=3 SV=1 176 369 3.0E-22
sp|Q5KZE8|NPD2_GEOKA NAD-dependent protein deacetylase 2 OS=Geobacillus kaustophilus (strain HTA426) GN=cobB2 PE=3 SV=1 162 397 4.0E-22
sp|Q89LY4|NPD1_BRADU NAD-dependent protein deacetylase 1 OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=cobB1 PE=3 SV=1 175 397 5.0E-22
sp|Q5V4Q5|NPD_HALMA NAD-dependent protein deacetylase OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=cobB PE=3 SV=1 157 391 9.0E-22
sp|Q92317|NCB2_YEAST Negative cofactor 2 complex subunit beta OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NCB2 PE=1 SV=1 7 115 1.0E-21
sp|B8ARK7|SIR1_ORYSI NAD-dependent protein deacetylase SRT1 OS=Oryza sativa subsp. indica GN=SRT1 PE=2 SV=1 175 382 1.0E-21
sp|Q5HM33|NPD_STAEQ NAD-dependent protein deacetylase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=cobB PE=3 SV=1 175 366 1.0E-21
sp|Q8TWG0|NPD_METKA NAD-dependent protein deacylase OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=cobB PE=3 SV=1 177 367 1.0E-21
sp|E2RDZ6|SIR5_CANLF NAD-dependent protein deacylase sirtuin-5, mitochondrial OS=Canis lupus familiaris GN=SIRT5 PE=3 SV=1 175 382 2.0E-21
sp|Q6GEN2|NPD_STAAR NAD-dependent protein deacetylase OS=Staphylococcus aureus (strain MRSA252) GN=cobB PE=3 SV=1 175 383 2.0E-21
sp|Q8R216|SIR4_MOUSE NAD-dependent protein lipoamidase sirtuin-4, mitochondrial OS=Mus musculus GN=Sirt4 PE=1 SV=3 175 361 2.0E-21
sp|Q9FE17|SIR1_ARATH NAD-dependent protein deacetylase SRT1 OS=Arabidopsis thaliana GN=SRT1 PE=2 SV=1 175 383 2.0E-21
sp|Q9YB13|NPD_AERPE NAD-dependent protein deacylase OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=cobB PE=3 SV=2 178 367 3.0E-21
sp|Q3ZBQ0|SIR5_BOVIN NAD-dependent protein deacylase sirtuin-5, mitochondrial OS=Bos taurus GN=SIRT5 PE=2 SV=1 175 382 4.0E-21
sp|Q8REC3|NPD_FUSNN NAD-dependent protein deacetylase OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) GN=cobB PE=3 SV=1 175 380 6.0E-21
sp|Q8Y3U2|NPD_LISMO NAD-dependent protein deacetylase OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=cobB PE=3 SV=1 176 385 7.0E-21
sp|Q839C6|NPD_ENTFA NAD-dependent protein deacetylase OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=cobB PE=3 SV=1 174 366 9.0E-21
sp|O67919|NPD_AQUAE NAD-dependent protein deacylase OS=Aquifex aeolicus (strain VF5) GN=cobB PE=3 SV=1 177 378 9.0E-21
sp|Q71W25|NPD_LISMF NAD-dependent protein deacetylase OS=Listeria monocytogenes serotype 4b (strain F2365) GN=cobB PE=3 SV=1 175 384 9.0E-21
sp|Q8NVC8|NPD_STAAW NAD-dependent protein deacetylase OS=Staphylococcus aureus (strain MW2) GN=cobB PE=3 SV=1 175 383 1.0E-20
sp|Q6G7B7|NPD_STAAS NAD-dependent protein deacetylase OS=Staphylococcus aureus (strain MSSA476) GN=cobB PE=3 SV=1 175 383 1.0E-20
sp|E9GD30|SIR5_DAPPU NAD-dependent protein deacylase OS=Daphnia pulex GN=DAPPUDRAFT_195469 PE=3 SV=1 177 382 1.0E-20
sp|Q6DHI5|SIR5_DANRE NAD-dependent protein deacylase sirtuin-5, mitochondrial OS=Danio rerio GN=sirt5 PE=1 SV=1 175 382 2.0E-20
sp|Q5R6G3|SIR5_PONAB NAD-dependent protein deacylase sirtuin-5, mitochondrial OS=Pongo abelii GN=SIRT5 PE=2 SV=1 175 382 2.0E-20
sp|P66816|NPD_STAAN NAD-dependent protein deacetylase OS=Staphylococcus aureus (strain N315) GN=cobB PE=3 SV=1 175 383 2.0E-20
sp|P66815|NPD_STAAM NAD-dependent protein deacetylase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=cobB PE=1 SV=1 175 383 2.0E-20
sp|Q72IV5|NPD_THET2 NAD-dependent protein deacylase OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=cobB PE=3 SV=1 175 366 3.0E-20
sp|C1DBX3|NPD_LARHH NAD-dependent protein deacetylase OS=Laribacter hongkongensis (strain HLHK9) GN=cobB PE=3 SV=1 175 382 3.0E-20
sp|Q5HE07|NPD_STAAC NAD-dependent protein deacetylase OS=Staphylococcus aureus (strain COL) GN=cobB PE=3 SV=1 175 383 3.0E-20
sp|Q9NXA8|SIR5_HUMAN NAD-dependent protein deacylase sirtuin-5, mitochondrial OS=Homo sapiens GN=SIRT5 PE=1 SV=2 175 382 4.0E-20
sp|Q5A1W9|HST3_CANAL NAD-dependent histone deacetylase HST3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=HST3 PE=3 SV=1 145 360 5.0E-20
sp|Q53700|NPD_STAA8 NAD-dependent protein deacetylase OS=Staphylococcus aureus (strain NCTC 8325) GN=cobB PE=3 SV=1 175 383 5.0E-20
sp|Q5SIH7|NPD_THET8 NAD-dependent protein deacylase OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=cobB PE=3 SV=1 175 366 6.0E-20
sp|Q8FRV5|NPD2_COREF NAD-dependent protein deacylase 2 OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) GN=cobB2 PE=3 SV=2 175 367 7.0E-20
sp|Q9VJQ5|NC2B_DROME Protein Dr1 OS=Drosophila melanogaster GN=NC2beta PE=1 SV=1 9 114 7.0E-20
sp|Q68FX9|SIR5_RAT NAD-dependent protein deacylase sirtuin-5, mitochondrial OS=Rattus norvegicus GN=Sirt5 PE=2 SV=1 151 382 7.0E-20
sp|F7EZ75|SIR5_MACMU NAD-dependent protein deacylase sirtuin-5, mitochondrial OS=Macaca mulatta GN=SIRT5 PE=3 SV=1 175 382 1.0E-19
sp|Q8K2C6|SIR5_MOUSE NAD-dependent protein deacylase sirtuin-5, mitochondrial OS=Mus musculus GN=Sirt5 PE=1 SV=1 175 382 1.0E-19
sp|E1BRE2|SIR5_CHICK NAD-dependent protein deacylase sirtuin-5, mitochondrial OS=Gallus gallus GN=SIRT5 PE=3 SV=1 175 382 1.0E-19
sp|Q927A7|NPD_LISIN NAD-dependent protein deacetylase OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=cobB PE=3 SV=1 175 385 1.0E-19
sp|Q5HZN8|SIR5A_XENLA NAD-dependent protein deacylase sirtuin-5A, mitochondrial OS=Xenopus laevis GN=sirt5-a PE=2 SV=1 175 382 2.0E-19
sp|A9SDL4|SIR5_PHYPA NAD-dependent protein deacylase OS=Physcomitrella patens subsp. patens GN=SRT1505 PE=3 SV=1 175 363 2.0E-19
sp|Q6MJJ2|NPD_BDEBA NAD-dependent protein deacylase OS=Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100) GN=cobB PE=3 SV=1 175 374 2.0E-19
sp|Q88BY5|NPD_PSEPK NAD-dependent protein deacylase OS=Pseudomonas putida (strain KT2440) GN=cobB PE=3 SV=1 175 395 2.0E-19
sp|Q8R9N6|NPD1_CALS4 NAD-dependent protein deacylase 1 OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=cobB1 PE=3 SV=1 172 372 3.0E-19
sp|P53687|HST3_YEAST NAD-dependent histone deacetylase HST3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HST3 PE=1 SV=1 175 360 4.0E-19
sp|F4P804|SIR4_BATDJ NAD-dependent protein deacylase SIR4 OS=Batrachochytrium dendrobatidis (strain JAM81 / FGSC 10211) GN=BATDEDRAFT_20316 PE=3 SV=1 176 397 5.0E-19
sp|Q8CJM9|NPD2_STRCO NAD-dependent protein deacetylase 2 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=cobB2 PE=3 SV=1 177 382 6.0E-19
sp|F7DKV7|SIR5_XENTR NAD-dependent protein deacylase sirtuin-5, mitochondrial OS=Xenopus tropicalis GN=sirt5 PE=3 SV=1 175 382 6.0E-19
sp|Q5WKC8|NPD_BACSK NAD-dependent protein deacetylase OS=Bacillus clausii (strain KSM-K16) GN=cobB PE=3 SV=1 175 399 9.0E-19
sp|A9UVV1|SIR4_MONBE NAD-dependent protein deacylase SIR4 OS=Monosiga brevicollis GN=15984 PE=3 SV=1 177 380 3.0E-18
sp|Q7VX46|NPD_BORPE NAD-dependent protein deacetylase OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=cobB PE=3 SV=1 162 397 3.0E-18
sp|Q7WLE5|NPD_BORBR NAD-dependent protein deacetylase OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=cobB PE=3 SV=1 162 397 3.0E-18
sp|Q88ZA0|NPD_LACPL NAD-dependent protein deacetylase OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=cobB PE=3 SV=1 175 366 3.0E-18
sp|Q9KEE5|NPD_BACHD NAD-dependent protein deacetylase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=cobB PE=3 SV=1 175 380 4.0E-18
sp|Q9RYD4|NPD_DEIRA NAD-dependent protein deacylase OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=cobB PE=3 SV=1 179 366 7.0E-18
sp|Q8IRR5|SIR4_DROME NAD-dependent protein deacylase Sirt4 OS=Drosophila melanogaster GN=Sirt4 PE=2 SV=2 162 336 7.0E-18
sp|Q8N6T7|SIR6_HUMAN NAD-dependent protein deacetylase sirtuin-6 OS=Homo sapiens GN=SIRT6 PE=1 SV=2 177 412 9.0E-18
sp|Q885X7|NPD2_PSESM NAD-dependent protein deacylase 2 OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=cobB2 PE=3 SV=1 175 371 2.0E-17
sp|Q20480|SIR41_CAEEL NAD-dependent protein deacylase sir-2.2 OS=Caenorhabditis elegans GN=sir-2.2 PE=3 SV=1 157 381 3.0E-17
sp|Q68F47|SIR5B_XENLA NAD-dependent protein deacylase sirtuin-5B, mitochondrial OS=Xenopus laevis GN=sirt5-b PE=2 SV=1 175 382 4.0E-17
sp|Q9I4E1|NPD2_PSEAE NAD-dependent protein deacylase 2 OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=cobB2 PE=3 SV=1 175 395 5.0E-17
sp|B2RZ55|SIR7_RAT NAD-dependent protein deacetylase sirtuin-7 OS=Rattus norvegicus GN=Sirt7 PE=2 SV=1 160 412 1.0E-16
sp|A9A0B2|NPD_DESOH NAD-dependent protein deacylase OS=Desulfococcus oleovorans (strain DSM 6200 / Hxd3) GN=cobB PE=3 SV=1 176 380 1.0E-16
sp|P59941|SIR6_MOUSE NAD-dependent protein deacetylase sirtuin-6 OS=Mus musculus GN=Sirt6 PE=1 SV=1 177 412 1.0E-16
sp|Q94AQ6|SIR4_ARATH NAD-dependent protein deacylase SRT2 OS=Arabidopsis thaliana GN=SRT2 PE=2 SV=1 176 397 2.0E-16
sp|Q9VH08|SIR6_DROME NAD-dependent protein deacetylase Sirt6 OS=Drosophila melanogaster GN=Sirt6 PE=2 SV=1 176 367 4.0E-16
sp|Q0P595|SIR7_BOVIN NAD-dependent protein deacetylase sirtuin-7 OS=Bos taurus GN=SIRT7 PE=2 SV=1 160 412 9.0E-16
sp|Q882K4|NPD3_PSESM NAD-dependent protein deacetylase 3 OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=cobB3 PE=3 SV=1 157 397 1.0E-15
sp|Q9RL35|NPD1_STRCO NAD-dependent protein deacetylase 1 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=cobB1 PE=3 SV=1 177 335 2.0E-15
sp|Q8BKJ9|SIR7_MOUSE NAD-dependent protein deacetylase sirtuin-7 OS=Mus musculus GN=Sirt7 PE=1 SV=2 160 412 2.0E-15
sp|Q9NRC8|SIR7_HUMAN NAD-dependent protein deacetylase sirtuin-7 OS=Homo sapiens GN=SIRT7 PE=1 SV=1 154 412 2.0E-15
sp|Q9I4L0|NPD1_PSEAE NAD-dependent protein deacylase 1 OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=cobB1 PE=3 SV=1 175 372 4.0E-15
sp|A0QDH4|NPD1_MYCA1 NAD-dependent protein deacetylase 1 OS=Mycobacterium avium (strain 104) GN=cobB1 PE=3 SV=1 175 361 7.0E-15
sp|Q9A2S6|NPD_CAUCR NAD-dependent protein deacylase OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=cobB PE=3 SV=1 176 366 8.0E-15
sp|Q8FUC8|NPD1_COREF NAD-dependent protein deacetylase 1 OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) GN=cobB1 PE=3 SV=2 177 380 1.0E-14
sp|Q8F3Z6|NPD_LEPIN NAD-dependent protein deacylase OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=cobB PE=3 SV=1 175 360 1.0E-14
sp|Q72RR0|NPD_LEPIC NAD-dependent protein deacylase OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) GN=cobB PE=3 SV=1 175 360 2.0E-14
sp|Q8IE47|SIR5_PLAF7 NAD-dependent protein deacylase Sir2A OS=Plasmodium falciparum (isolate 3D7) GN=Sir2A PE=1 SV=1 175 378 2.0E-14
sp|A8NWP2|SIR5_COPC7 NAD-dependent protein deacylase OS=Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003) GN=CC1G_00083 PE=3 SV=2 175 412 2.0E-14
sp|Q9KRX4|NPD_VIBCH NAD-dependent protein deacylase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=cobB PE=3 SV=2 171 366 2.0E-14
sp|Q584D5|SIR5_TRYB2 NAD-dependent protein deacylase SIR2rp3 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) GN=SIR2rp3 PE=3 SV=1 173 366 2.0E-14
sp|Q95Q89|SIR24_CAEEL NAD-dependent protein deacetylase sir-2.4 OS=Caenorhabditis elegans GN=sir-2.4 PE=3 SV=2 175 367 3.0E-14
sp|Q9CM50|NPD_PASMU NAD-dependent protein deacylase OS=Pasteurella multocida (strain Pm70) GN=cobB PE=3 SV=1 176 382 4.0E-14
sp|Q20481|SIR42_CAEEL NAD-dependent protein deacylase sir-2.3 OS=Caenorhabditis elegans GN=sir-2.3 PE=3 SV=1 157 381 4.0E-14
sp|Q4Q2Y6|SIR5_LEIMA NAD-dependent protein deacylase SIR2rp3 OS=Leishmania major GN=SIR2rp3 PE=3 SV=1 177 366 5.0E-14
sp|Q8A3H9|NPD_BACTN NAD-dependent protein deacylase OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=cobB PE=3 SV=1 175 411 5.0E-14
sp|Q9ZAB8|NPD_AGGAC NAD-dependent protein deacylase OS=Aggregatibacter actinomycetemcomitans GN=cobB PE=3 SV=1 178 366 5.0E-14
sp|Q669P6|NPD_YERPS NAD-dependent protein deacylase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=cobB PE=3 SV=2 177 382 1.0E-13
sp|Q8ZFR1|NPD_YERPE NAD-dependent protein deacylase OS=Yersinia pestis GN=cobB PE=3 SV=2 177 382 1.0E-13
sp|P0A2F2|NPD_SALTY NAD-dependent protein deacylase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=cobB PE=1 SV=2 176 382 1.0E-13
sp|P0A2F3|NPD_SALTI NAD-dependent protein deacylase OS=Salmonella typhi GN=cobB PE=3 SV=2 176 382 1.0E-13
sp|Q7UFQ9|NPD_RHOBA NAD-dependent protein deacylase OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=cobB PE=3 SV=1 176 382 3.0E-13
sp|Q9UR39|HST4_SCHPO NAD-dependent protein deacetylase hst4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=hst4 PE=2 SV=1 175 335 5.0E-13
sp|Q9SLG0|NFYB1_ARATH Nuclear transcription factor Y subunit B-1 OS=Arabidopsis thaliana GN=NFYB1 PE=1 SV=2 11 110 6.0E-13
sp|Q55DB0|SIR2E_DICDI NAD-dependent deacetylase sir2E OS=Dictyostelium discoideum GN=sir2E PE=2 SV=2 175 360 2.0E-12
sp|Q5BE04|HST4_EMENI NAD-dependent protein deacetylase hst4 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=AN1226 PE=3 SV=1 175 360 2.0E-12
sp|Q87W79|NPD4_PSESM NAD-dependent protein deacylase 4 OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=cobB4 PE=3 SV=1 175 411 3.0E-12
sp|Q607X6|NPD_METCA NAD-dependent protein deacylase OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=cobB PE=3 SV=1 175 370 5.0E-12
sp|Q7MKT7|NPD_VIBVY NAD-dependent protein deacylase OS=Vibrio vulnificus (strain YJ016) GN=cobB PE=3 SV=1 173 366 7.0E-12
sp|Q8D9J9|NPD_VIBVU NAD-dependent protein deacylase OS=Vibrio vulnificus (strain CMCP6) GN=cobB PE=3 SV=1 173 366 7.0E-12
sp|O25849|NPD_HELPY NAD-dependent protein deacylase OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=cobB PE=3 SV=2 175 366 3.0E-11
sp|P53688|HST4_YEAST NAD-dependent histone deacetylase HST4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HST4 PE=1 SV=1 175 360 3.0E-11
sp|Q87PH8|NPD_VIBPA NAD-dependent protein deacylase OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=cobB PE=3 SV=1 173 382 7.0E-11
sp|P25210|NFYB_PETMA Nuclear transcription factor Y subunit beta OS=Petromyzon marinus GN=NFYB PE=2 SV=1 11 120 9.0E-11
sp|P25209|NFYB_MAIZE Nuclear transcription factor Y subunit B OS=Zea mays GN=NFY2 PE=2 SV=1 11 143 1.0E-10
sp|Q9ZJW8|NPD_HELPJ NAD-dependent protein deacylase OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=cobB PE=3 SV=1 175 366 1.0E-10
sp|O23310|NFYB3_ARATH Nuclear transcription factor Y subunit B-3 OS=Arabidopsis thaliana GN=NFYB3 PE=2 SV=1 4 102 2.0E-10
sp|Q8VYK4|NFYB8_ARATH Nuclear transcription factor Y subunit B-8 OS=Arabidopsis thaliana GN=NFYB8 PE=2 SV=1 4 116 2.0E-10
sp|Q60EQ4|NFYB3_ORYSJ Nuclear transcription factor Y subunit B-3 OS=Oryza sativa subsp. japonica GN=NFYB3 PE=1 SV=2 11 102 5.0E-10
sp|Q67XJ2|NFYBA_ARATH Nuclear transcription factor Y subunit B-10 OS=Arabidopsis thaliana GN=NFYB10 PE=2 SV=1 11 102 5.0E-10
sp|P25207|NFYB_CHICK Nuclear transcription factor Y subunit beta OS=Gallus gallus GN=NFYB PE=2 SV=2 1 159 7.0E-10
sp|P25208|NFYB_HUMAN Nuclear transcription factor Y subunit beta OS=Homo sapiens GN=NFYB PE=1 SV=2 1 104 1.0E-09
sp|P63140|NFYB_RAT Nuclear transcription factor Y subunit beta OS=Rattus norvegicus GN=Nfyb PE=1 SV=1 1 104 1.0E-09
sp|P63139|NFYB_MOUSE Nuclear transcription factor Y subunit beta OS=Mus musculus GN=Nfyb PE=1 SV=1 1 104 1.0E-09
sp|Q32KW0|NFYB_BOVIN Nuclear transcription factor Y subunit beta OS=Bos taurus GN=NFYB PE=2 SV=1 1 104 1.0E-09
sp|Q6RG77|NFYB_HORSE Nuclear transcription factor Y subunit beta OS=Equus caballus GN=NFYB PE=2 SV=1 1 104 1.0E-09
sp|F7D4X9|SIR5_MONDO NAD-dependent protein deacylase sirtuin-5, mitochondrial OS=Monodelphis domestica GN=SIRT5 PE=3 SV=1 175 380 1.0E-09
sp|Q88A13|NPD1_PSESM NAD-dependent protein deacylase 1 OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=cobB1 PE=3 SV=1 189 369 1.0E-09
sp|Q9SIT9|NFYB7_ARATH Nuclear transcription factor Y subunit B-7 OS=Arabidopsis thaliana GN=NFYB7 PE=2 SV=1 11 88 2.0E-09
sp|Q7VIN2|NPD_HELHP NAD-dependent protein deacylase OS=Helicobacter hepaticus (strain ATCC 51449 / 3B1) GN=cobB PE=3 SV=1 176 360 2.0E-09
sp|Q9FGJ3|NFYB2_ARATH Nuclear transcription factor Y subunit B-2 OS=Arabidopsis thaliana GN=NFYB2 PE=2 SV=1 11 105 3.0E-09
sp|Q5QMG3|NFYB2_ORYSJ Nuclear transcription factor Y subunit B-2 OS=Oryza sativa subsp. japonica GN=NFYB2 PE=2 SV=1 11 101 3.0E-09
sp|O04027|NFYB4_ARATH Nuclear transcription factor Y subunit B-4 OS=Arabidopsis thaliana GN=NFYB4 PE=1 SV=1 9 105 4.0E-09
sp|Q84W66|NFYB6_ARATH Nuclear transcription factor Y subunit B-6 OS=Arabidopsis thaliana GN=NFYB6 PE=1 SV=2 10 105 4.0E-09
sp|Q9SFD8|NFYB9_ARATH Nuclear transcription factor Y subunit B-9 OS=Arabidopsis thaliana GN=NFYB9 PE=1 SV=2 11 105 4.0E-09
sp|O82248|NFYB5_ARATH Nuclear transcription factor Y subunit B-5 OS=Arabidopsis thaliana GN=NFYB5 PE=2 SV=1 11 87 7.0E-09
sp|Q54WV0|NFYB_DICDI Nuclear transcription factor Y subunit beta OS=Dictyostelium discoideum GN=nfyB PE=3 SV=1 11 108 2.0E-08
sp|Q5R4W3|DPOE3_PONAB DNA polymerase epsilon subunit 3 OS=Pongo abelii GN=POLE3 PE=2 SV=1 10 111 2.0E-08
sp|Q9NRF9|DPOE3_HUMAN DNA polymerase epsilon subunit 3 OS=Homo sapiens GN=POLE3 PE=1 SV=1 10 111 2.0E-08
sp|Q3SZN5|DPOE3_BOVIN DNA polymerase epsilon subunit 3 OS=Bos taurus GN=POLE3 PE=2 SV=1 10 111 2.0E-08
sp|Q65XK1|NFYB4_ORYSJ Nuclear transcription factor Y subunit B-4 OS=Oryza sativa subsp. japonica GN=NFYB4 PE=2 SV=2 11 88 3.0E-08
sp|Q642A5|DPOE3_RAT DNA polymerase epsilon subunit 3 OS=Rattus norvegicus GN=Pole3 PE=1 SV=1 10 111 4.0E-08
sp|P36611|HAP3_SCHPO Transcriptional activator hap3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=hap3 PE=3 SV=1 14 102 5.0E-08
sp|Q9JKP7|DPOE3_MOUSE DNA polymerase epsilon subunit 3 OS=Mus musculus GN=Pole3 PE=1 SV=1 10 111 1.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0070403 NAD+ binding Yes
GO:0097159 organic cyclic compound binding No
GO:0003674 molecular_function No
GO:0000166 nucleotide binding No
GO:0036094 small molecule binding No
GO:1901363 heterocyclic compound binding No
GO:0043167 ion binding No
GO:0005488 binding No
GO:0051287 NAD binding No
GO:0043168 anion binding No
GO:1901265 nucleoside phosphate binding No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

Transcription Factor Class
(based on PFAM domains)
Histone-like TF

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup4425
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4753
Ophiocordyceps australis map64 (Brazil) OphauB2|5492
Ophiocordyceps camponoti-floridani Ophcf2|04032
Ophiocordyceps camponoti-rufipedis Ophun1|1601 (this protein)
Ophiocordyceps kimflemingae Ophio5|1294
Ophiocordyceps subramaniannii Hirsu2|9169

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|1601
MSDHEFGGNDDLSLPKATVQKIVGEILPPQGGVAFAKEARDLLIECCVEFITLISSEANEISEKEAKKTIACDHI
TKALEQLGFSDYVPAVLEAAAEHKEVQKGREKKADKFANSEDSAPNLSALVPSALVPSARPASTMGQEESMPVDE
SVSPQSLSARTLKAVASYINSPPRKRVVVLTGAGISTAAGIPDFRSPKTGLYSNLARLDLPHAEAVFDISYFRQR
PEPFYALAKELYPGKFHPTVSHAFIALLAKKGMLQMLFTQNIDCLERAAGVPADKIVEAHGSFATQRCIDCKETF
PDDEMKECVVDGKVPRCGCGALVKPDIIFFGESLPRHFDKNTFHVATADIVLILGTSLSVYPFAGLPEMTTEGKP
RVLFNMERVGRIGSRADDVVEIGSCDDGTRKLADALGWREELEGLWRGVVGEEEAERQTRGEGAVEDDAEVLRLA
EGVEAALHFGEDESDEGEGKDGVDELGEGVESSKSANGAEERTVEEKPIHRKQSSSSLRHGQAEGDKAEAEIER*
Coding >Ophun1|1601
ATGTCCGATCACGAGTTTGGAGGCAACGATGACTTATCTCTGCCCAAGGCAACGGTTCAAAAGATCGTCGGCGAG
ATCCTTCCGCCGCAAGGGGGTGTTGCCTTTGCCAAGGAAGCTCGGGATCTTCTCATAGAGTGCTGCGTCGAGTTC
ATCACTCTCATATCCTCCGAGGCCAACGAGATATCTGAGAAGGAGGCAAAAAAGACGATTGCATGCGACCACATC
ACCAAGGCGCTCGAACAGCTCGGCTTCTCCGACTACGTTCCCGCCGTACTAGAGGCGGCGGCCGAGCACAAAGAG
GTACAAAAGGGCCGCGAGAAGAAGGCAGACAAGTTTGCGAATAGCGAAGACTCTGCTCCGAACCTGTCCGCTCTC
GTCCCGTCTGCTCTCGTCCCCTCGGCCAGGCCGGCCTCCACAATGGGCCAGGAGGAGTCGATGCCCGTGGACGAG
TCCGTCTCGCCGCAGAGCCTTTCGGCCCGGACGCTGAAGGCTGTGGCCTCGTACATCAACTCGCCGCCACGGAAG
CGCGTCGTCGTCCTTACCGGAGCTGGCATCTCGACAGCGGCGGGCATCCCCGACTTCAGATCGCCCAAGACGGGT
CTGTACAGCAACCTCGCCCGCCTCGACCTCCCGCACGCAGAAGCCGTCTTCGACATCTCGTACTTCCGTCAACGG
CCTGAACCTTTCTACGCGCTCGCGAAGGAGTTGTACCCCGGCAAATTCCACCCCACCGTTTCGCACGCCTTCATC
GCCCTGCTCGCGAAGAAGGGGATGCTGCAGATGCTCTTTACGCAAAACATTGACTGTCTGGAGAGGGCGGCGGGC
GTGCCGGCTGACAAGATTGTCGAGGCGCATGGGAGTTTCGCGACGCAGCGGTGTATCGACTGCAAGGAGACTTTC
CCGGACGATGAGATGAAAGAGTGTGTTGTTGACGGCAAGGTTCCTCGCTGTGGCTGCGGGGCACTCGTCAAGCCG
GACATCATCTTCTTCGGCGAGTCTCTACCCCGACACTTTGACAAGAATACCTTCCACGTCGCCACAGCAGACATC
GTCCTCATTCTCGGCACCAGCCTCTCCGTCTACCCCTTCGCCGGCCTCCCCGAGATGACGACGGAGGGAAAGCCG
CGCGTGCTGTTCAACATGGAGCGCGTTGGACGCATCGGCTCGCGGGCGGATGACGTCGTCGAGATTGGGTCCTGC
GATGATGGCACGAGGAAGCTTGCTGATGCTTTGGGCTGGAGGGAGGAGCTGGAGGGGCTTTGGAGGGGGGTTGTG
GGTGAGGAGGAGGCTGAGAGGCAGACTCGTGGGGAGGGGGCTGTTGAGGATGATGCTGAGGTGTTGAGGCTTGCT
GAGGGGGTTGAGGCGGCTCTTCATTTTGGGGAGGATGAGTCTGATGAGGGAGAGGGGAAGGATGGGGTTGACGAG
CTGGGTGAAGGTGTCGAGTCATCGAAGAGTGCTAATGGCGCTGAGGAGCGGACTGTGGAGGAGAAGCCCATCCAT
CGCAAGCAGTCTTCATCATCGTTGCGTCATGGTCAGGCCGAGGGGGACAAAGCAGAAGCCGAGATAGAGCGTTGA
Transcript >Ophun1|1601
ATGTCCGATCACGAGTTTGGAGGCAACGATGACTTATCTCTGCCCAAGGCAACGGTTCAAAAGATCGTCGGCGAG
ATCCTTCCGCCGCAAGGGGGTGTTGCCTTTGCCAAGGAAGCTCGGGATCTTCTCATAGAGTGCTGCGTCGAGTTC
ATCACTCTCATATCCTCCGAGGCCAACGAGATATCTGAGAAGGAGGCAAAAAAGACGATTGCATGCGACCACATC
ACCAAGGCGCTCGAACAGCTCGGCTTCTCCGACTACGTTCCCGCCGTACTAGAGGCGGCGGCCGAGCACAAAGAG
GTACAAAAGGGCCGCGAGAAGAAGGCAGACAAGTTTGCGAATAGCGAAGACTCTGCTCCGAACCTGTCCGCTCTC
GTCCCGTCTGCTCTCGTCCCCTCGGCCAGGCCGGCCTCCACAATGGGCCAGGAGGAGTCGATGCCCGTGGACGAG
TCCGTCTCGCCGCAGAGCCTTTCGGCCCGGACGCTGAAGGCTGTGGCCTCGTACATCAACTCGCCGCCACGGAAG
CGCGTCGTCGTCCTTACCGGAGCTGGCATCTCGACAGCGGCGGGCATCCCCGACTTCAGATCGCCCAAGACGGGT
CTGTACAGCAACCTCGCCCGCCTCGACCTCCCGCACGCAGAAGCCGTCTTCGACATCTCGTACTTCCGTCAACGG
CCTGAACCTTTCTACGCGCTCGCGAAGGAGTTGTACCCCGGCAAATTCCACCCCACCGTTTCGCACGCCTTCATC
GCCCTGCTCGCGAAGAAGGGGATGCTGCAGATGCTCTTTACGCAAAACATTGACTGTCTGGAGAGGGCGGCGGGC
GTGCCGGCTGACAAGATTGTCGAGGCGCATGGGAGTTTCGCGACGCAGCGGTGTATCGACTGCAAGGAGACTTTC
CCGGACGATGAGATGAAAGAGTGTGTTGTTGACGGCAAGGTTCCTCGCTGTGGCTGCGGGGCACTCGTCAAGCCG
GACATCATCTTCTTCGGCGAGTCTCTACCCCGACACTTTGACAAGAATACCTTCCACGTCGCCACAGCAGACATC
GTCCTCATTCTCGGCACCAGCCTCTCCGTCTACCCCTTCGCCGGCCTCCCCGAGATGACGACGGAGGGAAAGCCG
CGCGTGCTGTTCAACATGGAGCGCGTTGGACGCATCGGCTCGCGGGCGGATGACGTCGTCGAGATTGGGTCCTGC
GATGATGGCACGAGGAAGCTTGCTGATGCTTTGGGCTGGAGGGAGGAGCTGGAGGGGCTTTGGAGGGGGGTTGTG
GGTGAGGAGGAGGCTGAGAGGCAGACTCGTGGGGAGGGGGCTGTTGAGGATGATGCTGAGGTGTTGAGGCTTGCT
GAGGGGGTTGAGGCGGCTCTTCATTTTGGGGAGGATGAGTCTGATGAGGGAGAGGGGAAGGATGGGGTTGACGAG
CTGGGTGAAGGTGTCGAGTCATCGAAGAGTGCTAATGGCGCTGAGGAGCGGACTGTGGAGGAGAAGCCCATCCAT
CGCAAGCAGTCTTCATCATCGTTGCGTCATGGTCAGGCCGAGGGGGACAAAGCAGAAGCCGAGATAGAGCGTTGA
Gene >Ophun1|1601
ATGTCCGATCACGAGTTTGGAGGTGAGCCGTCACGGGATTCGTCTCGTTTCTCAGCATTGTTTCGTCTGTGAATG
TCTGGCGTGGCTGGGCAAAGTTGGTCCGTCTCGTTGTTCATGACGATCGCGCGCATGTGGATGATGGATCGGACG
AAATCTCTTTACTATATCTTGCTTGAGTTGCCATGGTACTGTTCAAGTGCGACCCTTGCTTCTCTGTTTGCTCCC
TCTTCCAGTTGGTCATGTGCGTCTTCCACATCTAGGTATGGGCGTTGGGCGTCAGCCACTCGACCACACTACTCA
AGTCGTCGCCATGGTTCGCAGGCCGGCGCAAGATCGTTACTGGGCCCGAGCGGACAACGAATTTTCTTGTTGTGT
GGACCGTCCTGGACTTCTTTGGCGATATGGCCGCTAACCTTGTCTGTCTACAGGCAACGATGACTTATCTCTGCC
CAAGGGTAAGGCGAATGACGAACCCATAAGCAATCGAATCAACGACTGACATGTCGCAGCAACGGTTCAAAAGAT
CGTCGGCGAGATCCTTCCGCCGCAAGGGGGTGTTGCCTTTGCCAAGGAAGCTCGGGATCTTCTCATAGAGTGCTG
CGTCGAGTTCATCACTCTCATATCCTCCGAGGCCAACGAGATATCTGAGAAGGAGGCAAAAAAGACGATTGCATG
CGACCACATCACCAAGGCGCTCGAACAGCTCGGCTTCTCCGACTACGTTCCCGCCGTACTAGAGGCGGCGGCCGA
GCACAAAGAGGTACAAAAGGTGAGAAGAGACCGCCCTGCGAACTGAAGTTTCATGCGAGGCTCACATCTACGAGC
AGGGCCGCGAGAAGAAGGCAGACAAGTTTGCGAATAGCGGTATGTCGATGGAGGAGCTGGCGCGCCTGCAAGAGG
AGCAGTTTGCTCAGGCACGGCAACGACACACATAGCATGGACAGATGATTCTATAATGGCGTCGTGGTAGGCGTT
GCTTGGCGTTGAACTACAAGGACATAAGGCGAACTTGGGGGCTGCAAGGGGATCGCTTTGGAGATTTGAAGGGTC
TGAAAAGAGGAAGTAAGTGGATGGATGGTATTTGGAAGACCGCGTAGTCTTGATTTGTTTGCTCTGGGAGTCTAG
CAGGATCTAGGAGGAGTTGAAAACTGGATCTGATGCCGTTTCAGAGCTGCGAGGCTTGCTTGAAGACGCGTCGAT
GAGAGGCATGGCTTATCGACAAGAAAAGCGTTGGTGAAAATAAGCACAGACGACGTCATGGTTTCGTATTCGTAT
GTACGACGTCACGTCAACAACCGTCACGAAGCCAGGGTTAGGGTTCACGAACGAAGCCTCTACAGAAGACTCTGC
TCCGAACCTGTCCGCTCTCGTCCCGTCTGCTCTCGTCCCCTCGGCCAGGCCGGCCTCCACAATGGGCCAGGAGGA
GTCGATGCCCGTGGACGAGTCCGTCTCGCCGCAGAGCCTTTCGGCCCGGACGCTGAAGGCTGTGGCCTCGTACAT
CAACTCGCCGCCACGGAAGCGCGTCGTCGTCCTTACCGGAGCTGGCATCTCGACAGCGGCGGGCAGTACGTTGTC
CTCCTACAGCCCTCGCTAAGTCCCCGACCTGATCTTTTCTCGCTCCCGCCCAGTCCCCGACTTCAGATCGCCCAA
GACGGGTCTGTACAGCAACCTCGCCCGCCTCGACCTCCCGCACGCAGAAGCCGTCTTCGACATCTCGTACTTCCG
TCAACGGCCTGAACCTTTCTACGCGCTCGCGAAGGAGTTGTACCCCGGCAAATTCCACCCCACCGTTTCGCACGC
CTTCATCGCCCTGCTCGCGAAGAAGGGGATGCTGCAGATGCTCTTTACGCAAAACATTGACTGTCTGGAGAGGGC
GGCGGGCGTGCCGGCTGACAAGATTGTCGAGGCGCATGGGAGTTTCGCGACGCAGCGGTGTATCGACTGCAAGGA
GACTTTCCCGGACGATGAGATGAAAGAGTGTGTTGTTGACGGCAAGGTTCCTCGCTGTGGCTGCGGGGCACTCGT
CAAGCCGGACATCATCTTCTTCGGCGAGTCTCTACCCCGACACTTTGACAAGAATACCTTCCACGTCGCCACAGC
AGACATCGTCCTCATTCTCGGCACCAGCCTCTCCGTCTACCCCTTCGCCGGCCTCCCCGAGATGACGACGGAGGG
AAAGCCGCGCGTGCTGTTCAACATGGAGCGCGTTGGACGCATCGGCTCGCGGGCGGATGACGTCGTCGAGATTGG
GTCCTGCGATGATGGCACGAGGAAGCTTGCTGATGCTTTGGGCTGGAGGGAGGAGCTGGAGGGGCTTTGGAGGGG
GGTTGTGGGTGAGGAGGAGGCTGAGAGGCAGACTCGTGGGGAGGGGGCTGTTGAGGATGATGCTGAGGTGTTGAG
GCTTGCTGAGGGGGTTGAGGCGGCTCTTCATTTTGGGGAGGATGAGTCTGATGAGGGAGAGGGGAAGGATGGGGT
TGACGAGCTGGGTGAAGGTGTCGAGTCATCGAAGAGTGCTAATGGCGCTGAGGAGCGGACTGTGGAGGAGAAGCC
CATCCATCGCAAGCAGTCTTCATCATCGTTGCGTCATGGTCAGGCCGAGGGGGACAAAGCAGAAGCCGAGATAGA
GCGTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail