Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|1592
Gene name
LocationContig_168:27713..29364
Strand+
Gene length (bp)1651
Transcript length (bp)1344
Coding sequence length (bp)1344
Protein length (aa) 448

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03155 Alg6_Alg8 ALG6, ALG8 glycosyltransferase family 4.7E-30 15 76
PF03155 Alg6_Alg8 ALG6, ALG8 glycosyltransferase family 2.6E-119 74 438

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q4IJT0|ALG8_GIBZE Dolichyl pyrophosphate Glc1Man9GlcNAc2 alpha-1,3-glucosyltransferase OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=ALG8 PE=3 SV=1 1 447 0.0E+00
sp|Q7RXP5|ALG8_NEUCR Dolichyl pyrophosphate Glc1Man9GlcNAc2 alpha-1,3-glucosyltransferase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=alg-8 PE=3 SV=2 1 447 0.0E+00
sp|Q1DJR8|ALG8_COCIM Dolichyl pyrophosphate Glc1Man9GlcNAc2 alpha-1,3-glucosyltransferase OS=Coccidioides immitis (strain RS) GN=ALG8 PE=3 SV=1 1 447 0.0E+00
sp|Q2UB20|ALG8_ASPOR Dolichyl pyrophosphate Glc1Man9GlcNAc2 alpha-1,3-glucosyltransferase OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=alg8 PE=3 SV=1 1 447 0.0E+00
sp|Q2HA14|ALG8_CHAGB Dolichyl pyrophosphate Glc1Man9GlcNAc2 alpha-1,3-glucosyltransferase OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=ALG8 PE=3 SV=1 1 447 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q4IJT0|ALG8_GIBZE Dolichyl pyrophosphate Glc1Man9GlcNAc2 alpha-1,3-glucosyltransferase OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=ALG8 PE=3 SV=1 1 447 0.0E+00
sp|Q7RXP5|ALG8_NEUCR Dolichyl pyrophosphate Glc1Man9GlcNAc2 alpha-1,3-glucosyltransferase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=alg-8 PE=3 SV=2 1 447 0.0E+00
sp|Q1DJR8|ALG8_COCIM Dolichyl pyrophosphate Glc1Man9GlcNAc2 alpha-1,3-glucosyltransferase OS=Coccidioides immitis (strain RS) GN=ALG8 PE=3 SV=1 1 447 0.0E+00
sp|Q2UB20|ALG8_ASPOR Dolichyl pyrophosphate Glc1Man9GlcNAc2 alpha-1,3-glucosyltransferase OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=alg8 PE=3 SV=1 1 447 0.0E+00
sp|Q2HA14|ALG8_CHAGB Dolichyl pyrophosphate Glc1Man9GlcNAc2 alpha-1,3-glucosyltransferase OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=ALG8 PE=3 SV=1 1 447 0.0E+00
sp|Q5AWM9|ALG8_EMENI Dolichyl pyrophosphate Glc1Man9GlcNAc2 alpha-1,3-glucosyltransferase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=alg8 PE=3 SV=1 1 414 1.0E-178
sp|Q10479|ALG8_SCHPO Dolichyl pyrophosphate Glc1Man9GlcNAc2 alpha-1,3-glucosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=alg8 PE=3 SV=1 8 447 4.0E-150
sp|Q6CJR2|ALG8_KLULA Dolichyl pyrophosphate Glc1Man9GlcNAc2 alpha-1,3-glucosyltransferase OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=ALG8 PE=3 SV=1 13 439 1.0E-117
sp|Q5AJD2|ALG8_CANAL Dolichyl pyrophosphate Glc1Man9GlcNAc2 alpha-1,3-glucosyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ALG8 PE=3 SV=1 7 440 3.0E-101
sp|Q6BRE5|ALG8_DEBHA Dolichyl pyrophosphate Glc1Man9GlcNAc2 alpha-1,3-glucosyltransferase OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=ALG8 PE=3 SV=1 73 440 4.0E-99
sp|P40351|ALG8_YEAST Dolichyl pyrophosphate Glc1Man9GlcNAc2 alpha-1,3-glucosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ALG8 PE=1 SV=1 14 437 1.0E-98
sp|Q6FKM3|ALG8_CANGA Dolichyl pyrophosphate Glc1Man9GlcNAc2 alpha-1,3-glucosyltransferase OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=ALG8 PE=3 SV=1 73 439 2.0E-91
sp|Q759R3|ALG8_ASHGO Dolichyl pyrophosphate Glc1Man9GlcNAc2 alpha-1,3-glucosyltransferase OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=ALG8 PE=3 SV=2 77 439 3.0E-88
sp|O80505|ALG8_ARATH Probable dolichyl pyrophosphate Glc1Man9GlcNAc2 alpha-1,3-glucosyltransferase OS=Arabidopsis thaliana GN=At2g44660 PE=2 SV=3 14 437 3.0E-82
sp|Q0P5D9|ALG8_BOVIN Probable dolichyl pyrophosphate Glc1Man9GlcNAc2 alpha-1,3-glucosyltransferase OS=Bos taurus GN=ALG8 PE=2 SV=1 12 437 1.0E-80
sp|Q9W3V8|ALG8_DROME Probable dolichyl pyrophosphate Glc1Man9GlcNAc2 alpha-1,3-glucosyltransferase OS=Drosophila melanogaster GN=xit PE=2 SV=1 14 434 1.0E-75
sp|Q9BVK2|ALG8_HUMAN Probable dolichyl pyrophosphate Glc1Man9GlcNAc2 alpha-1,3-glucosyltransferase OS=Homo sapiens GN=ALG8 PE=1 SV=2 85 437 4.0E-72
sp|Q554E2|ALG8_DICDI Probable dolichyl pyrophosphate Glc1Man9GlcNAc2 alpha-1,3-glucosyltransferase OS=Dictyostelium discoideum GN=alg8 PE=3 SV=1 82 434 1.0E-68
sp|Q6P8H8|ALG8_MOUSE Probable dolichyl pyrophosphate Glc1Man9GlcNAc2 alpha-1,3-glucosyltransferase OS=Mus musculus GN=Alg8 PE=2 SV=2 85 438 1.0E-63
sp|P52887|ALG8_CAEEL Probable dolichyl pyrophosphate Glc1Man9GlcNAc2 alpha-1,3-glucosyltransferase OS=Caenorhabditis elegans GN=C08H9.3 PE=3 SV=3 85 440 8.0E-43
sp|Q554E2|ALG8_DICDI Probable dolichyl pyrophosphate Glc1Man9GlcNAc2 alpha-1,3-glucosyltransferase OS=Dictyostelium discoideum GN=alg8 PE=3 SV=1 13 134 1.0E-21
sp|Q9BVK2|ALG8_HUMAN Probable dolichyl pyrophosphate Glc1Man9GlcNAc2 alpha-1,3-glucosyltransferase OS=Homo sapiens GN=ALG8 PE=1 SV=2 12 77 2.0E-21
sp|Q759R3|ALG8_ASHGO Dolichyl pyrophosphate Glc1Man9GlcNAc2 alpha-1,3-glucosyltransferase OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=ALG8 PE=3 SV=2 13 74 2.0E-21
sp|Q6P8H8|ALG8_MOUSE Probable dolichyl pyrophosphate Glc1Man9GlcNAc2 alpha-1,3-glucosyltransferase OS=Mus musculus GN=Alg8 PE=2 SV=2 12 76 1.0E-20
sp|Q5NVS8|ALG6_PONAB Dolichyl pyrophosphate Man9GlcNAc2 alpha-1,3-glucosyltransferase OS=Pongo abelii GN=ALG6 PE=2 SV=1 30 322 1.0E-18
sp|Q9Y672|ALG6_HUMAN Dolichyl pyrophosphate Man9GlcNAc2 alpha-1,3-glucosyltransferase OS=Homo sapiens GN=ALG6 PE=1 SV=1 30 322 2.0E-17
sp|P52887|ALG8_CAEEL Probable dolichyl pyrophosphate Glc1Man9GlcNAc2 alpha-1,3-glucosyltransferase OS=Caenorhabditis elegans GN=C08H9.3 PE=3 SV=3 17 76 4.0E-17
sp|Q6FKM3|ALG8_CANGA Dolichyl pyrophosphate Glc1Man9GlcNAc2 alpha-1,3-glucosyltransferase OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=ALG8 PE=3 SV=1 24 74 9.0E-17
sp|Q802T2|ALG6_CHICK Dolichyl pyrophosphate Man9GlcNAc2 alpha-1,3-glucosyltransferase OS=Gallus gallus GN=ALG6 PE=2 SV=1 75 322 2.0E-14
sp|Q54QG6|ALG6_DICDI Probable dolichyl pyrophosphate Man9GlcNAc2 alpha-1,3-glucosyltransferase OS=Dictyostelium discoideum GN=alg6 PE=3 SV=1 75 352 7.0E-14
sp|Q09226|ALG6_CAEEL Probable dolichyl pyrophosphate Man9GlcNAc2 alpha-1,3-glucosyltransferase OS=Caenorhabditis elegans GN=C08B11.8 PE=3 SV=1 82 312 6.0E-13
sp|Q9FF17|ALG6_ARATH Probable dolichyl pyrophosphate Man9GlcNAc2 alpha-1,3-glucosyltransferase OS=Arabidopsis thaliana GN=At5g38460 PE=2 SV=1 80 348 9.0E-13
sp|O43053|ALG6_SCHPO Probable dolichyl pyrophosphate Man9GlcNAc2 alpha-1,3-glucosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=alg6 PE=3 SV=1 62 348 3.0E-12
sp|Q3TAE8|ALG6_MOUSE Dolichyl pyrophosphate Man9GlcNAc2 alpha-1,3-glucosyltransferase OS=Mus musculus GN=Alg6 PE=2 SV=1 75 322 1.0E-11
sp|Q3T1L5|ALG6_RAT Dolichyl pyrophosphate Man9GlcNAc2 alpha-1,3-glucosyltransferase OS=Rattus norvegicus GN=Alg6 PE=2 SV=1 75 322 1.0E-11
sp|Q12001|ALG6_YEAST Dolichyl pyrophosphate Man9GlcNAc2 alpha-1,3-glucosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ALG6 PE=1 SV=1 76 310 9.0E-11
sp|Q9VKX7|ALG6_DROME Probable dolichyl pyrophosphate Man9GlcNAc2 alpha-1,3-glucosyltransferase OS=Drosophila melanogaster GN=gny PE=2 SV=2 84 318 6.0E-10
sp|Q802T2|ALG6_CHICK Dolichyl pyrophosphate Man9GlcNAc2 alpha-1,3-glucosyltransferase OS=Gallus gallus GN=ALG6 PE=2 SV=1 30 78 5.0E-07
sp|O43053|ALG6_SCHPO Probable dolichyl pyrophosphate Man9GlcNAc2 alpha-1,3-glucosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=alg6 PE=3 SV=1 30 73 3.0E-06
sp|Q12001|ALG6_YEAST Dolichyl pyrophosphate Man9GlcNAc2 alpha-1,3-glucosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ALG6 PE=1 SV=1 30 73 4.0E-06
sp|Q3TAE8|ALG6_MOUSE Dolichyl pyrophosphate Man9GlcNAc2 alpha-1,3-glucosyltransferase OS=Mus musculus GN=Alg6 PE=2 SV=1 30 84 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016758 hexosyltransferase activity Yes
GO:0016757 glycosyltransferase activity No
GO:0003674 molecular_function No
GO:0016740 transferase activity No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 18 0.45

Transmembrane Domains

Domain # Start End Length
1 67 89 22
2 94 111 17
3 124 146 22
4 167 189 22
5 301 323 22
6 330 349 19
7 359 378 19
8 390 412 22
9 422 444 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|1592
MAEPYPTLTQCAVVATAFKILLFPAYKSTDFEVHRNWLAVTHSLPISEWYFDETSPWTLDYPPLFAYWEWLLAHA
AALSIFLSPGLLIIDHIHFQYNGFLYGFLVLSLVLARRRSTLLHSAVVFAALLCFKHIYLYLAPAYFVFLLRTYC
LSARSIWRPEFLNCVKLAAAVSAVFAASLGPFALMGQLPQLLRRLFPFSRGLCHAYWAPNVWALYSLADRLMIRL
APRLGLSLKTEALQSVTRGLVGDSSFAVLPDVTPRTCFILTLLFQAPPLLRMLVRQTRPTWEDLVGAVTLCGYAS
FLFGWHVHEKAILLVVIPFSLVALRDRRHLSAFRPLAVAAHVSLFPLLFTPAEFPIKTAYTIFWLVLFLLAFDRL
APASDKPRFFLLDRFSTLYIAGSVPLIAYASLLHHVIFGDALAFLPLMFISCYAAVGVIGSWAGFMVVHLTS*
Coding >Ophun1|1592
ATGGCAGAGCCATACCCTACCCTAACGCAATGCGCCGTCGTCGCCACCGCCTTCAAAATCCTCCTCTTCCCCGCA
TACAAATCTACCGACTTCGAGGTTCATCGCAACTGGCTCGCCGTCACGCACAGCTTGCCCATCTCCGAGTGGTAC
TTTGACGAGACTTCGCCTTGGACGCTGGATTATCCCCCGCTCTTTGCCTATTGGGAGTGGTTGCTTGCTCATGCT
GCGGCTCTGTCCATCTTTCTATCGCCGGGCTTGCTCATCATCGACCACATTCACTTTCAGTACAATGGATTTCTC
TATGGATTTCTCGTCCTCTCTCTCGTCCTCGCTCGTCGAAGGTCTACCCTGCTGCACAGCGCCGTCGTCTTCGCA
GCTCTGCTGTGCTTCAAGCACATCTACCTCTACCTCGCGCCGGCCTACTTTGTCTTTCTGCTGCGCACCTACTGC
CTCTCGGCTCGATCCATATGGCGTCCCGAATTTCTCAACTGCGTCAAGCTCGCCGCCGCCGTCTCCGCCGTCTTC
GCCGCCTCTCTGGGTCCCTTTGCGCTCATGGGCCAGTTACCGCAGCTGCTGCGTCGCCTGTTTCCCTTTTCCCGC
GGCCTCTGTCACGCTTACTGGGCGCCCAACGTCTGGGCTCTTTACTCGCTGGCTGATCGCCTCATGATTCGTCTC
GCGCCGCGTCTCGGCCTTTCGCTCAAGACGGAGGCGCTGCAGAGCGTCACTCGCGGCCTCGTCGGTGACTCCTCC
TTTGCCGTTCTCCCCGATGTGACGCCGCGGACGTGCTTCATCCTCACGCTGTTGTTCCAGGCGCCGCCGCTGCTA
CGGATGCTCGTGCGGCAGACGCGGCCGACGTGGGAGGACCTGGTGGGCGCCGTTACGCTGTGCGGATACGCATCA
TTCCTCTTCGGCTGGCACGTGCACGAAAAGGCCATCCTGCTGGTGGTGATACCCTTCAGCCTGGTGGCCCTCCGA
GACCGACGACATCTCAGCGCGTTCCGACCGCTAGCCGTGGCGGCGCACGTGTCGCTGTTCCCGCTGCTCTTCACG
CCGGCCGAGTTCCCCATCAAGACGGCATACACCATATTCTGGCTGGTCTTGTTCTTGCTGGCGTTCGATAGGCTC
GCTCCGGCCTCGGACAAGCCGCGCTTCTTCCTGCTGGACCGCTTCAGCACGCTGTACATTGCCGGTAGCGTTCCG
CTGATCGCGTACGCATCGCTGCTGCATCATGTCATCTTTGGCGACGCACTCGCGTTTCTGCCCCTCATGTTCATC
AGCTGCTACGCTGCCGTGGGCGTCATCGGCAGCTGGGCCGGCTTCATGGTGGTGCATCTGACGTCGTGA
Transcript >Ophun1|1592
ATGGCAGAGCCATACCCTACCCTAACGCAATGCGCCGTCGTCGCCACCGCCTTCAAAATCCTCCTCTTCCCCGCA
TACAAATCTACCGACTTCGAGGTTCATCGCAACTGGCTCGCCGTCACGCACAGCTTGCCCATCTCCGAGTGGTAC
TTTGACGAGACTTCGCCTTGGACGCTGGATTATCCCCCGCTCTTTGCCTATTGGGAGTGGTTGCTTGCTCATGCT
GCGGCTCTGTCCATCTTTCTATCGCCGGGCTTGCTCATCATCGACCACATTCACTTTCAGTACAATGGATTTCTC
TATGGATTTCTCGTCCTCTCTCTCGTCCTCGCTCGTCGAAGGTCTACCCTGCTGCACAGCGCCGTCGTCTTCGCA
GCTCTGCTGTGCTTCAAGCACATCTACCTCTACCTCGCGCCGGCCTACTTTGTCTTTCTGCTGCGCACCTACTGC
CTCTCGGCTCGATCCATATGGCGTCCCGAATTTCTCAACTGCGTCAAGCTCGCCGCCGCCGTCTCCGCCGTCTTC
GCCGCCTCTCTGGGTCCCTTTGCGCTCATGGGCCAGTTACCGCAGCTGCTGCGTCGCCTGTTTCCCTTTTCCCGC
GGCCTCTGTCACGCTTACTGGGCGCCCAACGTCTGGGCTCTTTACTCGCTGGCTGATCGCCTCATGATTCGTCTC
GCGCCGCGTCTCGGCCTTTCGCTCAAGACGGAGGCGCTGCAGAGCGTCACTCGCGGCCTCGTCGGTGACTCCTCC
TTTGCCGTTCTCCCCGATGTGACGCCGCGGACGTGCTTCATCCTCACGCTGTTGTTCCAGGCGCCGCCGCTGCTA
CGGATGCTCGTGCGGCAGACGCGGCCGACGTGGGAGGACCTGGTGGGCGCCGTTACGCTGTGCGGATACGCATCA
TTCCTCTTCGGCTGGCACGTGCACGAAAAGGCCATCCTGCTGGTGGTGATACCCTTCAGCCTGGTGGCCCTCCGA
GACCGACGACATCTCAGCGCGTTCCGACCGCTAGCCGTGGCGGCGCACGTGTCGCTGTTCCCGCTGCTCTTCACG
CCGGCCGAGTTCCCCATCAAGACGGCATACACCATATTCTGGCTGGTCTTGTTCTTGCTGGCGTTCGATAGGCTC
GCTCCGGCCTCGGACAAGCCGCGCTTCTTCCTGCTGGACCGCTTCAGCACGCTGTACATTGCCGGTAGCGTTCCG
CTGATCGCGTACGCATCGCTGCTGCATCATGTCATCTTTGGCGACGCACTCGCGTTTCTGCCCCTCATGTTCATC
AGCTGCTACGCTGCCGTGGGCGTCATCGGCAGCTGGGCCGGCTTCATGGTGGTGCATCTGACGTCGTGA
Gene >Ophun1|1592
ATGGCAGAGCCATACCCTACCCTAACGCAATGCGCCGTCGTCGCCACCGCCTTCAAAATCCTCCTCTTCCCCGCA
TAGTCCGTCTGCCCCCCCCATCTACCCGACGAGAATAGCCTCAAAGCTGACGTCAAAGTCCGGGGACAGCAAATC
TACCGACTTCGAGGTTCATCGCAACTGGCTCGCCGTCACGCACAGCTTGCCCATCTCCGAGTGGTACTTTGACGA
GACTTCGCCTTGGACGCTGGATTATCCCCCGCTCTTTGCCTATTGGGAGTGGTTGCTTGCTCATGTGGCTCGGCT
GGTTGACCCGCTCATGGTGCGGCTTTATAGCATTGGCCACGAGTCCTGGCCGACTGTTTGCTTTCAGCGGGCTTC
TGTTGTTTTTGCAGAGCTTCTTCTTGTTGTTGCCCTGCATCTCTTTGTCGATTGGTGTCCGCTTTCGTCGAGGCG
AGCTGCTCAGGCTGCGGCTCTGTCCATCTTTCTATCGCCGGGCTTGCTCATCATCGACCACATTCACTTTCAGTA
CAATGGATTTCTCTATGGATTTCTCGTCCTCTCTCTCGTCCTCGCTCGTCGAAGGTCTACCCTGCTGCACAGCGC
CGTCGTCTTCGCAGCTCTGCTGTGCTTCAAGCACATCTACCTCTACCTCGCGCCGGCCTACTTTGTCTTTCTGCT
GCGCACCTACTGCCTCTCGGCTCGATCCATATGGCGTCCCGAATTTCTCAACTGCGTCAAGCTCGCCGCCGCCGT
CTCCGCCGTCTTCGCCGCCTCTCTGGGTCCCTTTGCGCTCATGGGCCAGTTACCGCAGCTGCTGCGTCGCCTGTT
TCCCTTTTCCCGCGGCCTCTGTCACGCTTACTGGGCGCCCAACGTCTGGGCTCTTTACTCGCTGGCTGATCGCCT
CATGATTCGTCGTCAGTAGCGGATGCGGTCGTTATGTTCCTCTTGTCTTACACGTCTTGCTGACATGGCTCTACC
TGCAGTCGCGCCGCGTCTCGGCCTTTCGCTCAAGACGGAGGCGCTGCAGAGCGTCACTCGCGGCCTCGTCGGTGA
CTCCTCCTTTGCCGTTCTCCCCGATGTGACGCCGCGGACGTGCTTCATCCTCACGCTGTTGTTCCAGGCGCCGCC
GCTGCTACGGATGCTCGTGCGGCAGACGCGGCCGACGTGGGAGGACCTGGTGGGCGCCGTTACGCTGTGCGGATA
CGCATCATTCCTCTTCGGCTGGCACGTGCACGAAAAGGCCATCCTGCTGGTGGTGATACCCTTCAGCCTGGTGGC
CCTCCGAGACCGACGACATCTCAGCGCGTTCCGACCGCTAGCCGTGGCGGCGCACGTGTCGCTGTTCCCGCTGCT
CTTCACGCCGGCCGAGTTCCCCATCAAGACGGCATACACCATATTCTGGCTGGTCTTGTTCTTGCTGGCGTTCGA
TAGGCTCGCTCCGGCCTCGGACAAGCCGCGCTTCTTCCTGCTGGACCGCTTCAGCACGCTGTACATTGCCGGTAG
CGTTCCGCTGATCGCGTACGCATCGCTGCTGCATCATGTCATCTTTGGCGACGCACTCGCGTTTCTGCCCCTCAT
GTTCATCAGCTGCTACGCTGCCGTGGGCGTCATCGGCAGCTGGGCCGGCTTCATGGTGGTGCATCTGACGTCGTG
A

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail