Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|1589
Gene name
LocationContig_168:19217..22392
Strand+
Gene length (bp)3175
Transcript length (bp)2928
Coding sequence length (bp)2928
Protein length (aa) 976

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04082 Fungal_trans Fungal specific transcription factor domain 6.6E-26 255 510
PF00172 Zn_clus Fungal Zn(2)-Cys(6) binuclear cluster domain 2.1E-10 52 88

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P40467|ASG1_YEAST Activator of stress genes 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ASG1 PE=1 SV=1 239 663 3.0E-78
sp|Q59LV8|ASG1_CANAL Activator of stress genes protein 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ASG1 PE=3 SV=1 239 663 6.0E-63
sp|P39529|YJU6_YEAST Putative transcriptional regulatory protein YJL206C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YJL206C PE=2 SV=1 227 665 9.0E-57
sp|O60130|YH7G_SCHPO Putative transcriptional regulatory protein C16G5.16 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC16G5.16 PE=1 SV=1 44 660 4.0E-50
sp|O59744|YN28_SCHPO Uncharacterized transcriptional regulatory protein C530.08 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC530.08 PE=3 SV=1 54 667 1.0E-48
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P40467|ASG1_YEAST Activator of stress genes 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ASG1 PE=1 SV=1 239 663 3.0E-78
sp|Q59LV8|ASG1_CANAL Activator of stress genes protein 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ASG1 PE=3 SV=1 239 663 6.0E-63
sp|P39529|YJU6_YEAST Putative transcriptional regulatory protein YJL206C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YJL206C PE=2 SV=1 227 665 9.0E-57
sp|O60130|YH7G_SCHPO Putative transcriptional regulatory protein C16G5.16 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC16G5.16 PE=1 SV=1 44 660 4.0E-50
sp|O59744|YN28_SCHPO Uncharacterized transcriptional regulatory protein C530.08 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC530.08 PE=3 SV=1 54 667 1.0E-48
sp|P87000|ACU15_NEUCR Transcriptional activator protein acu-15 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=acu-15 PE=1 SV=2 49 550 3.0E-38
sp|O59741|YN25_SCHPO Uncharacterized transcriptional regulatory protein C530.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC530.05 PE=3 SV=2 46 519 8.0E-28
sp|P36598|THI1_SCHPO Thiamine repressible genes regulatory protein thi1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=thi1 PE=1 SV=2 43 663 1.0E-24
sp|O14130|YF54_SCHPO Uncharacterized transcriptional regulatory protein C3C7.04 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC3C7.04 PE=3 SV=1 53 620 3.0E-22
sp|O94490|YC79_SCHPO Uncharacterized transcriptional regulatory protein C417.09c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC417.09c PE=3 SV=1 54 622 3.0E-19
sp|P40467|ASG1_YEAST Activator of stress genes 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ASG1 PE=1 SV=1 46 102 1.0E-18
sp|Q9UTN0|YII3_SCHPO Uncharacterized transcriptional regulatory protein C139.03 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC139.03 PE=3 SV=1 45 550 5.0E-18
sp|Q9C0Z1|YKM1_SCHPO Uncharacterized transcriptional regulatory protein PB24D3.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAPB24D3.01 PE=3 SV=2 49 644 8.0E-17
sp|Q10086|YAO7_SCHPO Uncharacterized transcriptional regulatory protein C11D3.07c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC11D3.07c PE=3 SV=3 51 631 1.0E-15
sp|Q09922|YAKB_SCHPO Uncharacterized transcriptional regulatory protein C1F7.11c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1F7.11c PE=3 SV=1 39 583 5.0E-13
sp|P52958|CTF1A_FUSSO Cutinase transcription factor 1 alpha OS=Fusarium solani subsp. pisi GN=CTF1-ALPHA PE=2 SV=1 46 478 1.0E-11
sp|O94569|YGDC_SCHPO Uncharacterized transcriptional regulatory protein C1773.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1773.12 PE=3 SV=1 48 420 2.0E-10
sp|O74915|YJ74_SCHPO Uncharacterized transcriptional regulatory protein C757.04 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC757.04 PE=3 SV=2 53 185 1.0E-09
sp|Q59NX5|FGR27_CANAL Filamentous growth regulator 27 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=FGR27 PE=2 SV=1 262 616 2.0E-09
sp|P10563|QUTA_EMENI Quinic acid utilization activator OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=qutA PE=3 SV=2 34 115 5.0E-09
sp|P12383|PDR1_YEAST Transcription factor PDR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR1 PE=1 SV=2 29 82 1.0E-08
sp|O94278|THI5_SCHPO Thiamine repressible genes regulatory protein thi5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=thi5 PE=3 SV=1 43 118 1.0E-08
sp|O93870|FCR1_CANAX Fluconazole resistance protein 1 OS=Candida albicans GN=FCR1 PE=3 SV=1 46 132 1.0E-08
sp|P50104|STB4_YEAST Probable transcriptional regulatory protein STB4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=STB4 PE=1 SV=1 25 90 5.0E-08
sp|G2TRN9|YAOB_SCHPO Uncharacterized transcriptional regulatory protein C11D3.11c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC11D3.11c PE=1 SV=1 53 431 7.0E-08
sp|P39113|CAT8_YEAST Regulatory protein CAT8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CAT8 PE=1 SV=2 37 122 2.0E-07
sp|Q2UD93|XLNR_ASPOR Xylanolytic transcriptional activator xlnR OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=xlnR PE=1 SV=2 26 89 2.0E-07
sp|B8N6M6|XLNR_ASPFN Xylanolytic transcriptional activator xlnR OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=xlnR PE=3 SV=1 26 89 2.0E-07
sp|A2R5W7|XLNR_ASPNC Xylanolytic transcriptional activator xlnR OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=xlnR PE=3 SV=2 30 89 2.0E-07
sp|O42804|XLNR_ASPNG Xylanolytic transcriptional activator xlnR OS=Aspergillus niger GN=xlnR PE=1 SV=2 30 89 2.0E-07
sp|Q0CV52|XLNR_ASPTN Xylanolytic transcriptional activator xlnR OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=xlnR PE=3 SV=2 6 89 3.0E-07
sp|Q96WP8|XLNR_ASPKA Xylanolytic transcriptional activator xlnR OS=Aspergillus kawachii GN=xlnR PE=3 SV=2 30 89 3.0E-07
sp|Q5AVS0|XLNR_EMENI Xylanolytic transcriptional activator xlnR OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=xlnR PE=2 SV=2 47 89 3.0E-07
sp|A1DIC0|XLNR_NEOFI Xylanolytic transcriptional activator xlnR OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=xlnR PE=3 SV=2 47 89 4.0E-07
sp|B0XUL1|XLNR_ASPFC Xylanolytic transcriptional activator xlnR OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=xlnR PE=3 SV=1 47 89 4.0E-07
sp|G4MZJ4|XLNR_MAGO7 Xylanolytic transcriptional activator xlnR homolog OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=xlr1 PE=3 SV=1 47 89 4.0E-07
sp|Q4WZV6|XLNR_ASPFU Xylanolytic transcriptional activator xlnR OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=xlnR PE=3 SV=1 47 89 5.0E-07
sp|Q4I0C5|RDR1_GIBZE Protein RDR1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=RDR1 PE=3 SV=1 45 99 6.0E-07
sp|P25502|PUT3_YEAST Proline utilization trans-activator OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PUT3 PE=1 SV=1 276 443 6.0E-07
sp|A1C7P9|XLNR_ASPCL Xylanolytic transcriptional activator xlnR OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=xlnR PE=3 SV=2 47 89 9.0E-07
sp|O74541|YCV2_SCHPO Uncharacterized transcriptional regulatory protein C777.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC777.02 PE=3 SV=4 53 113 1.0E-06
sp|P28349|NIT4_NEUCR Nitrogen assimilation transcription factor nit-4 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=nit-4 PE=3 SV=2 45 90 1.0E-06
sp|C7GP35|RGT1_YEAS2 Glucose transport transcription regulator RGT1 OS=Saccharomyces cerevisiae (strain JAY291) GN=RGT1 PE=3 SV=1 17 99 1.0E-06
sp|P11638|QA1F_NEUCR Quinic acid utilization activator OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=qa-1f PE=3 SV=2 46 115 2.0E-06
sp|P38157|MAL33_YEAST Maltose fermentation regulatory protein MAL33 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MAL33 PE=3 SV=1 50 89 2.0E-06
sp|P39961|YE14_YEAST Uncharacterized transcriptional regulatory protein YER184C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YER184C PE=3 SV=1 45 113 2.0E-06
sp|Q59NX5|FGR27_CANAL Filamentous growth regulator 27 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=FGR27 PE=2 SV=1 43 129 3.0E-06
sp|P28348|NIRA_EMENI Nitrogen assimilation transcription factor nirA OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=nirA PE=3 SV=1 43 90 4.0E-06
sp|Q9P6I9|YHDD_SCHPO Uncharacterized transcriptional regulatory protein C1683.13c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1683.13c PE=1 SV=1 39 113 6.0E-06
sp|P53338|MAL13_YEAST Maltose fermentation regulatory protein MAL13 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MAL13 PE=3 SV=1 44 101 6.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0006355 regulation of transcription, DNA-templated Yes
GO:0008270 zinc ion binding Yes
GO:0003677 DNA binding Yes
GO:0006351 transcription, DNA-templated Yes
GO:0000981 DNA-binding transcription factor activity, RNA polymerase II-specific Yes
GO:0006725 cellular aromatic compound metabolic process No
GO:1901362 organic cyclic compound biosynthetic process No
GO:0097159 organic cyclic compound binding No
GO:0010468 regulation of gene expression No
GO:2001141 regulation of RNA biosynthetic process No
GO:0044271 cellular nitrogen compound biosynthetic process No
GO:1901576 organic substance biosynthetic process No
GO:0034654 nucleobase-containing compound biosynthetic process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0019222 regulation of metabolic process No
GO:0032774 RNA biosynthetic process No
GO:0046872 metal ion binding No
GO:0090304 nucleic acid metabolic process No
GO:0097659 nucleic acid-templated transcription No
GO:0060255 regulation of macromolecule metabolic process No
GO:0009889 regulation of biosynthetic process No
GO:0008152 metabolic process No
GO:0009058 biosynthetic process No
GO:0140110 transcription regulator activity No
GO:0009987 cellular process No
GO:1901363 heterocyclic compound binding No
GO:1903506 regulation of nucleic acid-templated transcription No
GO:0044238 primary metabolic process No
GO:0046914 transition metal ion binding No
GO:0044237 cellular metabolic process No
GO:0005488 binding No
GO:0031326 regulation of cellular biosynthetic process No
GO:0050789 regulation of biological process No
GO:0006807 nitrogen compound metabolic process No
GO:0010556 regulation of macromolecule biosynthetic process No
GO:0080090 regulation of primary metabolic process No
GO:0065007 biological regulation No
GO:0016070 RNA metabolic process No
GO:0051171 regulation of nitrogen compound metabolic process No
GO:0071704 organic substance metabolic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0003676 nucleic acid binding No
GO:0043169 cation binding No
GO:0009059 macromolecule biosynthetic process No
GO:0051252 regulation of RNA metabolic process No
GO:0008150 biological_process No
GO:0046483 heterocycle metabolic process No
GO:0050794 regulation of cellular process No
GO:0019438 aromatic compound biosynthetic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0003674 molecular_function No
GO:0044249 cellular biosynthetic process No
GO:0018130 heterocycle biosynthetic process No
GO:0003700 DNA-binding transcription factor activity No
GO:0043167 ion binding No
GO:0019219 regulation of nucleobase-containing compound metabolic process No
GO:0031323 regulation of cellular metabolic process No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

Transcription Factor Class
(based on PFAM domains)
Fungal Specific TF

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup4170
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2801
Ophiocordyceps australis map64 (Brazil) OphauB2|745
Ophiocordyceps camponoti-floridani Ophcf2|06012
Ophiocordyceps camponoti-rufipedis Ophun1|1589 (this protein)
Ophiocordyceps kimflemingae Ophio5|1012
Ophiocordyceps subramaniannii Hirsu2|8465

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|1589
MSGDLTDDDAAGDWQLHHASSPADSARSDDEKAADDPSQPSQPIQKRRRVTRACDECRRKKIKCDGKQPCTHCSV
YSYECTYDKPSNRRRNPAPQYIEALENRLQRAEALLHKYLPDVDLADPSLDPAIQQEFLNRQRARAKQRSVDEPT
THTDAKLTTMIDSIGQLDLDEKGGWDFHGTSSGAVFLRRMKEHFRGMLGPASKVPFLPRPERPPGIMALEPPSPR
GDSPLSTSSAFPDLPPKDVARRLCYYSLSCATCLVRIVHVPSFYQRFERVYDCPLESLDQEDTRFLGLVYAVLAL
GCMYSNLEDAKPESGAYKAAIDQGFKYYKTARALLQDLAECRDIPSLQALVYMILFLQATSNLSACYAFIGVALR
SALRIGLHRHLQHDKIGIVEQQVRRRVFYVIRQLDIYVSTMLGFPLLLNVDDVDQPYPVEVDDEYVSETGIISPP
AGTPSFFEAFNAQTRLMEVLGKITKYVYPMHGQDQSTGATTYLISYARIKEIETELQTWYEMLPETWRPSPDGPV
EVVRVRHLLRFSYAHVQLVLYRPFLHYISPRLSQATEVDDLSYACAAAAISVSRNIVHIGLEIRKQGVLSGPYWF
MLYTEFFAVLSLVFYALENPDKPGSHEVLGDAWAGRRMIADLADKSMAADRVTNALKPLFDQLPQSLDQARSRPQ
PSRKRSAGPGKADLYMSPHALASPGSSTQRIGDFTHAGASTLGKTTLASPTSQASVDGSGQSMEHAFSGLPYAAG
MQDMISMDLSSRATPESSSTGSSQRQRLWSQQFQQGTQNPVNKLDSLMFPSDDPFAYPNQLMVELGFQPKADGTS
AAMTTPGHDAPAFFTTSLDGLGDELLGHPSSYMMQQQPLPQQQQLLLQQQQQQLFGLTGNPCDPHDMMAMHTAEH
QNQQQQQQRQFQQQQQQVPRGSVAQPGHRSLFSSFRRARSDRQQARQIDQMFTQQGMQPDWGSFFGSGRGGFQGM
*
Coding >Ophun1|1589
ATGTCGGGCGATCTCACCGACGATGACGCCGCCGGCGACTGGCAGCTTCATCACGCCTCGTCACCTGCCGATAGC
GCTCGATCTGACGATGAAAAGGCGGCCGATGATCCCTCTCAGCCGTCGCAGCCCATCCAGAAGCGCCGTCGCGTC
ACCCGCGCCTGTGACGAGTGCCGCCGCAAGAAGATCAAGTGCGATGGCAAGCAGCCCTGCACCCATTGTTCTGTC
TACAGCTATGAATGCACATACGACAAGCCCTCCAACAGGAGGCGAAACCCCGCCCCTCAGTATATCGAAGCCCTC
GAGAACCGTCTGCAGCGCGCAGAGGCCCTCCTCCACAAATATCTCCCCGATGTCGACCTTGCCGACCCTAGCCTC
GACCCTGCCATCCAACAGGAGTTTCTCAATCGTCAACGAGCTCGGGCCAAGCAGCGCTCCGTCGACGAACCAACG
ACTCACACCGACGCCAAGCTCACGACCATGATCGACTCCATCGGCCAGCTCGATCTCGACGAAAAGGGCGGCTGG
GATTTTCACGGCACCTCGTCCGGCGCCGTCTTCCTCCGACGCATGAAGGAGCACTTTCGCGGCATGCTCGGTCCC
GCCTCCAAGGTCCCGTTCCTGCCCCGCCCCGAACGCCCCCCGGGCATCATGGCTCTTGAACCGCCGTCTCCACGC
GGAGACTCCCCGCTCTCGACCTCGTCCGCATTTCCCGACCTACCTCCCAAGGACGTCGCCCGAAGGCTGTGCTAT
TATTCGCTGAGTTGCGCCACCTGTCTCGTCCGCATCGTCCACGTACCCTCCTTCTACCAACGATTCGAACGCGTC
TACGACTGTCCCCTGGAAAGCCTCGACCAGGAAGACACGCGCTTCTTGGGGCTCGTCTACGCCGTCCTCGCCCTC
GGCTGCATGTACAGCAACCTCGAGGATGCCAAGCCCGAGAGCGGAGCTTACAAGGCAGCCATCGACCAAGGCTTC
AAGTATTACAAGACGGCGAGGGCGCTTCTGCAGGATCTAGCCGAGTGCCGCGACATTCCGTCGCTCCAGGCTTTG
GTCTACATGATCCTCTTTCTCCAGGCCACCTCCAACCTCAGCGCCTGCTATGCATTCATCGGCGTCGCTCTGCGG
TCCGCCCTCCGCATCGGCCTCCACAGGCATCTGCAGCATGACAAGATTGGCATTGTCGAGCAGCAGGTCCGGAGG
CGAGTCTTTTACGTGATCCGCCAGTTGGACATTTACGTCTCCACCATGCTCGGCTTTCCGCTCCTCCTCAACGTT
GACGATGTCGATCAGCCGTACCCGGTCGAGGTGGACGACGAATACGTCTCGGAAACGGGCATCATCTCGCCGCCC
GCGGGGACGCCATCTTTCTTCGAAGCCTTCAACGCTCAGACCCGACTGATGGAGGTGCTCGGGAAGATCACAAAA
TACGTCTATCCGATGCATGGGCAGGACCAGTCCACGGGTGCAACGACCTATCTCATCAGCTATGCTCGCATCAAG
GAGATTGAGACGGAGCTGCAGACGTGGTACGAGATGCTGCCGGAGACGTGGCGACCGAGCCCGGATGGGCCAGTC
GAGGTGGTCCGGGTGCGGCACTTGCTCCGTTTCTCGTACGCACATGTGCAGCTCGTCCTATACAGGCCCTTTTTA
CACTACATATCGCCTCGACTCAGTCAGGCAACCGAGGTGGACGACCTCTCGTATGCCTGCGCCGCGGCTGCCATC
AGCGTGTCCCGAAATATCGTCCACATCGGTCTGGAGATTCGCAAGCAGGGTGTCCTCAGCGGGCCCTACTGGTTC
ATGCTGTACACCGAGTTCTTTGCCGTCCTATCCCTCGTCTTTTACGCTCTCGAAAACCCAGACAAGCCGGGATCG
CACGAAGTGCTGGGAGATGCCTGGGCTGGTCGGCGTATGATTGCTGACCTTGCCGACAAGAGCATGGCCGCCGAT
CGGGTAACCAACGCCCTCAAGCCCTTGTTCGACCAACTGCCCCAGAGCCTCGACCAGGCCCGCTCGCGGCCTCAG
CCCTCGCGGAAGAGATCCGCCGGTCCTGGCAAGGCCGACTTGTACATGTCGCCCCACGCCCTCGCAAGCCCCGGA
TCGTCGACGCAGCGGATCGGCGACTTCACACATGCCGGCGCCTCGACGCTTGGCAAGACGACGCTCGCCTCGCCG
ACGTCGCAGGCCTCGGTCGACGGTTCGGGACAGTCGATGGAGCATGCATTTTCCGGTCTGCCATACGCCGCAGGT
ATGCAGGACATGATTTCCATGGACCTGTCTTCGCGGGCGACGCCCGAGTCGTCTAGCACGGGCAGCTCTCAGCGG
CAGCGGCTTTGGTCTCAGCAGTTCCAGCAGGGCACGCAGAATCCCGTCAACAAGCTGGACTCGCTCATGTTCCCA
TCAGACGACCCGTTCGCCTACCCCAACCAGTTGATGGTGGAGCTCGGCTTTCAACCCAAGGCAGACGGGACGTCG
GCAGCCATGACGACTCCGGGTCACGACGCTCCCGCCTTCTTCACGACGTCGCTGGATGGGCTGGGAGATGAGCTT
CTAGGTCATCCTTCGTCCTACATGATGCAGCAGCAGCCACTGCCACAACAGCAGCAGCTACTACTTCAGCAGCAG
CAGCAGCAGCTGTTTGGTCTCACGGGGAATCCATGCGACCCGCACGACATGATGGCGATGCATACTGCTGAGCAT
CAGAACCAGCAGCAGCAGCAGCAAAGACAGTTTCAGCAGCAGCAGCAACAAGTCCCGCGCGGCTCGGTGGCGCAA
CCGGGCCACCGAAGTCTGTTCTCGAGCTTCCGCAGAGCTCGATCGGATCGGCAGCAAGCCAGGCAGATCGATCAG
ATGTTTACGCAGCAGGGGATGCAGCCCGACTGGGGAAGTTTCTTTGGTTCTGGAAGAGGCGGATTTCAGGGAATG
TAA
Transcript >Ophun1|1589
ATGTCGGGCGATCTCACCGACGATGACGCCGCCGGCGACTGGCAGCTTCATCACGCCTCGTCACCTGCCGATAGC
GCTCGATCTGACGATGAAAAGGCGGCCGATGATCCCTCTCAGCCGTCGCAGCCCATCCAGAAGCGCCGTCGCGTC
ACCCGCGCCTGTGACGAGTGCCGCCGCAAGAAGATCAAGTGCGATGGCAAGCAGCCCTGCACCCATTGTTCTGTC
TACAGCTATGAATGCACATACGACAAGCCCTCCAACAGGAGGCGAAACCCCGCCCCTCAGTATATCGAAGCCCTC
GAGAACCGTCTGCAGCGCGCAGAGGCCCTCCTCCACAAATATCTCCCCGATGTCGACCTTGCCGACCCTAGCCTC
GACCCTGCCATCCAACAGGAGTTTCTCAATCGTCAACGAGCTCGGGCCAAGCAGCGCTCCGTCGACGAACCAACG
ACTCACACCGACGCCAAGCTCACGACCATGATCGACTCCATCGGCCAGCTCGATCTCGACGAAAAGGGCGGCTGG
GATTTTCACGGCACCTCGTCCGGCGCCGTCTTCCTCCGACGCATGAAGGAGCACTTTCGCGGCATGCTCGGTCCC
GCCTCCAAGGTCCCGTTCCTGCCCCGCCCCGAACGCCCCCCGGGCATCATGGCTCTTGAACCGCCGTCTCCACGC
GGAGACTCCCCGCTCTCGACCTCGTCCGCATTTCCCGACCTACCTCCCAAGGACGTCGCCCGAAGGCTGTGCTAT
TATTCGCTGAGTTGCGCCACCTGTCTCGTCCGCATCGTCCACGTACCCTCCTTCTACCAACGATTCGAACGCGTC
TACGACTGTCCCCTGGAAAGCCTCGACCAGGAAGACACGCGCTTCTTGGGGCTCGTCTACGCCGTCCTCGCCCTC
GGCTGCATGTACAGCAACCTCGAGGATGCCAAGCCCGAGAGCGGAGCTTACAAGGCAGCCATCGACCAAGGCTTC
AAGTATTACAAGACGGCGAGGGCGCTTCTGCAGGATCTAGCCGAGTGCCGCGACATTCCGTCGCTCCAGGCTTTG
GTCTACATGATCCTCTTTCTCCAGGCCACCTCCAACCTCAGCGCCTGCTATGCATTCATCGGCGTCGCTCTGCGG
TCCGCCCTCCGCATCGGCCTCCACAGGCATCTGCAGCATGACAAGATTGGCATTGTCGAGCAGCAGGTCCGGAGG
CGAGTCTTTTACGTGATCCGCCAGTTGGACATTTACGTCTCCACCATGCTCGGCTTTCCGCTCCTCCTCAACGTT
GACGATGTCGATCAGCCGTACCCGGTCGAGGTGGACGACGAATACGTCTCGGAAACGGGCATCATCTCGCCGCCC
GCGGGGACGCCATCTTTCTTCGAAGCCTTCAACGCTCAGACCCGACTGATGGAGGTGCTCGGGAAGATCACAAAA
TACGTCTATCCGATGCATGGGCAGGACCAGTCCACGGGTGCAACGACCTATCTCATCAGCTATGCTCGCATCAAG
GAGATTGAGACGGAGCTGCAGACGTGGTACGAGATGCTGCCGGAGACGTGGCGACCGAGCCCGGATGGGCCAGTC
GAGGTGGTCCGGGTGCGGCACTTGCTCCGTTTCTCGTACGCACATGTGCAGCTCGTCCTATACAGGCCCTTTTTA
CACTACATATCGCCTCGACTCAGTCAGGCAACCGAGGTGGACGACCTCTCGTATGCCTGCGCCGCGGCTGCCATC
AGCGTGTCCCGAAATATCGTCCACATCGGTCTGGAGATTCGCAAGCAGGGTGTCCTCAGCGGGCCCTACTGGTTC
ATGCTGTACACCGAGTTCTTTGCCGTCCTATCCCTCGTCTTTTACGCTCTCGAAAACCCAGACAAGCCGGGATCG
CACGAAGTGCTGGGAGATGCCTGGGCTGGTCGGCGTATGATTGCTGACCTTGCCGACAAGAGCATGGCCGCCGAT
CGGGTAACCAACGCCCTCAAGCCCTTGTTCGACCAACTGCCCCAGAGCCTCGACCAGGCCCGCTCGCGGCCTCAG
CCCTCGCGGAAGAGATCCGCCGGTCCTGGCAAGGCCGACTTGTACATGTCGCCCCACGCCCTCGCAAGCCCCGGA
TCGTCGACGCAGCGGATCGGCGACTTCACACATGCCGGCGCCTCGACGCTTGGCAAGACGACGCTCGCCTCGCCG
ACGTCGCAGGCCTCGGTCGACGGTTCGGGACAGTCGATGGAGCATGCATTTTCCGGTCTGCCATACGCCGCAGGT
ATGCAGGACATGATTTCCATGGACCTGTCTTCGCGGGCGACGCCCGAGTCGTCTAGCACGGGCAGCTCTCAGCGG
CAGCGGCTTTGGTCTCAGCAGTTCCAGCAGGGCACGCAGAATCCCGTCAACAAGCTGGACTCGCTCATGTTCCCA
TCAGACGACCCGTTCGCCTACCCCAACCAGTTGATGGTGGAGCTCGGCTTTCAACCCAAGGCAGACGGGACGTCG
GCAGCCATGACGACTCCGGGTCACGACGCTCCCGCCTTCTTCACGACGTCGCTGGATGGGCTGGGAGATGAGCTT
CTAGGTCATCCTTCGTCCTACATGATGCAGCAGCAGCCACTGCCACAACAGCAGCAGCTACTACTTCAGCAGCAG
CAGCAGCAGCTGTTTGGTCTCACGGGGAATCCATGCGACCCGCACGACATGATGGCGATGCATACTGCTGAGCAT
CAGAACCAGCAGCAGCAGCAGCAAAGACAGTTTCAGCAGCAGCAGCAACAAGTCCCGCGCGGCTCGGTGGCGCAA
CCGGGCCACCGAAGTCTGTTCTCGAGCTTCCGCAGAGCTCGATCGGATCGGCAGCAAGCCAGGCAGATCGATCAG
ATGTTTACGCAGCAGGGGATGCAGCCCGACTGGGGAAGTTTCTTTGGTTCTGGAAGAGGCGGATTTCAGGGAATG
TAA
Gene >Ophun1|1589
ATGTCGGGCGATCTCACCGACGATGACGCCGCCGGCGACTGGCAGCTTCATCACGCCTCGTCACCTGCCGATAGC
GCTCGATCTGACGATGAAAAGGCGGCCGATGATCCCTCTCAGCCGTCGCAGCCCATCCAGAAGCGCCGTCGCGTC
ACCCGCGCCTGTGACGAGTGCCGCCGCAAGAAGATCAAGTGCGATGGCAAGCAGCCCTGCACCCATTGTTCTGTC
TACAGCTATGGTGCGTCTCTCCCCGGCCCTCTGACCTCGTCTTCTCCTCCTCACCCCCGTGGCAGAATGCACATA
CGACAAGCCCTCCAACAGGAGGCGAAACCCCGCCCCTCAGTATATCGAAGCCCTCGAGAACCGTCTGCAGCGCGC
AGAGGCCCTCCTCCACAAATATCTCCCCGATGTCGACCTTGCCGACCCTAGCCTCGACCCTGCCATCCAACAGGA
GTTTCTCAATCGTCAACGAGCTCGGGCCAAGCAGCGCTCCGTCGACGAACCAACGACTCACACCGACGCCAAGCT
CACGACCATGATCGACTCCATCGGCCAGCTCGATCTCGACGAAAAGGGCGGCTGGGATTTTCACGGCACCTCGTC
CGGCGCCGTCTTCCTCCGACGCATGAAGGAGCACTTTCGCGGCATGCTCGGTCCCGCCTCCAAGGTCCCGTTCCT
GCCCCGCCCCGAACGCCCCCCGGGCATCATGGCTCTTGAACCGCCGTCTCCACGCGGAGACTCCCCGCTCTCGAC
CTCGTCCGCATTTCCCGACCTACCTCCCAAGGACGTCGCCCGAAGGCTGTGCTATTATTCGCTGAGTTGCGCCAC
CTGTCTCGTCCGCATCGTCCACGTACCCTCCTTCTACCAACGATTCGAACGCGTCTACGACTGTCCCCTGGAAAG
CCTCGACCAGGAAGACACGCGCTTCTTGGGGCTCGTCTACGCCGTCCTCGCCCTCGGCTGCATGTACAGCAACCT
CGAGGATGCCAAGCCCGAGAGCGGAGCTTACAAGGCAGCCATCGACCAAGGGTGTGTTTGCCTCCCTCCCTGCTC
CCCCGTCTCTTTGCCCCGCCTGACCCCCTTCGGCGCAGCTTCAAGTATTACAAGACGGCGAGGGCGCTTCTGCAG
GATCTAGCCGAGTGCCGCGACATTCCGTCGCTCCAGGCTTTGGTCTACATGATCCTCTTTCTCCAGGCCACCTCC
AACCTCAGCGCCTGCTATGCATTCATCGGCGTCGCTCTGCGGTCCGCCCTCCGCATCGGCCTCCACAGGCATCTG
CAGCATGACAAGATTGGCATTGTCGAGCAGCAGGTCCGGAGGCGAGTCTTTTACGTGATCCGCCAGTTGGACATT
TACGTCTCCACCATGCTCGGCTTTCCGCTCCTCCTCAACGTTGACGATGTCGATCAGCCGTACCCGGTCGAGGTG
GACGACGAATACGTCTCGGAAACGGGCATCATCTCGCCGCCCGCGGGGACGCCATCTTTCTTCGAAGCCTTCAAC
GCTCAGACCCGACTGATGGAGGTGCTCGGGAAGATCACAAAATACGTCTATCCGATGCATGGGCAGGACCAGTCC
ACGGGTGCAACGACCTATCTCATCAGCTATGCTCGCATCAAGGAGATTGAGACGGAGCTGCAGACGTGGTACGAG
ATGCTGCCGGAGACGTGGCGACCGAGCCCGGATGGGCCAGTCGAGGTGGTCCGGTGAGTCCATGATCAATCATGT
CGACCACGTTCATCATCTCGTGACGGATTGGCTGACTCGGAGACTGTTCAGGGTGCGGCACTTGCTCCGTTTCTC
GTACGCACATGTGCAGCTCGTCCTATACAGGCCCTTTTTACACTACATATCGCCTCGACTCAGTCAGGCAACCGA
GGTGGACGACCTCTCGTATGCCTGCGCCGCGGCTGCCATCAGCGTGTCCCGAAATATCGTCCACATCGGTCTGGA
GATTCGCAAGCAGGGTGTCCTCAGCGGGCCCTACTGGTTCATGCTGTACACCGAGTTCTTTGCCGTCCTATCCCT
CGTCTTTTACGCTCTCGAAAACCCAGACAAGCCGGGATCGCACGAAGTGCTGGGAGATGCCTGGGCTGGTCGGCG
TATGATTGCTGACCTTGCCGACAAGAGCATGGCCGCCGATCGGGTAACCAACGCCCTCAAGGTACGAGTCTAGAG
AAAGCCACGGACTGTTGGGAACCTTGTTGACCCCATCCACTAGCCCTTGTTCGACCAACTGCCCCAGAGCCTCGA
CCAGGCCCGCTCGCGGCCTCAGCCCTCGCGGAAGAGATCCGCCGGTCCTGGCAAGGCCGACTTGTACATGTCGCC
CCACGCCCTCGCAAGCCCCGGATCGTCGACGCAGCGGATCGGCGACTTCACACATGCCGGCGCCTCGACGCTTGG
CAAGACGACGCTCGCCTCGCCGACGTCGCAGGCCTCGGTCGACGGTTCGGGACAGTCGATGGAGCATGCATTTTC
CGGTCTGCCATACGCCGCAGGTATGCAGGACATGATTTCCATGGACCTGTCTTCGCGGGCGACGCCCGAGTCGTC
TAGCACGGGCAGCTCTCAGCGGCAGCGGCTTTGGTCTCAGCAGTTCCAGCAGGGCACGCAGAATCCCGTCAACAA
GCTGGACTCGCTCATGTTCCCATCAGACGACCCGTTCGCCTACCCCAACCAGTTGATGGTGGAGCTCGGCTTTCA
ACCCAAGGCAGACGGGACGTCGGCAGCCATGACGACTCCGGGTCACGACGCTCCCGCCTTCTTCACGACGTCGCT
GGATGGGCTGGGAGATGAGCTTCTAGGTCATCCTTCGTCCTACATGATGCAGCAGCAGCCACTGCCACAACAGCA
GCAGCTACTACTTCAGCAGCAGCAGCAGCAGCTGTTTGGTCTCACGGGGAATCCATGCGACCCGCACGACATGAT
GGCGATGCATACTGCTGAGCATCAGAACCAGCAGCAGCAGCAGCAAAGACAGTTTCAGCAGCAGCAGCAACAAGT
CCCGCGCGGCTCGGTGGCGCAACCGGGCCACCGAAGTCTGTTCTCGAGCTTCCGCAGAGCTCGATCGGATCGGCA
GCAAGCCAGGCAGATCGATCAGATGTTTACGCAGCAGGGGATGCAGCCCGACTGGGGAAGTTTCTTTGGTTCTGG
AAGAGGCGGATTTCAGGGAATGTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail