Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|1587
Gene name
LocationContig_168:14353..15513
Strand+
Gene length (bp)1160
Transcript length (bp)1041
Coding sequence length (bp)1041
Protein length (aa) 347

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02840 Prp18 Prp18 domain 6.5E-51 200 337
PF08799 PRP4 pre-mRNA processing factor 4 (PRP4) like 1.2E-10 129 157

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q6GMH0|PRP18_DANRE Pre-mRNA-splicing factor 18 OS=Danio rerio GN=prpf18 PE=2 SV=1 129 339 1.0E-29
sp|Q5EAV6|PRP18_XENLA Pre-mRNA-splicing factor 18 OS=Xenopus laevis GN=prpf18 PE=2 SV=1 129 339 2.0E-28
sp|Q2HJ41|PRP18_BOVIN Pre-mRNA-splicing factor 18 OS=Bos taurus GN=PRPF18 PE=2 SV=1 129 339 2.0E-28
sp|Q9JKB8|PRP18_RAT Pre-mRNA-splicing factor 18 OS=Rattus norvegicus GN=Prpf18 PE=2 SV=1 211 339 4.0E-28
sp|Q99633|PRP18_HUMAN Pre-mRNA-splicing factor 18 OS=Homo sapiens GN=PRPF18 PE=1 SV=1 211 339 4.0E-28
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q6GMH0|PRP18_DANRE Pre-mRNA-splicing factor 18 OS=Danio rerio GN=prpf18 PE=2 SV=1 129 339 1.0E-29
sp|Q5EAV6|PRP18_XENLA Pre-mRNA-splicing factor 18 OS=Xenopus laevis GN=prpf18 PE=2 SV=1 129 339 2.0E-28
sp|Q2HJ41|PRP18_BOVIN Pre-mRNA-splicing factor 18 OS=Bos taurus GN=PRPF18 PE=2 SV=1 129 339 2.0E-28
sp|Q9JKB8|PRP18_RAT Pre-mRNA-splicing factor 18 OS=Rattus norvegicus GN=Prpf18 PE=2 SV=1 211 339 4.0E-28
sp|Q99633|PRP18_HUMAN Pre-mRNA-splicing factor 18 OS=Homo sapiens GN=PRPF18 PE=1 SV=1 211 339 4.0E-28
sp|Q5RE03|PRP18_PONAB Pre-mRNA-splicing factor 18 OS=Pongo abelii GN=PRPF18 PE=2 SV=1 211 339 4.0E-28
sp|Q8BM39|PRP18_MOUSE Pre-mRNA-splicing factor 18 OS=Mus musculus GN=Prpf18 PE=1 SV=1 211 339 4.0E-28
sp|O94406|PRP18_SCHPO Pre-mRNA-splicing factor 18 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=prp18 PE=3 SV=1 21 333 7.0E-27
sp|P33411|PRP18_YEAST Pre-mRNA-splicing factor 18 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRP18 PE=1 SV=3 253 331 2.0E-14
[Show less]

GO

GO Term Description Terminal node
GO:0005681 spliceosomal complex Yes
GO:0008380 RNA splicing Yes
GO:0090304 nucleic acid metabolic process No
GO:0044237 cellular metabolic process No
GO:0044238 primary metabolic process No
GO:0009987 cellular process No
GO:0006396 RNA processing No
GO:0008152 metabolic process No
GO:0032991 protein-containing complex No
GO:0140513 nuclear protein-containing complex No
GO:0006725 cellular aromatic compound metabolic process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0005575 cellular_component No
GO:1990904 ribonucleoprotein complex No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0046483 heterocycle metabolic process No
GO:0008150 biological_process No
GO:1901360 organic cyclic compound metabolic process No
GO:0071704 organic substance metabolic process No
GO:0016070 RNA metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 63 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|1587
MDFAAMMGKELAKAKPSDKDKRYLKRSDIEASRAAAYEAEQKALEESRAAKAAAKRQREEDLAAETAAREEKRRK
LAEASRLRRHELELEEERARRKRLGLPELKGARADGEQVDGDGDGEGDVEEGVVVDGLRALGQPVRLFGESGAAR
VRRYRKLKTVVTDGPIPTTLQLVEGADIKVEGSVPKDAEGRRWLFRQLASYFTMVLVEYERAVEGERRDTTASKT
AYSAMVQTRENMKPLFRKFEAGDLDNSLLEPIVEIVKALQERRYLDANDGYLRLSIGKAAWPIGVTMVGIHERSA
REKLHGGEKGHVMGDEVTRKFLQSIKRCLTFAQVRWPPDDLRQLMG*
Coding >Ophun1|1587
ATGGACTTCGCCGCAATGATGGGCAAGGAACTGGCCAAGGCCAAACCCTCCGACAAAGACAAGAGATACCTAAAG
CGCAGCGACATAGAAGCCTCCCGCGCAGCCGCCTACGAAGCCGAGCAAAAAGCCCTCGAAGAAAGCCGCGCCGCC
AAAGCAGCCGCCAAGCGCCAACGCGAAGAAGACCTCGCCGCCGAAACAGCAGCCCGCGAAGAGAAACGCCGGAAA
CTAGCCGAAGCCTCCCGCCTCCGCCGCCACGAGCTCGAGCTGGAGGAGGAGCGCGCGCGCAGGAAACGTCTCGGG
CTTCCGGAGCTCAAGGGTGCGCGCGCGGATGGCGAGCAGGTCGATGGCGATGGCGATGGCGAGGGTGATGTTGAG
GAGGGGGTCGTGGTGGATGGGTTGCGGGCGCTTGGTCAGCCGGTTCGGTTGTTTGGCGAGTCGGGGGCTGCCAGG
GTGCGGCGTTATCGCAAGCTGAAGACGGTGGTGACGGATGGGCCTATACCGACGACGCTGCAGCTCGTTGAGGGG
GCTGATATCAAGGTTGAGGGCAGTGTGCCCAAGGATGCCGAGGGCCGGAGGTGGCTGTTCAGACAGCTGGCTAGC
TACTTCACCATGGTTCTCGTCGAGTATGAGCGCGCCGTCGAGGGAGAGAGGAGGGACACGACGGCCAGCAAGACG
GCGTATAGCGCCATGGTGCAGACGAGGGAGAACATGAAGCCGCTCTTCCGCAAATTCGAAGCCGGCGACCTCGAC
AACTCCCTCCTCGAACCCATCGTCGAAATCGTCAAAGCCCTCCAGGAACGGCGCTACCTAGACGCCAACGACGGC
TACCTCCGTCTCAGCATCGGAAAGGCCGCCTGGCCCATTGGCGTCACCATGGTGGGCATCCACGAGCGCAGCGCG
CGCGAGAAGCTTCATGGCGGTGAAAAGGGCCACGTCATGGGCGACGAGGTCACTCGCAAGTTTCTACAGAGTATC
AAGCGCTGCCTCACCTTTGCCCAGGTCAGGTGGCCCCCCGATGATCTGCGGCAGTTGATGGGTTGA
Transcript >Ophun1|1587
ATGGACTTCGCCGCAATGATGGGCAAGGAACTGGCCAAGGCCAAACCCTCCGACAAAGACAAGAGATACCTAAAG
CGCAGCGACATAGAAGCCTCCCGCGCAGCCGCCTACGAAGCCGAGCAAAAAGCCCTCGAAGAAAGCCGCGCCGCC
AAAGCAGCCGCCAAGCGCCAACGCGAAGAAGACCTCGCCGCCGAAACAGCAGCCCGCGAAGAGAAACGCCGGAAA
CTAGCCGAAGCCTCCCGCCTCCGCCGCCACGAGCTCGAGCTGGAGGAGGAGCGCGCGCGCAGGAAACGTCTCGGG
CTTCCGGAGCTCAAGGGTGCGCGCGCGGATGGCGAGCAGGTCGATGGCGATGGCGATGGCGAGGGTGATGTTGAG
GAGGGGGTCGTGGTGGATGGGTTGCGGGCGCTTGGTCAGCCGGTTCGGTTGTTTGGCGAGTCGGGGGCTGCCAGG
GTGCGGCGTTATCGCAAGCTGAAGACGGTGGTGACGGATGGGCCTATACCGACGACGCTGCAGCTCGTTGAGGGG
GCTGATATCAAGGTTGAGGGCAGTGTGCCCAAGGATGCCGAGGGCCGGAGGTGGCTGTTCAGACAGCTGGCTAGC
TACTTCACCATGGTTCTCGTCGAGTATGAGCGCGCCGTCGAGGGAGAGAGGAGGGACACGACGGCCAGCAAGACG
GCGTATAGCGCCATGGTGCAGACGAGGGAGAACATGAAGCCGCTCTTCCGCAAATTCGAAGCCGGCGACCTCGAC
AACTCCCTCCTCGAACCCATCGTCGAAATCGTCAAAGCCCTCCAGGAACGGCGCTACCTAGACGCCAACGACGGC
TACCTCCGTCTCAGCATCGGAAAGGCCGCCTGGCCCATTGGCGTCACCATGGTGGGCATCCACGAGCGCAGCGCG
CGCGAGAAGCTTCATGGCGGTGAAAAGGGCCACGTCATGGGCGACGAGGTCACTCGCAAGTTTCTACAGAGTATC
AAGCGCTGCCTCACCTTTGCCCAGGTCAGGTGGCCCCCCGATGATCTGCGGCAGTTGATGGGTTGA
Gene >Ophun1|1587
ATGGACTTCGCCGCAATGATGGGCAAGGAACTGGCCAAGGCCAAACCCTCCGACAAAGACAAGAGATACCTAAAG
CGCAGCGACATAGAAGCCTCCCGCGCAGCCGCCTACGAAGCCGAGCAAAAAGCCCTCGAAGAAAGCCGCGCCGCC
AAAGCAGCCGCCAAGCGCCAACGCGAAGAAGACCTCGCCGCCGAAACAGCAGCCCGCGAAGAGAAACGCCGGAAA
CTAGCCGAAGCCTCCCGCCTCCGCCGCCACGAGCTCGAGCTGGAGGAGGAGCGCGCGCGCAGGAAACGTCTCGGG
CTTCCGGAGCTCAAGGGTGCGCGCGCGGATGGCGAGCAGGTCGATGGCGATGGCGATGGCGAGGGTGATGTTGAG
GAGGGGGTCGTGGTGGATGGGTTGCGGGCGCTTGGTCAGCCGGTTCGGTTGTTTGGCGAGTCGGGGGCTGCCAGG
GTGCGGCGTTATCGCAAGCTGAAGACGGTGGTGACGGATGGGCCTATACCGACGACGCTGCAGCTCGTTGAGGGG
GCTGATATCAAGGTTGAGGGCAGTGTGCCCAAGGATGCCGAGGGCCGGAGGTGGCTGTTCAGACAGCTGGCTAGC
TACTTCACCATGGTTCTCGTCGAGTATGAGCGCGCCGTCGAGGGAGAGAGGAGGGACACGACGGCCAGCAAGACG
GCGTATAGCGCCATGGTGCAGACGAGGGAGAACATGAAGCCGGTAAGTTTCGCCACCTCATCCCGCCCCTCCATC
TTCTCCTCCCGTCAACCCTCTATCCGACGCCTATCAAGGCGATCGACAGCCTTGGACTCGTACACTGACAGATTC
CGCCTCAATAGCTCTTCCGCAAATTCGAAGCCGGCGACCTCGACAACTCCCTCCTCGAACCCATCGTCGAAATCG
TCAAAGCCCTCCAGGAACGGCGCTACCTAGACGCCAACGACGGCTACCTCCGTCTCAGCATCGGAAAGGCCGCCT
GGCCCATTGGCGTCACCATGGTGGGCATCCACGAGCGCAGCGCGCGCGAGAAGCTTCATGGCGGTGAAAAGGGCC
ACGTCATGGGCGACGAGGTCACTCGCAAGTTTCTACAGAGTATCAAGCGCTGCCTCACCTTTGCCCAGGTCAGGT
GGCCCCCCGATGATCTGCGGCAGTTGATGGGTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail