Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|1577
Gene name
LocationContig_167:11429..14014
Strand+
Gene length (bp)2585
Transcript length (bp)2517
Coding sequence length (bp)2517
Protein length (aa) 839

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF18368 Ig_GlcNase Exo-beta-D-glucosaminidase Ig-fold domain 5.5E-34 735 836
PF00703 Glyco_hydro_2 Glycosyl hydrolases family 2 2.4E-10 187 287

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q4R1C4|EBDG_HYPJE Exo-beta-D-glucosaminidase OS=Hypocrea jecorina GN=gls93 PE=1 SV=1 16 836 0.0E+00
sp|C0LRA7|EBDG_HYPVI Exo-beta-D-glucosaminidase OS=Hypocrea virens GN=gls1 PE=2 SV=1 16 836 0.0E+00
sp|D4AUH1|EBDG_ARTBC Exo-beta-D-glucosaminidase ARB_07888 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07888 PE=1 SV=1 8 836 0.0E+00
sp|Q82NR8|EBDG_STRAW Exo-beta-D-glucosaminidase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=csxA PE=1 SV=1 16 838 0.0E+00
sp|Q56F26|EBDG_AMYOR Exo-beta-D-glucosaminidase OS=Amycolatopsis orientalis GN=csxA PE=1 SV=2 16 837 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q4R1C4|EBDG_HYPJE Exo-beta-D-glucosaminidase OS=Hypocrea jecorina GN=gls93 PE=1 SV=1 16 836 0.0E+00
sp|C0LRA7|EBDG_HYPVI Exo-beta-D-glucosaminidase OS=Hypocrea virens GN=gls1 PE=2 SV=1 16 836 0.0E+00
sp|D4AUH1|EBDG_ARTBC Exo-beta-D-glucosaminidase ARB_07888 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07888 PE=1 SV=1 8 836 0.0E+00
sp|Q82NR8|EBDG_STRAW Exo-beta-D-glucosaminidase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=csxA PE=1 SV=1 16 838 0.0E+00
sp|Q56F26|EBDG_AMYOR Exo-beta-D-glucosaminidase OS=Amycolatopsis orientalis GN=csxA PE=1 SV=2 16 837 0.0E+00
sp|Q5H7P5|EBM_LILLO Mannosylglycoprotein endo-beta-mannosidase OS=Lilium longiflorum GN=EBM PE=1 SV=4 35 838 7.0E-43
sp|Q75W54|EBM_ARATH Mannosylglycoprotein endo-beta-mannosidase OS=Arabidopsis thaliana GN=EBM PE=1 SV=3 71 835 2.0E-42
sp|Q4FZV0|MANBA_RAT Beta-mannosidase OS=Rattus norvegicus GN=Manba PE=2 SV=1 69 614 4.0E-16
sp|A2QYN2|MANBB_ASPNC Beta-mannosidase B OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=mndB PE=3 SV=1 152 624 2.0E-14
sp|Q8K2I4|MANBA_MOUSE Beta-mannosidase OS=Mus musculus GN=Manba PE=1 SV=1 69 614 4.0E-13
sp|Q5B7W2|MANBB_EMENI Beta-mannosidase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=mndB PE=1 SV=2 247 720 4.0E-13
sp|Q95327|MANBA_CAPHI Beta-mannosidase OS=Capra hircus GN=MANBA PE=2 SV=1 69 614 1.0E-11
sp|I2C092|MANBB_THIHE Beta-mannosidase B OS=Thielavia heterothallica GN=man9 PE=1 SV=1 69 626 2.0E-11
sp|O00462|MANBA_HUMAN Beta-mannosidase OS=Homo sapiens GN=MANBA PE=2 SV=3 16 418 1.0E-10
sp|A7LXS9|BGH2A_BACO1 Beta-galactosidase BoGH2A OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / NCTC 11153) GN=BACOVA_02645 PE=1 SV=1 71 444 3.0E-08
[Show less]

GO

GO Term Description Terminal node
GO:0005975 carbohydrate metabolic process Yes
GO:0004553 hydrolase activity, hydrolyzing O-glycosyl compounds Yes
GO:0003674 molecular_function No
GO:0008152 metabolic process No
GO:0008150 biological_process No
GO:0071704 organic substance metabolic process No
GO:0003824 catalytic activity No
GO:0016787 hydrolase activity No
GO:0016798 hydrolase activity, acting on glycosyl bonds No
GO:0044238 primary metabolic process No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

CAZyme category E-value Start End
GH2 5.4E-56 24 645

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup2977
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7021
Ophiocordyceps australis map64 (Brazil) OphauB2|7701
Ophiocordyceps camponoti-floridani Ophcf2|01607
Ophiocordyceps camponoti-rufipedis Ophun1|1577 (this protein)
Ophiocordyceps kimflemingae Ophio5|3098
Ophiocordyceps subramaniannii Hirsu2|5087

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|1577
MPASLQLAIFSRPLLVSLPGYDASCWHHIEVSRCTVMGCLLASGVYNDSHLWYSDNLKRFDRSQFSVPWVYRSEF
SLSPERGQHYSLQTHGITSRADIFLNGKQIANSSFQSGSFGGHMYDVTDVVTRDNAVAVVAYPGDFNYDLIQGFV
DWNPSPPDNSTGVWRDVFVKQTGPVSMGPVSVSIEDLASASATITVRAEAKNLQHDEVWLLVKSRITDPSGRHKF
LRATVVKLPRNGAALVELSHKIRKPRVWWPKQWGQQPLYTSELIFSVDSAISDASRHSFGIRTVTSSLNKYNDTV
FQVNGRPFQVSGGGYAPDQFLRWDRGRFLTIARYALDMGLNTIRLEGMLEHPELYQIADELGIMILPGWVCCSKW
EAWKHNHDLHIKPVPYWHEEDYKTAAASMAHEAAMLRNHPSVLGFLIGSDSWPDDRATGIYLDALRAVFWEMPVI
ASAAKRGYPQMMQPSGMKMDGPYDWVPPNYWYDTGKRLGAAFGFGSELGSGVGTPEYASLAGFLSAGELESLWKR
PDDNLFHMSTSKSFFTNRSIYNEALFQRYGRPTSLKDYLWKCQMMDYEATRAQNEAYASRWNAQRPATGSIYWML
NSAWPSLHWSLFDYLMHPAGAYFGAKTAGRIQHVAYDYVSRSVWLVDRSLGRREVRTVTIEVLDLGGTTVYRRRV
RAFTRGNTAVRVADLSGLTCTDAVVLLRLLLCDERGRPLSRNVYWIAREVDVLDWNRSTWYHTPVTKFANFKDLS
SMATAKVLAQASPTGAKTMTVELQNESPVPAFFIRLSVVDESGEEVTPVIWSDNYVTLWPFERLRVDVELIEVVA
GVRVRINGWNVGE*
Coding >Ophun1|1577
ATGCCTGCGTCACTGCAGCTTGCCATCTTCTCACGTCCTCTGCTGGTGTCTCTTCCCGGCTACGATGCCTCGTGC
TGGCATCACATTGAGGTCTCACGCTGCACCGTAATGGGATGTCTTCTGGCTTCAGGCGTCTACAACGATTCGCAT
CTCTGGTACTCTGACAATCTCAAGAGATTCGACCGCAGCCAGTTCTCCGTCCCTTGGGTTTATAGGAGTGAATTC
TCGCTGTCGCCGGAAAGGGGGCAGCATTACTCACTACAAACACACGGCATCACATCCAGAGCAGACATTTTCCTC
AACGGCAAGCAGATAGCAAACTCGAGCTTTCAGTCCGGCTCTTTTGGGGGTCACATGTACGACGTTACCGACGTG
GTTACGCGCGATAATGCCGTTGCTGTCGTCGCCTATCCCGGAGACTTTAATTACGACCTCATACAAGGCTTCGTG
GACTGGAACCCATCGCCTCCGGATAACTCGACTGGCGTTTGGCGCGATGTGTTTGTGAAACAGACCGGCCCGGTG
AGCATGGGACCTGTGAGCGTTTCCATAGAGGATCTGGCTTCGGCGTCGGCTACGATCACTGTGCGTGCTGAGGCG
AAGAACCTGCAACATGACGAGGTGTGGCTCCTAGTGAAGTCAAGGATCACGGACCCTTCTGGACGCCACAAGTTT
CTGCGAGCCACTGTTGTAAAGCTGCCGCGCAATGGAGCCGCTCTCGTGGAGCTTTCGCACAAGATCAGAAAGCCC
AGAGTCTGGTGGCCGAAGCAATGGGGTCAGCAGCCCCTTTACACCTCCGAGCTGATCTTCTCAGTCGACTCTGCC
ATCTCAGATGCAAGCCGGCATTCATTCGGAATTCGCACCGTCACATCCAGTCTCAACAAATACAATGACACCGTT
TTCCAGGTAAATGGCAGGCCATTCCAGGTCTCGGGAGGCGGATATGCGCCCGATCAATTCCTCCGCTGGGACAGA
GGGCGATTTCTCACGATAGCGAGATACGCGCTTGACATGGGATTGAACACGATTCGGCTCGAAGGTATGCTTGAG
CATCCAGAGCTGTATCAGATAGCAGATGAGCTGGGCATCATGATCCTTCCCGGTTGGGTCTGCTGCTCTAAATGG
GAAGCGTGGAAGCACAATCACGACCTGCACATTAAGCCGGTCCCATACTGGCACGAGGAAGACTATAAGACAGCA
GCCGCTAGCATGGCGCATGAAGCGGCAATGCTTCGAAATCACCCCAGCGTCCTGGGCTTTCTGATCGGCAGCGAC
TCATGGCCAGACGACCGGGCCACCGGCATCTACCTCGACGCCCTGAGAGCCGTCTTCTGGGAGATGCCCGTTATT
GCATCGGCGGCCAAGCGGGGATATCCGCAGATGATGCAGCCGAGCGGCATGAAGATGGACGGGCCGTACGATTGG
GTGCCGCCGAACTACTGGTACGACACTGGGAAGCGGCTCGGGGCTGCTTTCGGGTTCGGATCTGAGCTGGGGTCG
GGCGTGGGGACCCCTGAGTATGCAAGCTTGGCTGGCTTTCTCTCTGCTGGGGAGTTGGAGAGTCTCTGGAAACGA
CCAGACGATAACTTGTTCCACATGTCGACCAGCAAATCATTCTTTACGAACCGAAGCATCTACAATGAGGCCCTG
TTTCAGAGATATGGACGCCCAACCTCGCTGAAAGACTACCTCTGGAAGTGCCAGATGATGGACTACGAAGCAACC
CGCGCCCAGAACGAAGCCTACGCATCCCGGTGGAACGCCCAACGGCCAGCCACGGGATCCATCTACTGGATGCTT
AACAGTGCCTGGCCATCTCTCCACTGGAGCCTGTTCGACTACCTCATGCACCCGGCCGGAGCCTACTTCGGAGCC
AAGACGGCGGGCCGGATCCAGCACGTCGCGTATGACTACGTGAGTCGAAGTGTGTGGCTCGTCGACCGCTCGCTG
GGTAGGCGTGAGGTGCGGACGGTTACCATTGAAGTCTTGGACTTGGGTGGGACGACTGTCTATAGGAGGAGGGTG
AGGGCGTTTACCAGAGGGAACACGGCTGTCCGGGTTGCGGATCTTTCTGGGCTGACTTGCACGGATGCCGTTGTT
CTCCTGCGGCTGCTTCTCTGCGACGAACGAGGCAGACCGTTGAGCCGCAACGTCTACTGGATCGCCAGAGAAGTC
GACGTGTTAGACTGGAACCGCTCGACATGGTATCACACGCCCGTCACCAAATTCGCAAACTTCAAAGACCTGAGC
AGCATGGCAACGGCAAAAGTGCTCGCCCAGGCATCGCCAACCGGTGCAAAGACCATGACCGTGGAGCTCCAGAAC
GAATCCCCCGTGCCGGCATTCTTTATCCGGCTCAGCGTGGTGGACGAGAGCGGCGAGGAGGTGACGCCCGTGATC
TGGTCGGATAATTACGTGACGCTGTGGCCGTTTGAGCGGCTACGGGTTGATGTTGAGTTGATTGAGGTGGTGGCT
GGAGTGAGGGTGAGGATCAATGGGTGGAATGTGGGTGAGTAA
Transcript >Ophun1|1577
ATGCCTGCGTCACTGCAGCTTGCCATCTTCTCACGTCCTCTGCTGGTGTCTCTTCCCGGCTACGATGCCTCGTGC
TGGCATCACATTGAGGTCTCACGCTGCACCGTAATGGGATGTCTTCTGGCTTCAGGCGTCTACAACGATTCGCAT
CTCTGGTACTCTGACAATCTCAAGAGATTCGACCGCAGCCAGTTCTCCGTCCCTTGGGTTTATAGGAGTGAATTC
TCGCTGTCGCCGGAAAGGGGGCAGCATTACTCACTACAAACACACGGCATCACATCCAGAGCAGACATTTTCCTC
AACGGCAAGCAGATAGCAAACTCGAGCTTTCAGTCCGGCTCTTTTGGGGGTCACATGTACGACGTTACCGACGTG
GTTACGCGCGATAATGCCGTTGCTGTCGTCGCCTATCCCGGAGACTTTAATTACGACCTCATACAAGGCTTCGTG
GACTGGAACCCATCGCCTCCGGATAACTCGACTGGCGTTTGGCGCGATGTGTTTGTGAAACAGACCGGCCCGGTG
AGCATGGGACCTGTGAGCGTTTCCATAGAGGATCTGGCTTCGGCGTCGGCTACGATCACTGTGCGTGCTGAGGCG
AAGAACCTGCAACATGACGAGGTGTGGCTCCTAGTGAAGTCAAGGATCACGGACCCTTCTGGACGCCACAAGTTT
CTGCGAGCCACTGTTGTAAAGCTGCCGCGCAATGGAGCCGCTCTCGTGGAGCTTTCGCACAAGATCAGAAAGCCC
AGAGTCTGGTGGCCGAAGCAATGGGGTCAGCAGCCCCTTTACACCTCCGAGCTGATCTTCTCAGTCGACTCTGCC
ATCTCAGATGCAAGCCGGCATTCATTCGGAATTCGCACCGTCACATCCAGTCTCAACAAATACAATGACACCGTT
TTCCAGGTAAATGGCAGGCCATTCCAGGTCTCGGGAGGCGGATATGCGCCCGATCAATTCCTCCGCTGGGACAGA
GGGCGATTTCTCACGATAGCGAGATACGCGCTTGACATGGGATTGAACACGATTCGGCTCGAAGGTATGCTTGAG
CATCCAGAGCTGTATCAGATAGCAGATGAGCTGGGCATCATGATCCTTCCCGGTTGGGTCTGCTGCTCTAAATGG
GAAGCGTGGAAGCACAATCACGACCTGCACATTAAGCCGGTCCCATACTGGCACGAGGAAGACTATAAGACAGCA
GCCGCTAGCATGGCGCATGAAGCGGCAATGCTTCGAAATCACCCCAGCGTCCTGGGCTTTCTGATCGGCAGCGAC
TCATGGCCAGACGACCGGGCCACCGGCATCTACCTCGACGCCCTGAGAGCCGTCTTCTGGGAGATGCCCGTTATT
GCATCGGCGGCCAAGCGGGGATATCCGCAGATGATGCAGCCGAGCGGCATGAAGATGGACGGGCCGTACGATTGG
GTGCCGCCGAACTACTGGTACGACACTGGGAAGCGGCTCGGGGCTGCTTTCGGGTTCGGATCTGAGCTGGGGTCG
GGCGTGGGGACCCCTGAGTATGCAAGCTTGGCTGGCTTTCTCTCTGCTGGGGAGTTGGAGAGTCTCTGGAAACGA
CCAGACGATAACTTGTTCCACATGTCGACCAGCAAATCATTCTTTACGAACCGAAGCATCTACAATGAGGCCCTG
TTTCAGAGATATGGACGCCCAACCTCGCTGAAAGACTACCTCTGGAAGTGCCAGATGATGGACTACGAAGCAACC
CGCGCCCAGAACGAAGCCTACGCATCCCGGTGGAACGCCCAACGGCCAGCCACGGGATCCATCTACTGGATGCTT
AACAGTGCCTGGCCATCTCTCCACTGGAGCCTGTTCGACTACCTCATGCACCCGGCCGGAGCCTACTTCGGAGCC
AAGACGGCGGGCCGGATCCAGCACGTCGCGTATGACTACGTGAGTCGAAGTGTGTGGCTCGTCGACCGCTCGCTG
GGTAGGCGTGAGGTGCGGACGGTTACCATTGAAGTCTTGGACTTGGGTGGGACGACTGTCTATAGGAGGAGGGTG
AGGGCGTTTACCAGAGGGAACACGGCTGTCCGGGTTGCGGATCTTTCTGGGCTGACTTGCACGGATGCCGTTGTT
CTCCTGCGGCTGCTTCTCTGCGACGAACGAGGCAGACCGTTGAGCCGCAACGTCTACTGGATCGCCAGAGAAGTC
GACGTGTTAGACTGGAACCGCTCGACATGGTATCACACGCCCGTCACCAAATTCGCAAACTTCAAAGACCTGAGC
AGCATGGCAACGGCAAAAGTGCTCGCCCAGGCATCGCCAACCGGTGCAAAGACCATGACCGTGGAGCTCCAGAAC
GAATCCCCCGTGCCGGCATTCTTTATCCGGCTCAGCGTGGTGGACGAGAGCGGCGAGGAGGTGACGCCCGTGATC
TGGTCGGATAATTACGTGACGCTGTGGCCGTTTGAGCGGCTACGGGTTGATGTTGAGTTGATTGAGGTGGTGGCT
GGAGTGAGGGTGAGGATCAATGGGTGGAATGTGGGTGAGTAA
Gene >Ophun1|1577
ATGCCTGCGTCACTGCAGCTTGCCATCTTCTCACGTCCTCTGCTGGTCAGCGAGCAGCCATCCCTCGCTGGGATT
TACAGTCTTCATCCCTCCTCGAAAAGGATGTAACGCAGGTGTCTCTTCCCGGCTACGATGCCTCGTGCTGGCATC
ACATTGAGGTCTCACGCTGCACCGTAATGGGATGTCTTCTGGCTTCAGGCGTCTACAACGATTCGCATCTCTGGT
ACTCTGACAATCTCAAGAGATTCGACCGCAGCCAGTTCTCCGTCCCTTGGGTTTATAGGAGTGAATTCTCGCTGT
CGCCGGAAAGGGGGCAGCATTACTCACTACAAACACACGGCATCACATCCAGAGCAGACATTTTCCTCAACGGCA
AGCAGATAGCAAACTCGAGCTTTCAGTCCGGCTCTTTTGGGGGTCACATGTACGACGTTACCGACGTGGTTACGC
GCGATAATGCCGTTGCTGTCGTCGCCTATCCCGGAGACTTTAATTACGACCTCATACAAGGCTTCGTGGACTGGA
ACCCATCGCCTCCGGATAACTCGACTGGCGTTTGGCGCGATGTGTTTGTGAAACAGACCGGCCCGGTGAGCATGG
GACCTGTGAGCGTTTCCATAGAGGATCTGGCTTCGGCGTCGGCTACGATCACTGTGCGTGCTGAGGCGAAGAACC
TGCAACATGACGAGGTGTGGCTCCTAGTGAAGTCAAGGATCACGGACCCTTCTGGACGCCACAAGTTTCTGCGAG
CCACTGTTGTAAAGCTGCCGCGCAATGGAGCCGCTCTCGTGGAGCTTTCGCACAAGATCAGAAAGCCCAGAGTCT
GGTGGCCGAAGCAATGGGGTCAGCAGCCCCTTTACACCTCCGAGCTGATCTTCTCAGTCGACTCTGCCATCTCAG
ATGCAAGCCGGCATTCATTCGGAATTCGCACCGTCACATCCAGTCTCAACAAATACAATGACACCGTTTTCCAGG
TAAATGGCAGGCCATTCCAGGTCTCGGGAGGCGGATATGCGCCCGATCAATTCCTCCGCTGGGACAGAGGGCGAT
TTCTCACGATAGCGAGATACGCGCTTGACATGGGATTGAACACGATTCGGCTCGAAGGTATGCTTGAGCATCCAG
AGCTGTATCAGATAGCAGATGAGCTGGGCATCATGATCCTTCCCGGTTGGGTCTGCTGCTCTAAATGGGAAGCGT
GGAAGCACAATCACGACCTGCACATTAAGCCGGTCCCATACTGGCACGAGGAAGACTATAAGACAGCAGCCGCTA
GCATGGCGCATGAAGCGGCAATGCTTCGAAATCACCCCAGCGTCCTGGGCTTTCTGATCGGCAGCGACTCATGGC
CAGACGACCGGGCCACCGGCATCTACCTCGACGCCCTGAGAGCCGTCTTCTGGGAGATGCCCGTTATTGCATCGG
CGGCCAAGCGGGGATATCCGCAGATGATGCAGCCGAGCGGCATGAAGATGGACGGGCCGTACGATTGGGTGCCGC
CGAACTACTGGTACGACACTGGGAAGCGGCTCGGGGCTGCTTTCGGGTTCGGATCTGAGCTGGGGTCGGGCGTGG
GGACCCCTGAGTATGCAAGCTTGGCTGGCTTTCTCTCTGCTGGGGAGTTGGAGAGTCTCTGGAAACGACCAGACG
ATAACTTGTTCCACATGTCGACCAGCAAATCATTCTTTACGAACCGAAGCATCTACAATGAGGCCCTGTTTCAGA
GATATGGACGCCCAACCTCGCTGAAAGACTACCTCTGGAAGTGCCAGATGATGGACTACGAAGCAACCCGCGCCC
AGAACGAAGCCTACGCATCCCGGTGGAACGCCCAACGGCCAGCCACGGGATCCATCTACTGGATGCTTAACAGTG
CCTGGCCATCTCTCCACTGGAGCCTGTTCGACTACCTCATGCACCCGGCCGGAGCCTACTTCGGAGCCAAGACGG
CGGGCCGGATCCAGCACGTCGCGTATGACTACGTGAGTCGAAGTGTGTGGCTCGTCGACCGCTCGCTGGGTAGGC
GTGAGGTGCGGACGGTTACCATTGAAGTCTTGGACTTGGGTGGGACGACTGTCTATAGGAGGAGGGTGAGGGCGT
TTACCAGAGGGAACACGGCTGTCCGGGTTGCGGATCTTTCTGGGCTGACTTGCACGGATGCCGTTGTTCTCCTGC
GGCTGCTTCTCTGCGACGAACGAGGCAGACCGTTGAGCCGCAACGTCTACTGGATCGCCAGAGAAGTCGACGTGT
TAGACTGGAACCGCTCGACATGGTATCACACGCCCGTCACCAAATTCGCAAACTTCAAAGACCTGAGCAGCATGG
CAACGGCAAAAGTGCTCGCCCAGGCATCGCCAACCGGTGCAAAGACCATGACCGTGGAGCTCCAGAACGAATCCC
CCGTGCCGGCATTCTTTATCCGGCTCAGCGTGGTGGACGAGAGCGGCGAGGAGGTGACGCCCGTGATCTGGTCGG
ATAATTACGTGACGCTGTGGCCGTTTGAGCGGCTACGGGTTGATGTTGAGTTGATTGAGGTGGTGGCTGGAGTGA
GGGTGAGGATCAATGGGTGGAATGTGGGTGAGTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail