Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|1576
Gene name
LocationContig_167:9283..10960
Strand+
Gene length (bp)1677
Transcript length (bp)1677
Coding sequence length (bp)1677
Protein length (aa) 559

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF16499 Melibiase_2 Alpha galactosidase A 6.2E-50 30 310
PF17801 Melibiase_C Alpha galactosidase C-terminal beta sandwich domain 9.2E-11 323 406
PF00652 Ricin_B_lectin Ricin-type beta-trefoil lectin domain 5.8E-08 416 518

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|B8MWJ5|AGALA_ASPFN Probable alpha-galactosidase A OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=aglA PE=3 SV=1 8 534 5.0E-155
sp|Q2UT06|AGALA_ASPOR Probable alpha-galactosidase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=aglA PE=3 SV=1 8 534 7.0E-155
sp|P28351|AGALA_ASPNG Alpha-galactosidase A OS=Aspergillus niger GN=aglA PE=1 SV=1 26 532 9.0E-154
sp|Q0CPK2|AGALA_ASPTN Probable alpha-galactosidase A OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=aglA PE=3 SV=2 8 534 2.0E-153
sp|A2QL72|AGALA_ASPNC Probable alpha-galactosidase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=aglA PE=3 SV=1 26 532 1.0E-151
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|B8MWJ5|AGALA_ASPFN Probable alpha-galactosidase A OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=aglA PE=3 SV=1 8 534 5.0E-155
sp|Q2UT06|AGALA_ASPOR Probable alpha-galactosidase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=aglA PE=3 SV=1 8 534 7.0E-155
sp|P28351|AGALA_ASPNG Alpha-galactosidase A OS=Aspergillus niger GN=aglA PE=1 SV=1 26 532 9.0E-154
sp|Q0CPK2|AGALA_ASPTN Probable alpha-galactosidase A OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=aglA PE=3 SV=2 8 534 2.0E-153
sp|A2QL72|AGALA_ASPNC Probable alpha-galactosidase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=aglA PE=3 SV=1 26 532 1.0E-151
sp|A1DDD8|AGALA_NEOFI Probable alpha-galactosidase A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=aglA PE=3 SV=1 26 532 5.0E-148
sp|Q4WVZ3|AGALA_ASPFU Probable alpha-galactosidase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=aglA PE=3 SV=1 7 532 1.0E-147
sp|A1CBW8|AGALA_ASPCL Probable alpha-galactosidase A OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=aglA PE=3 SV=1 1 532 2.0E-144
sp|Q8RX86|AGAL2_ARATH Alpha-galactosidase 2 OS=Arabidopsis thaliana GN=AGAL2 PE=1 SV=1 30 411 1.0E-54
sp|Q42656|AGAL_COFAR Alpha-galactosidase OS=Coffea arabica PE=1 SV=1 30 407 1.0E-53
sp|P14749|AGAL_CYATE Alpha-galactosidase OS=Cyamopsis tetragonoloba PE=1 SV=1 30 410 2.0E-51
sp|Q9FXT4|AGAL_ORYSJ Alpha-galactosidase OS=Oryza sativa subsp. japonica GN=Os10g0493600 PE=1 SV=1 30 407 4.0E-48
sp|Q9FT97|AGAL1_ARATH Alpha-galactosidase 1 OS=Arabidopsis thaliana GN=AGAL1 PE=2 SV=1 30 410 1.0E-47
sp|Q90744|NAGAB_CHICK Alpha-N-acetylgalactosaminidase OS=Gallus gallus GN=NAGA PE=1 SV=1 30 410 5.0E-47
sp|Q8VXZ7|AGAL3_ARATH Alpha-galactosidase 3 OS=Arabidopsis thaliana GN=AGAL3 PE=1 SV=1 30 409 1.0E-43
sp|Q99172|MEL_LACCI Alpha-galactosidase OS=Lachancea cidri GN=MEL PE=3 SV=1 19 358 4.0E-43
sp|Q9URZ0|AGAL_SCHPO Alpha-galactosidase mel1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mel1 PE=3 SV=1 30 408 8.0E-43
sp|B3PGJ1|AGAL_CELJU Alpha-galactosidase A OS=Cellvibrio japonicus (strain Ueda107) GN=agaA PE=1 SV=1 8 409 2.0E-41
sp|Q66H12|NAGAB_RAT Alpha-N-acetylgalactosaminidase OS=Rattus norvegicus GN=Naga PE=2 SV=1 26 388 7.0E-41
sp|Q9QWR8|NAGAB_MOUSE Alpha-N-acetylgalactosaminidase OS=Mus musculus GN=Naga PE=1 SV=2 26 334 2.0E-40
sp|Q55B10|AGAL_DICDI Probable alpha-galactosidase OS=Dictyostelium discoideum GN=melA PE=3 SV=1 30 407 4.0E-40
sp|P17050|NAGAB_HUMAN Alpha-N-acetylgalactosaminidase OS=Homo sapiens GN=NAGA PE=1 SV=2 26 388 5.0E-40
sp|Q11129|MEL_SACMI Alpha-galactosidase OS=Saccharomyces mikatae GN=MEL PE=3 SV=1 5 406 5.0E-39
sp|P51569|AGAL_MOUSE Alpha-galactosidase A OS=Mus musculus GN=Gla PE=1 SV=1 30 408 7.0E-39
sp|P06280|AGAL_HUMAN Alpha-galactosidase A OS=Homo sapiens GN=GLA PE=1 SV=1 7 359 7.0E-39
sp|Q5AX28|AGALD_EMENI Alpha-galactosidase D OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=aglD PE=1 SV=2 1 415 9.0E-39
sp|Q03647|MEL_SACCA Alpha-galactosidase OS=Saccharomyces pastorianus (strain ATCC 76529 / Carlsberg bottom yeast no.1 / CBS 1513 / CLIB 176 / NBRC 1167 / NCYC 396 / NRRL Y-12693) GN=MEL PE=3 SV=1 5 406 2.0E-38
sp|A2R2S6|AGALD_ASPNC Probable alpha-galactosidase D OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=aglD PE=3 SV=2 30 419 2.0E-38
sp|Q9P4V4|MEL_ZYGMR Alpha-galactosidase OS=Zygotorulaspora mrakii GN=MEL PE=3 SV=1 30 346 6.0E-38
sp|P41945|MEL2_YEASX Alpha-galactosidase 2 OS=Saccharomyces cerevisiae GN=MEL2 PE=3 SV=1 5 410 2.0E-37
sp|Q58DH9|NAGAB_BOVIN Alpha-N-acetylgalactosaminidase OS=Bos taurus GN=NAGA PE=2 SV=1 26 388 4.0E-37
sp|A2QEJ9|AGALB_ASPNC Probable alpha-galactosidase B OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=aglB PE=3 SV=1 6 313 1.0E-36
sp|Q9Y865|AGALB_ASPNG Probable alpha-galactosidase B OS=Aspergillus niger GN=aglB PE=2 SV=1 6 313 2.0E-36
sp|Q2UI87|AGALD_ASPOR Probable alpha-galactosidase D OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=aglD PE=3 SV=2 1 416 2.0E-36
sp|P41947|MEL6_YEASX Alpha-galactosidase 6 OS=Saccharomyces cerevisiae GN=MEL6 PE=3 SV=1 5 410 3.0E-36
sp|P04824|MEL1_YEASX Alpha-galactosidase 1 OS=Saccharomyces cerevisiae GN=MEL1 PE=1 SV=1 5 387 4.0E-36
sp|Q0CVX4|AGALD_ASPTN Probable alpha-galactosidase D OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=aglD PE=3 SV=2 9 423 4.0E-36
sp|A1D9S3|AGALD_NEOFI Probable alpha-galactosidase D OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=aglD PE=3 SV=1 1 418 4.0E-36
sp|A4DA70|AGALD_ASPFU Probable alpha-galactosidase D OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=aglD PE=3 SV=2 1 418 5.0E-36
sp|B0YEK2|AGALD_ASPFC Probable alpha-galactosidase D OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=aglD PE=3 SV=2 1 418 5.0E-36
sp|A1D0A3|AGALB_NEOFI Probable alpha-galactosidase B OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=aglB PE=3 SV=1 29 313 9.0E-36
sp|O94221|AGALB_PENSI Probable alpha-galactosidase B OS=Penicillium simplicissimum GN=agl1 PE=2 SV=1 29 316 1.0E-35
sp|P41946|MEL5_YEASX Alpha-galactosidase 5 OS=Saccharomyces cerevisiae GN=MEL5 PE=3 SV=1 5 410 1.0E-35
sp|B8N306|AGALB_ASPFN Probable alpha-galactosidase B OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=aglB PE=3 SV=1 29 396 3.0E-35
sp|Q2UJ97|AGALB_ASPOR Probable alpha-galactosidase B OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=aglB PE=3 SV=1 29 313 3.0E-35
sp|B8N7Z0|AGALD_ASPFN Probable alpha-galactosidase D OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=aglD PE=3 SV=1 1 415 1.0E-34
sp|A1C5D3|AGALB_ASPCL Probable alpha-galactosidase B OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=aglB PE=3 SV=1 8 433 2.0E-34
sp|B0Y224|AGALB_ASPFC Probable alpha-galactosidase B OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=aglB PE=3 SV=1 29 313 8.0E-34
sp|Q4WE86|AGALB_ASPFU Probable alpha-galactosidase B OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=aglB PE=3 SV=2 29 313 1.0E-33
sp|Q09187|MEL_SACPA Alpha-galactosidase OS=Saccharomyces paradoxus GN=MEL PE=3 SV=1 30 406 1.0E-32
sp|Q9UVD6|MEL_TORDE Alpha-galactosidase OS=Torulaspora delbrueckii GN=MEL PE=3 SV=1 30 345 4.0E-32
sp|A7XZT2|AGALB_TALEM Probable alpha-galactosidase B OS=Talaromyces emersonii PE=3 SV=1 29 410 7.0E-32
sp|Q5AVQ6|AGALB_EMENI Probable alpha-galactosidase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=aglB PE=2 SV=2 5 315 6.0E-31
[Show less]

GO

GO Term Description Terminal node
GO:0005975 carbohydrate metabolic process Yes
GO:0004553 hydrolase activity, hydrolyzing O-glycosyl compounds Yes
GO:0003674 molecular_function No
GO:0008152 metabolic process No
GO:0008150 biological_process No
GO:0071704 organic substance metabolic process No
GO:0003824 catalytic activity No
GO:0016787 hydrolase activity No
GO:0016798 hydrolase activity, acting on glycosyl bonds No
GO:0044238 primary metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 21 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|1576
MQRPIWFLALAAALVNPSSATPAERLLPLPPMGFNNWARYQTNISESIFVEAAEAMVRAGLLAARYNRINLDDAW
STTARAASRSLVWDAVKFPRGFPWLTQHLKSMGFLPGIYSDSGSLSCGGYPGSLDYEDVDLKDFTNWGFKFLKMD
GCNLPDGSEGTYHSIYGRWNRLLSESNSNIIFSDSAPAYFSNVPDLTNWYAAIGWAREYGHLARHSGDITTYPQG
RSWDTVMFIYRQHIRLARFQKPGFFNDPDFLNVDHPSYSMDEKKSHFALWCVFSAPLLLSADLTALSNAEIQYLT
NRRLIDVNQDSLVQQATLVSSDTTWDVLTKSIDNGDRVVAVLNKGNSPGSLFISWERLGFSLVPLQRIDFVTVED
LWTGKRRQTRVSLKGISVTAVPSHGTAVYRISQKASGVTPTGLIFNSKSLKCLTDSWSGLVRWSACDGSDAQVWK
VQPEGLISSLLQPGGCLMQIDQVFVSSRSPGRACDKWKYYVSGNLINTRSQLCLTEGTDGAAVTVSCGYLRNDQV
LSLPIGVVVLETRQRDRWTLSENHVENDLGGSV*
Coding >Ophun1|1576
ATGCAACGGCCTATATGGTTCCTGGCGCTGGCCGCAGCCCTCGTCAACCCCAGCTCCGCAACCCCTGCCGAACGG
CTCCTCCCGCTCCCCCCAATGGGCTTCAACAACTGGGCTCGCTACCAGACAAACATTAGCGAATCCATCTTCGTC
GAAGCCGCCGAAGCCATGGTCAGAGCCGGCCTCTTAGCTGCCAGATACAACCGTATAAACCTCGACGATGCCTGG
TCGACCACGGCACGAGCAGCCAGCAGATCCCTAGTCTGGGACGCGGTCAAGTTCCCGAGGGGGTTCCCTTGGCTC
ACGCAGCACTTGAAGTCCATGGGCTTCCTGCCTGGCATCTACAGCGACTCTGGCAGCTTATCCTGTGGCGGCTAC
CCGGGTTCTCTCGACTACGAGGACGTTGATCTCAAGGACTTTACAAACTGGGGCTTCAAGTTTCTCAAGATGGAC
GGCTGCAATCTCCCGGACGGCAGTGAGGGAACTTACCACTCGATATACGGCCGCTGGAACAGACTGCTCTCCGAG
TCCAACAGCAACATCATCTTCTCCGACTCCGCCCCTGCTTACTTCTCCAATGTCCCAGACCTGACAAACTGGTAT
GCTGCCATCGGCTGGGCCCGTGAATACGGCCATCTCGCCCGCCACAGCGGCGACATCACGACCTACCCGCAGGGT
CGATCGTGGGACACCGTCATGTTCATCTACAGACAGCACATTCGTCTGGCTCGCTTCCAGAAGCCGGGATTCTTC
AACGATCCGGACTTTCTCAACGTCGACCATCCGTCTTACAGCATGGATGAGAAGAAGAGCCACTTTGCGCTGTGG
TGCGTCTTCTCGGCGCCGCTGCTGCTCAGCGCCGACTTGACGGCCCTGTCAAACGCTGAGATCCAGTATCTCACC
AACCGCCGGCTCATAGACGTCAATCAGGACAGTTTGGTGCAGCAAGCTACGCTCGTGAGCTCCGACACCACATGG
GATGTTCTCACCAAGAGCATCGACAACGGCGATCGGGTTGTCGCCGTGCTCAACAAGGGCAACTCACCTGGCAGT
CTGTTCATCTCCTGGGAGAGGCTCGGCTTCTCGCTGGTTCCCCTCCAGAGAATCGATTTCGTTACCGTCGAAGAT
CTCTGGACCGGTAAGCGCCGGCAGACTCGCGTGAGCCTCAAGGGAATCTCCGTCACAGCAGTCCCCTCCCACGGC
ACCGCCGTCTACCGCATCTCGCAAAAGGCCAGTGGCGTTACGCCTACGGGCCTCATCTTCAACTCCAAAAGCCTC
AAGTGCCTCACCGATAGCTGGTCAGGCCTGGTCAGATGGTCTGCCTGCGACGGCTCCGATGCTCAGGTCTGGAAG
GTCCAGCCAGAAGGCCTGATTAGCAGCCTGCTTCAACCCGGCGGCTGTTTGATGCAGATCGATCAGGTGTTTGTC
TCGTCTCGCAGCCCGGGCCGCGCCTGCGACAAGTGGAAGTACTACGTCTCGGGCAACCTGATCAATACGAGGTCG
CAACTTTGCCTTACGGAGGGGACGGATGGGGCCGCTGTCACTGTTTCTTGTGGCTACCTGCGAAACGATCAGGTC
TTGAGCTTGCCTATCGGCGTTGTCGTGCTTGAGACGAGGCAACGTGACAGGTGGACTCTGAGCGAGAATCATGTA
GAAAATGATCTGGGTGGCAGTGTATAA
Transcript >Ophun1|1576
ATGCAACGGCCTATATGGTTCCTGGCGCTGGCCGCAGCCCTCGTCAACCCCAGCTCCGCAACCCCTGCCGAACGG
CTCCTCCCGCTCCCCCCAATGGGCTTCAACAACTGGGCTCGCTACCAGACAAACATTAGCGAATCCATCTTCGTC
GAAGCCGCCGAAGCCATGGTCAGAGCCGGCCTCTTAGCTGCCAGATACAACCGTATAAACCTCGACGATGCCTGG
TCGACCACGGCACGAGCAGCCAGCAGATCCCTAGTCTGGGACGCGGTCAAGTTCCCGAGGGGGTTCCCTTGGCTC
ACGCAGCACTTGAAGTCCATGGGCTTCCTGCCTGGCATCTACAGCGACTCTGGCAGCTTATCCTGTGGCGGCTAC
CCGGGTTCTCTCGACTACGAGGACGTTGATCTCAAGGACTTTACAAACTGGGGCTTCAAGTTTCTCAAGATGGAC
GGCTGCAATCTCCCGGACGGCAGTGAGGGAACTTACCACTCGATATACGGCCGCTGGAACAGACTGCTCTCCGAG
TCCAACAGCAACATCATCTTCTCCGACTCCGCCCCTGCTTACTTCTCCAATGTCCCAGACCTGACAAACTGGTAT
GCTGCCATCGGCTGGGCCCGTGAATACGGCCATCTCGCCCGCCACAGCGGCGACATCACGACCTACCCGCAGGGT
CGATCGTGGGACACCGTCATGTTCATCTACAGACAGCACATTCGTCTGGCTCGCTTCCAGAAGCCGGGATTCTTC
AACGATCCGGACTTTCTCAACGTCGACCATCCGTCTTACAGCATGGATGAGAAGAAGAGCCACTTTGCGCTGTGG
TGCGTCTTCTCGGCGCCGCTGCTGCTCAGCGCCGACTTGACGGCCCTGTCAAACGCTGAGATCCAGTATCTCACC
AACCGCCGGCTCATAGACGTCAATCAGGACAGTTTGGTGCAGCAAGCTACGCTCGTGAGCTCCGACACCACATGG
GATGTTCTCACCAAGAGCATCGACAACGGCGATCGGGTTGTCGCCGTGCTCAACAAGGGCAACTCACCTGGCAGT
CTGTTCATCTCCTGGGAGAGGCTCGGCTTCTCGCTGGTTCCCCTCCAGAGAATCGATTTCGTTACCGTCGAAGAT
CTCTGGACCGGTAAGCGCCGGCAGACTCGCGTGAGCCTCAAGGGAATCTCCGTCACAGCAGTCCCCTCCCACGGC
ACCGCCGTCTACCGCATCTCGCAAAAGGCCAGTGGCGTTACGCCTACGGGCCTCATCTTCAACTCCAAAAGCCTC
AAGTGCCTCACCGATAGCTGGTCAGGCCTGGTCAGATGGTCTGCCTGCGACGGCTCCGATGCTCAGGTCTGGAAG
GTCCAGCCAGAAGGCCTGATTAGCAGCCTGCTTCAACCCGGCGGCTGTTTGATGCAGATCGATCAGGTGTTTGTC
TCGTCTCGCAGCCCGGGCCGCGCCTGCGACAAGTGGAAGTACTACGTCTCGGGCAACCTGATCAATACGAGGTCG
CAACTTTGCCTTACGGAGGGGACGGATGGGGCCGCTGTCACTGTTTCTTGTGGCTACCTGCGAAACGATCAGGTC
TTGAGCTTGCCTATCGGCGTTGTCGTGCTTGAGACGAGGCAACGTGACAGGTGGACTCTGAGCGAGAATCATGTA
GAAAATGATCTGGGTGGCAGTGTATAA
Gene >Ophun1|1576
ATGCAACGGCCTATATGGTTCCTGGCGCTGGCCGCAGCCCTCGTCAACCCCAGCTCCGCAACCCCTGCCGAACGG
CTCCTCCCGCTCCCCCCAATGGGCTTCAACAACTGGGCTCGCTACCAGACAAACATTAGCGAATCCATCTTCGTC
GAAGCCGCCGAAGCCATGGTCAGAGCCGGCCTCTTAGCTGCCAGATACAACCGTATAAACCTCGACGATGCCTGG
TCGACCACGGCACGAGCAGCCAGCAGATCCCTAGTCTGGGACGCGGTCAAGTTCCCGAGGGGGTTCCCTTGGCTC
ACGCAGCACTTGAAGTCCATGGGCTTCCTGCCTGGCATCTACAGCGACTCTGGCAGCTTATCCTGTGGCGGCTAC
CCGGGTTCTCTCGACTACGAGGACGTTGATCTCAAGGACTTTACAAACTGGGGCTTCAAGTTTCTCAAGATGGAC
GGCTGCAATCTCCCGGACGGCAGTGAGGGAACTTACCACTCGATATACGGCCGCTGGAACAGACTGCTCTCCGAG
TCCAACAGCAACATCATCTTCTCCGACTCCGCCCCTGCTTACTTCTCCAATGTCCCAGACCTGACAAACTGGTAT
GCTGCCATCGGCTGGGCCCGTGAATACGGCCATCTCGCCCGCCACAGCGGCGACATCACGACCTACCCGCAGGGT
CGATCGTGGGACACCGTCATGTTCATCTACAGACAGCACATTCGTCTGGCTCGCTTCCAGAAGCCGGGATTCTTC
AACGATCCGGACTTTCTCAACGTCGACCATCCGTCTTACAGCATGGATGAGAAGAAGAGCCACTTTGCGCTGTGG
TGCGTCTTCTCGGCGCCGCTGCTGCTCAGCGCCGACTTGACGGCCCTGTCAAACGCTGAGATCCAGTATCTCACC
AACCGCCGGCTCATAGACGTCAATCAGGACAGTTTGGTGCAGCAAGCTACGCTCGTGAGCTCCGACACCACATGG
GATGTTCTCACCAAGAGCATCGACAACGGCGATCGGGTTGTCGCCGTGCTCAACAAGGGCAACTCACCTGGCAGT
CTGTTCATCTCCTGGGAGAGGCTCGGCTTCTCGCTGGTTCCCCTCCAGAGAATCGATTTCGTTACCGTCGAAGAT
CTCTGGACCGGTAAGCGCCGGCAGACTCGCGTGAGCCTCAAGGGAATCTCCGTCACAGCAGTCCCCTCCCACGGC
ACCGCCGTCTACCGCATCTCGCAAAAGGCCAGTGGCGTTACGCCTACGGGCCTCATCTTCAACTCCAAAAGCCTC
AAGTGCCTCACCGATAGCTGGTCAGGCCTGGTCAGATGGTCTGCCTGCGACGGCTCCGATGCTCAGGTCTGGAAG
GTCCAGCCAGAAGGCCTGATTAGCAGCCTGCTTCAACCCGGCGGCTGTTTGATGCAGATCGATCAGGTGTTTGTC
TCGTCTCGCAGCCCGGGCCGCGCCTGCGACAAGTGGAAGTACTACGTCTCGGGCAACCTGATCAATACGAGGTCG
CAACTTTGCCTTACGGAGGGGACGGATGGGGCCGCTGTCACTGTTTCTTGTGGCTACCTGCGAAACGATCAGGTC
TTGAGCTTGCCTATCGGCGTTGTCGTGCTTGAGACGAGGCAACGTGACAGGTGGACTCTGAGCGAGAATCATGTA
GAAAATGATCTGGGTGGCAGTGTATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail