Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|1573
Gene name
LocationContig_167:3429..4191
Strand+
Gene length (bp)762
Transcript length (bp)762
Coding sequence length (bp)762
Protein length (aa) 254

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12697 Abhydrolase_6 Alpha/beta hydrolase family 3.5E-16 10 244

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup3998
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis map64 (Brazil) OphauB2|4304
Ophiocordyceps australis map64 (Brazil) OphauB2|5646
Ophiocordyceps camponoti-floridani Ophcf2|01603
Ophiocordyceps camponoti-rufipedis Ophun1|1573 (this protein)
Ophiocordyceps kimflemingae Ophio5|6821
Ophiocordyceps subramaniannii Hirsu2|8015

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|1573
MTISKREQAVLIITGYWHVPEHFARVRSQLERKGIRVICECLPTIQNLPPPHKTIYDDIQFIKDIVAKEVEQLTF
LTVLCHSYGGMVASAALGEFAVDPNSTNKGGVTGIVYLSAFVPSENQSLISRLTNQLPDFIKVRPDNTCLPSPPI
PLFYSDLTFEDAEWAIGLLTRCPVAPMTSPIPGDRVAWRSIPSAYIVCEADGALPLKSQRSMVAAAKAQGAEFRE
YSLDTNHSPFINKPGAVADIVVDVMQSR*
Coding >Ophun1|1573
ATGACCATCTCAAAGAGAGAACAAGCAGTCCTCATTATCACCGGCTACTGGCATGTCCCGGAACACTTTGCCCGA
GTCCGCTCGCAGCTCGAAAGAAAGGGCATCAGGGTGATATGCGAGTGTCTACCAACTATTCAGAACCTCCCGCCT
CCTCACAAGACCATCTACGACGACATTCAGTTCATCAAGGATATCGTGGCCAAGGAAGTCGAGCAACTGACGTTC
CTGACTGTCCTGTGCCACTCTTACGGTGGAATGGTCGCTTCTGCCGCCCTCGGCGAATTCGCCGTCGACCCAAAC
TCGACGAATAAAGGGGGCGTGACGGGCATCGTCTACCTGTCCGCTTTTGTTCCCTCAGAGAACCAGTCTCTTATC
AGCCGGCTCACGAATCAACTGCCCGACTTCATCAAAGTACGGCCGGATAACACATGCTTGCCCTCCCCCCCGATC
CCTCTCTTCTACAGCGACTTGACTTTCGAGGACGCAGAGTGGGCTATAGGCCTCCTCACCAGGTGTCCAGTCGCC
CCCATGACTAGTCCCATCCCCGGGGACCGCGTGGCTTGGCGGTCGATCCCTTCGGCTTACATCGTCTGCGAGGCT
GACGGCGCTTTGCCTCTCAAGAGCCAGCGGTCAATGGTGGCGGCTGCCAAAGCCCAGGGAGCCGAATTCAGGGAG
TATAGCCTGGATACTAACCATAGTCCGTTCATTAACAAGCCGGGAGCAGTTGCGGATATTGTTGTCGATGTCATG
CAGTCTCGTTAG
Transcript >Ophun1|1573
ATGACCATCTCAAAGAGAGAACAAGCAGTCCTCATTATCACCGGCTACTGGCATGTCCCGGAACACTTTGCCCGA
GTCCGCTCGCAGCTCGAAAGAAAGGGCATCAGGGTGATATGCGAGTGTCTACCAACTATTCAGAACCTCCCGCCT
CCTCACAAGACCATCTACGACGACATTCAGTTCATCAAGGATATCGTGGCCAAGGAAGTCGAGCAACTGACGTTC
CTGACTGTCCTGTGCCACTCTTACGGTGGAATGGTCGCTTCTGCCGCCCTCGGCGAATTCGCCGTCGACCCAAAC
TCGACGAATAAAGGGGGCGTGACGGGCATCGTCTACCTGTCCGCTTTTGTTCCCTCAGAGAACCAGTCTCTTATC
AGCCGGCTCACGAATCAACTGCCCGACTTCATCAAAGTACGGCCGGATAACACATGCTTGCCCTCCCCCCCGATC
CCTCTCTTCTACAGCGACTTGACTTTCGAGGACGCAGAGTGGGCTATAGGCCTCCTCACCAGGTGTCCAGTCGCC
CCCATGACTAGTCCCATCCCCGGGGACCGCGTGGCTTGGCGGTCGATCCCTTCGGCTTACATCGTCTGCGAGGCT
GACGGCGCTTTGCCTCTCAAGAGCCAGCGGTCAATGGTGGCGGCTGCCAAAGCCCAGGGAGCCGAATTCAGGGAG
TATAGCCTGGATACTAACCATAGTCCGTTCATTAACAAGCCGGGAGCAGTTGCGGATATTGTTGTCGATGTCATG
CAGTCTCGTTAG
Gene >Ophun1|1573
ATGACCATCTCAAAGAGAGAACAAGCAGTCCTCATTATCACCGGCTACTGGCATGTCCCGGAACACTTTGCCCGA
GTCCGCTCGCAGCTCGAAAGAAAGGGCATCAGGGTGATATGCGAGTGTCTACCAACTATTCAGAACCTCCCGCCT
CCTCACAAGACCATCTACGACGACATTCAGTTCATCAAGGATATCGTGGCCAAGGAAGTCGAGCAACTGACGTTC
CTGACTGTCCTGTGCCACTCTTACGGTGGAATGGTCGCTTCTGCCGCCCTCGGCGAATTCGCCGTCGACCCAAAC
TCGACGAATAAAGGGGGCGTGACGGGCATCGTCTACCTGTCCGCTTTTGTTCCCTCAGAGAACCAGTCTCTTATC
AGCCGGCTCACGAATCAACTGCCCGACTTCATCAAAGTACGGCCGGATAACACATGCTTGCCCTCCCCCCCGATC
CCTCTCTTCTACAGCGACTTGACTTTCGAGGACGCAGAGTGGGCTATAGGCCTCCTCACCAGGTGTCCAGTCGCC
CCCATGACTAGTCCCATCCCCGGGGACCGCGTGGCTTGGCGGTCGATCCCTTCGGCTTACATCGTCTGCGAGGCT
GACGGCGCTTTGCCTCTCAAGAGCCAGCGGTCAATGGTGGCGGCTGCCAAAGCCCAGGGAGCCGAATTCAGGGAG
TATAGCCTGGATACTAACCATAGTCCGTTCATTAACAAGCCGGGAGCAGTTGCGGATATTGTTGTCGATGTCATG
CAGTCTCGTTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail