Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|1572
Gene name
LocationContig_167:1084..2500
Strand+
Gene length (bp)1416
Transcript length (bp)1416
Coding sequence length (bp)1416
Protein length (aa) 472

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01490 Aa_trans Transmembrane amino acid transporter protein 1.6E-53 66 460

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P38680|MTR_NEUCR N amino acid transport system protein OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=mtr PE=3 SV=2 40 466 0.0E+00
sp|Q38967|AAP2_ARATH Amino acid permease 2 OS=Arabidopsis thaliana GN=AAP2 PE=1 SV=1 61 463 2.0E-07
sp|O80592|AAP8_ARATH Amino acid permease 8 OS=Arabidopsis thaliana GN=AAP8 PE=1 SV=1 76 465 5.0E-06

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 64 0.45

Transmembrane Domains

Domain # Start End Length
1 91 113 22
2 149 171 22
3 181 200 19
4 207 229 22
5 249 268 19
6 288 310 22
7 330 352 22
8 372 394 22
9 399 421 22
10 438 460 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|1572
MGIMEYSSEPDAKLVKSTSEPREESSSSSDNVLGGSAIAGEVSEFEERRCDMEKQKTEAGDAHFHRLGWKRLTVI
LIVEAVALGSLSLPAAFATLGMVAGVICCVGLGLIAIYTSDIVGQVKLKYPDVAHYADAGRLLMGRFGYELTGAM
FVLQLTFLVGSHTLTGTIAFLDITNNGACSVVFGFVSAVILLLLAVPPSFAEVAILGYIDFVSILAAIGITLIAT
GIIATDSPGGLAAVNWSAWPKTGISFAEAFIAIANIVFAYSFCMCQFSFMDEMHTPSDYLKSIWTLGIIEIIIYT
LTGAIIYAFVGVDVKSPALLSAGPLISKIAFGVALPVIFISGSINTTVVGRYIHGRMFKDSVTRFINTPRGWITW
LAVITVVTIAAFIIAEVIPFFSDLLSISSSLFVSGFTFYIPAMMWYKLLRVGPWYSRENLIHALMNGFCFIIGIV
VLVCGTYGSIDDIVSRLILVP*
Coding >Ophun1|1572
ATGGGCATCATGGAGTACTCGTCGGAGCCCGACGCGAAGCTGGTCAAGTCGACCTCTGAGCCCCGAGAGGAATCG
TCGTCCTCGTCGGATAATGTACTAGGGGGCAGCGCCATCGCCGGCGAGGTCAGCGAGTTCGAGGAGCGGCGCTGC
GACATGGAGAAGCAAAAGACGGAGGCGGGCGACGCCCACTTCCACCGGTTGGGTTGGAAACGACTGACCGTCATC
CTCATCGTCGAGGCCGTTGCTCTCGGCAGCTTGAGTCTCCCCGCGGCCTTTGCCACGCTTGGAATGGTGGCGGGC
GTCATCTGCTGCGTCGGACTGGGCCTCATCGCCATCTATACCAGCGACATCGTCGGTCAGGTCAAGCTCAAGTAT
CCCGATGTCGCTCACTATGCCGACGCCGGACGGTTGCTTATGGGTCGTTTCGGCTACGAGCTCACGGGCGCCATG
TTTGTGTTGCAGTTGACGTTTCTCGTCGGCTCTCACACCTTGACAGGCACCATTGCCTTCCTCGACATCACCAAC
AACGGCGCCTGCTCCGTCGTCTTCGGCTTCGTCTCGGCTGTCATCTTGCTGTTGCTGGCGGTTCCGCCGTCTTTC
GCAGAGGTTGCTATCCTGGGATACATCGACTTCGTCTCCATCCTGGCCGCCATTGGTATCACGCTCATCGCCACC
GGCATCATCGCCACCGACTCTCCCGGGGGCTTAGCCGCTGTAAACTGGTCCGCGTGGCCGAAGACCGGCATCAGC
TTCGCCGAGGCCTTCATCGCCATCGCCAACATCGTCTTCGCTTACAGCTTCTGCATGTGTCAGTTCTCCTTTATG
GACGAGATGCACACTCCAAGCGACTACCTCAAGTCCATCTGGACGCTGGGAATCATCGAGATCATCATCTACACC
CTCACCGGCGCCATCATCTATGCCTTTGTCGGTGTCGATGTCAAGTCGCCCGCCCTGCTGTCAGCCGGTCCGCTC
ATCTCCAAGATCGCCTTCGGAGTTGCGCTGCCCGTCATCTTCATCTCGGGATCCATCAACACTACCGTCGTCGGC
CGCTATATCCACGGCCGCATGTTCAAAGACTCCGTCACGCGCTTCATCAACACGCCCAGGGGCTGGATCACCTGG
CTGGCCGTCATCACCGTCGTCACCATCGCCGCCTTCATCATCGCCGAGGTCATTCCCTTCTTCTCCGACCTGCTG
TCCATCTCGTCCTCCCTCTTCGTCTCCGGCTTCACCTTTTATATCCCAGCCATGATGTGGTACAAGTTGCTCCGG
GTCGGGCCGTGGTATTCGCGCGAGAACCTGATTCACGCCTTGATGAACGGCTTCTGCTTCATCATCGGCATCGTC
GTCCTGGTCTGCGGCACATACGGCAGTATCGATGATATTGTAAGTCGCTTGATTCTCGTCCCTTGA
Transcript >Ophun1|1572
ATGGGCATCATGGAGTACTCGTCGGAGCCCGACGCGAAGCTGGTCAAGTCGACCTCTGAGCCCCGAGAGGAATCG
TCGTCCTCGTCGGATAATGTACTAGGGGGCAGCGCCATCGCCGGCGAGGTCAGCGAGTTCGAGGAGCGGCGCTGC
GACATGGAGAAGCAAAAGACGGAGGCGGGCGACGCCCACTTCCACCGGTTGGGTTGGAAACGACTGACCGTCATC
CTCATCGTCGAGGCCGTTGCTCTCGGCAGCTTGAGTCTCCCCGCGGCCTTTGCCACGCTTGGAATGGTGGCGGGC
GTCATCTGCTGCGTCGGACTGGGCCTCATCGCCATCTATACCAGCGACATCGTCGGTCAGGTCAAGCTCAAGTAT
CCCGATGTCGCTCACTATGCCGACGCCGGACGGTTGCTTATGGGTCGTTTCGGCTACGAGCTCACGGGCGCCATG
TTTGTGTTGCAGTTGACGTTTCTCGTCGGCTCTCACACCTTGACAGGCACCATTGCCTTCCTCGACATCACCAAC
AACGGCGCCTGCTCCGTCGTCTTCGGCTTCGTCTCGGCTGTCATCTTGCTGTTGCTGGCGGTTCCGCCGTCTTTC
GCAGAGGTTGCTATCCTGGGATACATCGACTTCGTCTCCATCCTGGCCGCCATTGGTATCACGCTCATCGCCACC
GGCATCATCGCCACCGACTCTCCCGGGGGCTTAGCCGCTGTAAACTGGTCCGCGTGGCCGAAGACCGGCATCAGC
TTCGCCGAGGCCTTCATCGCCATCGCCAACATCGTCTTCGCTTACAGCTTCTGCATGTGTCAGTTCTCCTTTATG
GACGAGATGCACACTCCAAGCGACTACCTCAAGTCCATCTGGACGCTGGGAATCATCGAGATCATCATCTACACC
CTCACCGGCGCCATCATCTATGCCTTTGTCGGTGTCGATGTCAAGTCGCCCGCCCTGCTGTCAGCCGGTCCGCTC
ATCTCCAAGATCGCCTTCGGAGTTGCGCTGCCCGTCATCTTCATCTCGGGATCCATCAACACTACCGTCGTCGGC
CGCTATATCCACGGCCGCATGTTCAAAGACTCCGTCACGCGCTTCATCAACACGCCCAGGGGCTGGATCACCTGG
CTGGCCGTCATCACCGTCGTCACCATCGCCGCCTTCATCATCGCCGAGGTCATTCCCTTCTTCTCCGACCTGCTG
TCCATCTCGTCCTCCCTCTTCGTCTCCGGCTTCACCTTTTATATCCCAGCCATGATGTGGTACAAGTTGCTCCGG
GTCGGGCCGTGGTATTCGCGCGAGAACCTGATTCACGCCTTGATGAACGGCTTCTGCTTCATCATCGGCATCGTC
GTCCTGGTCTGCGGCACATACGGCAGTATCGATGATATTGTAAGTCGCTTGATTCTCGTCCCTTGA
Gene >Ophun1|1572
ATGGGCATCATGGAGTACTCGTCGGAGCCCGACGCGAAGCTGGTCAAGTCGACCTCTGAGCCCCGAGAGGAATCG
TCGTCCTCGTCGGATAATGTACTAGGGGGCAGCGCCATCGCCGGCGAGGTCAGCGAGTTCGAGGAGCGGCGCTGC
GACATGGAGAAGCAAAAGACGGAGGCGGGCGACGCCCACTTCCACCGGTTGGGTTGGAAACGACTGACCGTCATC
CTCATCGTCGAGGCCGTTGCTCTCGGCAGCTTGAGTCTCCCCGCGGCCTTTGCCACGCTTGGAATGGTGGCGGGC
GTCATCTGCTGCGTCGGACTGGGCCTCATCGCCATCTATACCAGCGACATCGTCGGTCAGGTCAAGCTCAAGTAT
CCCGATGTCGCTCACTATGCCGACGCCGGACGGTTGCTTATGGGTCGTTTCGGCTACGAGCTCACGGGCGCCATG
TTTGTGTTGCAGTTGACGTTTCTCGTCGGCTCTCACACCTTGACAGGCACCATTGCCTTCCTCGACATCACCAAC
AACGGCGCCTGCTCCGTCGTCTTCGGCTTCGTCTCGGCTGTCATCTTGCTGTTGCTGGCGGTTCCGCCGTCTTTC
GCAGAGGTTGCTATCCTGGGATACATCGACTTCGTCTCCATCCTGGCCGCCATTGGTATCACGCTCATCGCCACC
GGCATCATCGCCACCGACTCTCCCGGGGGCTTAGCCGCTGTAAACTGGTCCGCGTGGCCGAAGACCGGCATCAGC
TTCGCCGAGGCCTTCATCGCCATCGCCAACATCGTCTTCGCTTACAGCTTCTGCATGTGTCAGTTCTCCTTTATG
GACGAGATGCACACTCCAAGCGACTACCTCAAGTCCATCTGGACGCTGGGAATCATCGAGATCATCATCTACACC
CTCACCGGCGCCATCATCTATGCCTTTGTCGGTGTCGATGTCAAGTCGCCCGCCCTGCTGTCAGCCGGTCCGCTC
ATCTCCAAGATCGCCTTCGGAGTTGCGCTGCCCGTCATCTTCATCTCGGGATCCATCAACACTACCGTCGTCGGC
CGCTATATCCACGGCCGCATGTTCAAAGACTCCGTCACGCGCTTCATCAACACGCCCAGGGGCTGGATCACCTGG
CTGGCCGTCATCACCGTCGTCACCATCGCCGCCTTCATCATCGCCGAGGTCATTCCCTTCTTCTCCGACCTGCTG
TCCATCTCGTCCTCCCTCTTCGTCTCCGGCTTCACCTTTTATATCCCAGCCATGATGTGGTACAAGTTGCTCCGG
GTCGGGCCGTGGTATTCGCGCGAGAACCTGATTCACGCCTTGATGAACGGCTTCTGCTTCATCATCGGCATCGTC
GTCCTGGTCTGCGGCACATACGGCAGTATCGATGATATTGTAAGTCGCTTGATTCTCGTCCCTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail