Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|1571
Gene name
LocationContig_1666:13..1259
Strand+
Gene length (bp)1246
Transcript length (bp)1188
Coding sequence length (bp)1188
Protein length (aa) 396

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08316 Pal1 Pal1 cell morphology protein 1.2E-47 130 264

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q05518|PAL1_YEAST Protein PAL1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PAL1 PE=1 SV=1 116 290 8.0E-26
sp|P38809|YHP7_YEAST Uncharacterized protein YHR097C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YHR097C PE=1 SV=1 117 383 4.0E-23
sp|Q9UU83|PAL1_SCHPO Protein pal1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pal1 PE=1 SV=1 119 290 7.0E-22

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup2206
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4982
Ophiocordyceps australis map64 (Brazil) OphauB2|1950
Ophiocordyceps camponoti-floridani Ophcf2|00892
Ophiocordyceps camponoti-rufipedis Ophun1|1571 (this protein)
Ophiocordyceps kimflemingae Ophio5|738
Ophiocordyceps subramaniannii Hirsu2|2779

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|1571
MTKPPRVEGKPLPPKSTSPSKGSHRPTRSQEEAQKARKPPGAGPRPGPSGSPQRKPLPRPRRNSESSVMDLSAQP
ITQEEMKMIEAKRLRDRQRRDRDGRSAAGRDVKGGDGKADGKDRNKSKRPSRRLDIIDQLDATSIYGTGLFHHDG
PFDALNPHRNRHNSRRAPMQAFPKDSLNNSIGGAGPLNRNPDHAVFMGNGTDEAFRDYAGGIKNKNGYSYPGSSS
GEAAIFDPVARGAVVHGDESHGLGTSTFLEGTPAARTAIARREAEHAQDAVEGGLQRKKSLAQRIRHINKGPRDF
TPSGRMTNPEATTTLMRRSTDGAASAGVGGSDANPFFAEFGEETLSVKPRDTTGSPPGSSPTDEGGKPSGLLGRM
KSLKGGKKTRTSEQGMGVAL*
Coding >Ophun1|1571
ATGACGAAGCCGCCCAGAGTCGAGGGCAAGCCGCTGCCGCCCAAGTCGACGTCGCCGTCCAAGGGTAGTCATCGC
CCCACGCGGTCGCAGGAGGAGGCACAAAAGGCCCGAAAGCCGCCTGGTGCCGGCCCGAGGCCCGGCCCGTCTGGC
TCGCCCCAGCGCAAACCGCTTCCGAGGCCGCGGCGCAACTCGGAGTCGTCGGTCATGGACCTCAGCGCCCAGCCC
ATTACCCAGGAGGAGATGAAGATGATCGAGGCCAAGAGGCTCCGAGACCGACAGCGCCGAGACCGCGATGGCCGC
TCCGCCGCCGGCCGCGATGTCAAGGGCGGCGACGGCAAGGCCGATGGCAAGGACAGGAACAAGTCGAAGCGGCCG
AGTCGTCGACTGGACATTATCGACCAGCTGGACGCGACGAGCATATACGGCACCGGGCTCTTCCACCACGACGGC
CCTTTTGACGCTCTCAACCCACACCGTAACCGGCATAATAGCCGACGAGCCCCCATGCAGGCCTTCCCCAAAGAC
TCTCTCAACAACTCGATCGGCGGGGCCGGGCCCCTCAACCGCAACCCCGATCACGCCGTCTTCATGGGCAACGGG
ACGGACGAGGCGTTCCGCGACTACGCCGGCGGCATCAAGAACAAGAACGGATACAGCTACCCGGGCTCGTCGAGC
GGCGAGGCGGCCATCTTCGACCCGGTGGCGCGCGGGGCGGTAGTCCACGGCGACGAGAGCCATGGGCTGGGGACG
TCGACGTTCCTTGAAGGCACGCCGGCGGCTCGGACGGCGATTGCGCGGCGCGAGGCGGAGCACGCGCAGGATGCG
GTCGAGGGCGGGCTGCAGCGCAAGAAGTCGCTGGCGCAGCGGATCCGGCACATCAACAAGGGTCCGCGCGACTTT
ACGCCGTCGGGACGTATGACGAACCCGGAGGCGACGACGACGTTGATGCGGCGGTCGACGGACGGGGCGGCTTCG
GCTGGGGTCGGAGGATCGGACGCGAACCCCTTCTTCGCCGAGTTTGGCGAGGAGACGCTGAGCGTCAAGCCGCGC
GACACCACGGGCAGCCCTCCGGGGTCGAGCCCGACGGACGAGGGGGGAAAGCCGTCGGGACTTCTGGGGCGGATG
AAGAGCCTCAAGGGGGGGAAGAAGACGCGGACATCGGAGCAGGGCATGGGGGTTGCGCTGTGA
Transcript >Ophun1|1571
ATGACGAAGCCGCCCAGAGTCGAGGGCAAGCCGCTGCCGCCCAAGTCGACGTCGCCGTCCAAGGGTAGTCATCGC
CCCACGCGGTCGCAGGAGGAGGCACAAAAGGCCCGAAAGCCGCCTGGTGCCGGCCCGAGGCCCGGCCCGTCTGGC
TCGCCCCAGCGCAAACCGCTTCCGAGGCCGCGGCGCAACTCGGAGTCGTCGGTCATGGACCTCAGCGCCCAGCCC
ATTACCCAGGAGGAGATGAAGATGATCGAGGCCAAGAGGCTCCGAGACCGACAGCGCCGAGACCGCGATGGCCGC
TCCGCCGCCGGCCGCGATGTCAAGGGCGGCGACGGCAAGGCCGATGGCAAGGACAGGAACAAGTCGAAGCGGCCG
AGTCGTCGACTGGACATTATCGACCAGCTGGACGCGACGAGCATATACGGCACCGGGCTCTTCCACCACGACGGC
CCTTTTGACGCTCTCAACCCACACCGTAACCGGCATAATAGCCGACGAGCCCCCATGCAGGCCTTCCCCAAAGAC
TCTCTCAACAACTCGATCGGCGGGGCCGGGCCCCTCAACCGCAACCCCGATCACGCCGTCTTCATGGGCAACGGG
ACGGACGAGGCGTTCCGCGACTACGCCGGCGGCATCAAGAACAAGAACGGATACAGCTACCCGGGCTCGTCGAGC
GGCGAGGCGGCCATCTTCGACCCGGTGGCGCGCGGGGCGGTAGTCCACGGCGACGAGAGCCATGGGCTGGGGACG
TCGACGTTCCTTGAAGGCACGCCGGCGGCTCGGACGGCGATTGCGCGGCGCGAGGCGGAGCACGCGCAGGATGCG
GTCGAGGGCGGGCTGCAGCGCAAGAAGTCGCTGGCGCAGCGGATCCGGCACATCAACAAGGGTCCGCGCGACTTT
ACGCCGTCGGGACGTATGACGAACCCGGAGGCGACGACGACGTTGATGCGGCGGTCGACGGACGGGGCGGCTTCG
GCTGGGGTCGGAGGATCGGACGCGAACCCCTTCTTCGCCGAGTTTGGCGAGGAGACGCTGAGCGTCAAGCCGCGC
GACACCACGGGCAGCCCTCCGGGGTCGAGCCCGACGGACGAGGGGGGAAAGCCGTCGGGACTTCTGGGGCGGATG
AAGAGCCTCAAGGGGGGGAAGAAGACGCGGACATCGGAGCAGGGCATGGGGGTTGCGCTGTGA
Gene >Ophun1|1571
ATGACGAAGCCGCCCAGAGTCGAGGGCAAGCCGCTGCCGCCCAAGTCGACGTCGCCGTCCAAGGGTAGTCATCGC
CCCACGCGGTCGCAGGAGGAGGCACAAAAGGCCCGAAAGCCGCCTGGTGCCGGCCCGAGGCCCGGCCCGTCTGGC
TCGCCCCAGCGCAAACCGCTTCCGAGGCCGCGGCGCAACTCGGAGTCGTCGGTCATGGACCTCAGCGCCCAGCCC
ATTACCCAGGAGGAGATGAAGATGATCGAGGCCAAGAGGCTCCGAGACCGACAGCGCCGAGACCGCGATGGCCGC
TCCGCCGCCGGCCGCGATGTCAAGGGCGGCGACGGCAAGGCCGATGGCAAGGACAGGAACAAGTCGAAGCGGCCG
AGTCGTCGACTGGACATTATCGACCAGCTGGACGCGACGAGCATATACGGCACCGGGCGTAAGTCTTTTTCTCTC
TGCTTCTCTCGGGTTATATCTGACGAGCACGTTGATTGTAGTCTTCCACCACGACGGCCCTTTTGACGCTCTCAA
CCCACACCGTAACCGGCATAATAGCCGACGAGCCCCCATGCAGGCCTTCCCCAAAGACTCTCTCAACAACTCGAT
CGGCGGGGCCGGGCCCCTCAACCGCAACCCCGATCACGCCGTCTTCATGGGCAACGGGACGGACGAGGCGTTCCG
CGACTACGCCGGCGGCATCAAGAACAAGAACGGATACAGCTACCCGGGCTCGTCGAGCGGCGAGGCGGCCATCTT
CGACCCGGTGGCGCGCGGGGCGGTAGTCCACGGCGACGAGAGCCATGGGCTGGGGACGTCGACGTTCCTTGAAGG
CACGCCGGCGGCTCGGACGGCGATTGCGCGGCGCGAGGCGGAGCACGCGCAGGATGCGGTCGAGGGCGGGCTGCA
GCGCAAGAAGTCGCTGGCGCAGCGGATCCGGCACATCAACAAGGGTCCGCGCGACTTTACGCCGTCGGGACGTAT
GACGAACCCGGAGGCGACGACGACGTTGATGCGGCGGTCGACGGACGGGGCGGCTTCGGCTGGGGTCGGAGGATC
GGACGCGAACCCCTTCTTCGCCGAGTTTGGCGAGGAGACGCTGAGCGTCAAGCCGCGCGACACCACGGGCAGCCC
TCCGGGGTCGAGCCCGACGGACGAGGGGGGAAAGCCGTCGGGACTTCTGGGGCGGATGAAGAGCCTCAAGGGGGG
GAAGAAGACGCGGACATCGGAGCAGGGCATGGGGGTTGCGCTGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail