Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|1569
Gene name
LocationContig_166:26310..31010
Strand+
Gene length (bp)4700
Transcript length (bp)3993
Coding sequence length (bp)3993
Protein length (aa) 1331

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00328 His_Phos_2 Histidine phosphatase superfamily (branch 2) 5.6E-87 775 1320
PF18086 PPIP5K2_N Diphosphoinositol pentakisphosphate kinase 2 N-terminal domain 4.1E-35 294 381
PF08443 RimK RimK-like ATP-grasp domain 7.2E-06 517 607

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O74429|VIP1_SCHPO Inositol hexakisphosphate and diphosphoinositol-pentakisphosphate kinase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=asp1 PE=1 SV=1 288 639 8.0E-145
sp|Q06685|VIP1_YEAST Inositol hexakisphosphate and diphosphoinositol-pentakisphosphate kinase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VIP1 PE=1 SV=1 292 633 8.0E-132
sp|Q06685|VIP1_YEAST Inositol hexakisphosphate and diphosphoinositol-pentakisphosphate kinase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VIP1 PE=1 SV=1 771 1320 3.0E-100
sp|O74429|VIP1_SCHPO Inositol hexakisphosphate and diphosphoinositol-pentakisphosphate kinase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=asp1 PE=1 SV=1 930 1318 7.0E-91
sp|O43314|VIP2_HUMAN Inositol hexakisphosphate and diphosphoinositol-pentakisphosphate kinase 2 OS=Homo sapiens GN=PPIP5K2 PE=1 SV=3 293 632 1.0E-90
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O74429|VIP1_SCHPO Inositol hexakisphosphate and diphosphoinositol-pentakisphosphate kinase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=asp1 PE=1 SV=1 288 639 8.0E-145
sp|Q06685|VIP1_YEAST Inositol hexakisphosphate and diphosphoinositol-pentakisphosphate kinase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VIP1 PE=1 SV=1 292 633 8.0E-132
sp|Q06685|VIP1_YEAST Inositol hexakisphosphate and diphosphoinositol-pentakisphosphate kinase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VIP1 PE=1 SV=1 771 1320 3.0E-100
sp|O74429|VIP1_SCHPO Inositol hexakisphosphate and diphosphoinositol-pentakisphosphate kinase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=asp1 PE=1 SV=1 930 1318 7.0E-91
sp|O43314|VIP2_HUMAN Inositol hexakisphosphate and diphosphoinositol-pentakisphosphate kinase 2 OS=Homo sapiens GN=PPIP5K2 PE=1 SV=3 293 632 1.0E-90
sp|Q5REW0|VIP2_PONAB Inositol hexakisphosphate and diphosphoinositol-pentakisphosphate kinase 2 OS=Pongo abelii GN=PPIP5K2 PE=2 SV=1 293 632 2.0E-90
sp|Q6ZQB6|VIP2_MOUSE Inositol hexakisphosphate and diphosphoinositol-pentakisphosphate kinase 2 OS=Mus musculus GN=Ppip5k2 PE=1 SV=3 293 632 3.0E-90
sp|Q5XHF8|VIP2_XENLA Inositol hexakisphosphate and diphosphoinositol-pentakisphosphate kinase 2 OS=Xenopus laevis GN=ppip5k2 PE=2 SV=1 293 632 8.0E-90
sp|Q6PFW1|VIP1_HUMAN Inositol hexakisphosphate and diphosphoinositol-pentakisphosphate kinase 1 OS=Homo sapiens GN=PPIP5K1 PE=1 SV=1 293 632 2.0E-89
sp|A2ARP1|VIP1_MOUSE Inositol hexakisphosphate and diphosphoinositol-pentakisphosphate kinase 1 OS=Mus musculus GN=Ppip5k1 PE=1 SV=1 293 632 2.0E-89
sp|P0C644|VIP1_RAT Inositol hexakisphosphate and diphosphoinositol-pentakisphosphate kinase 1 OS=Rattus norvegicus GN=Ppip5k1 PE=1 SV=1 293 632 3.0E-89
sp|A7Z050|VIP1_BOVIN Inositol hexakisphosphate and diphosphoinositol-pentakisphosphate kinase 1 OS=Bos taurus GN=PPIP5K1 PE=2 SV=1 293 632 3.0E-89
sp|Q5RDF1|VIP1_PONAB Inositol hexakisphosphate and diphosphoinositol-pentakisphosphate kinase 1 OS=Pongo abelii GN=PPIP5K1 PE=2 SV=1 293 632 2.0E-88
sp|Q9VR59|VIP1_DROME Inositol hexakisphosphate and diphosphoinositol-pentakisphosphate kinase OS=Drosophila melanogaster GN=l(1)G0196 PE=1 SV=2 293 632 7.0E-87
sp|P91309|VIP1_CAEEL Inositol hexakisphosphate and diphosphoinositol-pentakisphosphate kinase OS=Caenorhabditis elegans GN=F46F11.1 PE=3 SV=3 285 651 3.0E-81
sp|B3PCD4|RIMK_CELJU Probable alpha-L-glutamate ligase OS=Cellvibrio japonicus (strain Ueda107) GN=rimK PE=3 SV=1 504 606 5.0E-06
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup1673
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3652
Ophiocordyceps australis map64 (Brazil) OphauB2|1251
Ophiocordyceps camponoti-floridani Ophcf2|02737
Ophiocordyceps camponoti-rufipedis Ophun1|1569 (this protein)
Ophiocordyceps kimflemingae Ophio5|8399
Ophiocordyceps subramaniannii Hirsu2|1427

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|1569
MDEKFGRELGVCISSAEATAHRPLAKPVKRIAPMMDVATPDDGCHDDGSTDAPPPPPRQHSSRARSISSSSAAGS
VASRKSRYAEPGLSHVNAERTSVASATPHHSPLRASRSRRPNSSVSDDWSEEAVSASPDIDTPRPRPLSTVDLAS
LPEPALAARPSFSEIQSRRLSANSLASARSLVVSSPQADIGNPPRSVPSYIMAAGKSPTSSSADPGAPANSPVQG
QHHLVQPLDLMRRNQRNDAAIRPQPDRSRSRAKRRFSGSTAASSHSPSSDRGPQYRDKEEAKPAPWGVIGICALD
VKARSKPSRNILNRLIANREFDVVVFGDKVILDEAVENWPMCDYLISFYSDGFPLDKAIAYVKARKPFSVNDVPM
QQVLWDRRVCLRLLDKIQVRTPKRLEVSRDGGPAILTPEMSKHIKDISGICLTPTEAQGVPVPRHVELIDDGDVL
SVDGALLRKPFVEKPTSGEDHNIIIYFPKSSGGGARKLFRKIGNKSSDYLPDLNVPRAISEPGSSYIYESFMKVD
NAEDVKAYTVGPHYCHAETRKSPVVDGIVRRNTHGKELRYVTALSAEEKDVASKISTTFGQRVCGFDLLRASGKS
YVIDVNGWSFVKDNDDYYDHCANILKDMFVKERLRRGGVTPPMPSPAFSDIDPLARAAQAMKDRDQQQPPGTSSG
SQSASRAASGTGVFSQGSQHTDSTRAASEAASNKAESALNSSTQSTETSPVLPPPPPEVMSAGSVSASSSIRTAA
AHASNAQPPEEEAMAAPPPPKHSWKLKGMVCVIRHADRTPKQKYKFTFHTEPFIALLKGHQEEVLLIGEAALASV
IQAVDVALEEGIEDGVKLKALRNVLVKKGSWAGTKVQIKPMFRNKPEARPAPDTSEAGDNVRAANAEGVDEGGEG
DGRRKPPKRQDSLSGVTMSKFTAAEERLVLDKLQLIVKWGGEPTHSARYQSQELGENMRNDLMLLNRDVLDEVHV
FSSSERRVTASAQIWAASFLGRKDIPEDFITIRKNLLDDSNAAKDETDKVKKKLKGLLRKGNERPAQFAWPENMP
EPSEVQTRVVQLMNFHRRVMHYNYGKIRSGNGTSLSSVSNASTEKLTAEGSNTSLSSAVSHANGINGIQSRWCSG
EDADLFRERWEKLFAEFCDGDKVDPSKISELYDTMKFDALHNRQFLEWVFTPPKAMLDEEYSLKSTTADDNRAVE
EQQKDDKGDYGLDRTDPSSRGATVRKLFRRRSFLNNLRHQHEDTAAEQYFRLYKGTAHKTAAKVDPRNEPLQELY
RLAKVLFDFICPQEYGISDSEKLEIGLLTSLPLLKEIVQDLEEMQAFALSCTSLR*
Coding >Ophun1|1569
ATGGATGAAAAATTTGGGCGCGAGCTCGGTGTATGTATCAGTAGTGCCGAGGCTACGGCCCACAGGCCACTGGCC
AAACCGGTCAAGCGCATTGCTCCCATGATGGACGTCGCCACTCCCGACGACGGCTGCCACGATGACGGCTCCACC
GACGCTCCTCCTCCTCCTCCCCGTCAGCACTCGTCCCGCGCCCGCAGCATCTCTTCCTCGTCGGCCGCCGGCTCT
GTTGCCAGTAGGAAGAGTCGCTACGCTGAACCGGGCCTCTCCCACGTCAACGCTGAACGCACCAGCGTCGCCTCC
GCAACCCCCCACCACTCCCCACTGAGGGCCTCGAGGTCTCGCCGCCCCAATAGCAGCGTCTCGGACGACTGGAGC
GAGGAAGCCGTGTCCGCTAGCCCTGACATCGACACGCCTAGGCCCCGTCCGTTGTCCACCGTGGACCTCGCCTCC
CTCCCCGAGCCTGCTCTGGCAGCCCGTCCGTCCTTTTCCGAGATTCAGTCAAGGCGTCTGTCGGCCAACTCGCTT
GCTTCGGCCCGCAGCCTTGTCGTCTCGTCTCCGCAGGCCGATATCGGAAATCCGCCGCGTTCCGTCCCGAGCTAC
ATCATGGCCGCCGGCAAGAGCCCGACATCTTCCTCTGCCGACCCGGGCGCACCCGCCAATTCGCCCGTCCAGGGG
CAGCACCATCTCGTCCAGCCCCTTGACCTCATGCGACGCAACCAGCGTAACGACGCCGCCATACGCCCCCAGCCT
GACCGCTCCCGCAGTAGGGCGAAGAGGAGGTTCAGTGGTAGCACCGCCGCCAGCAGCCACAGCCCAAGCAGTGAT
CGTGGTCCCCAATACCGCGACAAGGAAGAAGCGAAGCCGGCTCCATGGGGGGTCATTGGTATTTGCGCCCTTGAC
GTCAAGGCCAGAAGTAAGCCGAGCAGAAACATACTCAACCGTCTCATCGCGAATCGTGAATTCGACGTGGTTGTC
TTTGGCGACAAGGTCATTCTTGATGAAGCGGTCGAGAACTGGCCAATGTGTGACTATCTCATATCATTTTACTCC
GACGGCTTTCCTCTCGACAAGGCCATCGCCTACGTCAAGGCCCGAAAGCCATTCTCTGTCAACGATGTTCCCATG
CAGCAGGTTCTTTGGGACAGGCGAGTTTGTCTTCGGCTTCTTGATAAGATCCAGGTTCGGACCCCCAAGCGCCTC
GAGGTGAGCCGGGATGGCGGCCCCGCGATTTTGACCCCCGAAATGTCCAAGCACATCAAGGACATCTCTGGGATT
TGCCTAACTCCCACGGAGGCTCAAGGGGTGCCAGTGCCGCGGCATGTCGAGCTCATCGACGATGGCGATGTGTTG
AGCGTGGATGGTGCCCTGCTCCGGAAGCCATTCGTGGAGAAACCTACCAGTGGCGAAGACCACAACATCATCATC
TACTTTCCAAAGAGCTCCGGCGGCGGCGCGAGGAAGCTGTTCCGGAAGATTGGCAACAAGAGCTCCGACTATCTG
CCCGACCTCAACGTACCCAGAGCCATCTCGGAACCCGGCAGCAGCTACATCTATGAAAGCTTTATGAAAGTCGAT
AATGCGGAAGACGTCAAGGCCTACACCGTTGGGCCTCATTACTGCCACGCAGAGACACGCAAGTCCCCCGTCGTC
GATGGTATAGTCAGGCGCAACACGCACGGGAAAGAGCTGCGCTACGTAACTGCTTTGAGCGCTGAGGAAAAGGAC
GTTGCCAGCAAGATATCGACCACCTTTGGCCAACGCGTCTGCGGCTTCGACTTGCTGCGAGCGTCGGGCAAGAGC
TATGTCATTGATGTCAACGGATGGAGCTTCGTCAAGGACAACGACGACTACTACGATCATTGCGCGAATATTCTC
AAAGATATGTTTGTTAAGGAAAGGCTGCGTAGGGGAGGCGTCACTCCGCCGATGCCGTCACCAGCCTTTTCGGAC
ATTGATCCGCTGGCTCGAGCCGCACAGGCCATGAAGGATCGCGACCAACAGCAGCCACCCGGAACCAGCAGCGGC
TCTCAATCGGCGTCGAGAGCAGCTAGCGGAACCGGCGTGTTTTCCCAGGGGTCGCAGCATACTGATTCGACCCGG
GCTGCGAGCGAGGCAGCGTCTAACAAGGCCGAGAGCGCCCTCAACTCGTCGACGCAGAGCACAGAAACGAGCCCC
GTGCTGCCACCGCCGCCCCCGGAAGTGATGTCGGCCGGGTCCGTCTCGGCCTCTTCCTCCATCAGGACTGCGGCC
GCTCACGCGTCAAACGCCCAGCCACCGGAAGAAGAGGCTATGGCTGCTCCTCCGCCGCCGAAGCACTCTTGGAAG
CTCAAAGGCATGGTCTGCGTCATACGTCATGCCGATCGCACGCCCAAGCAAAAGTACAAGTTTACGTTTCACACC
GAGCCCTTCATCGCCCTTCTCAAGGGACATCAAGAAGAAGTGCTGCTCATAGGGGAAGCGGCGCTGGCGAGCGTC
ATCCAAGCCGTCGACGTGGCGCTCGAAGAGGGCATCGAGGACGGAGTCAAACTCAAGGCACTGCGTAACGTGCTC
GTCAAGAAGGGCAGCTGGGCGGGGACCAAGGTTCAGATCAAGCCCATGTTTCGCAACAAACCAGAGGCTCGGCCC
GCACCGGATACTTCTGAGGCGGGTGACAATGTCAGAGCCGCGAATGCCGAGGGCGTGGACGAGGGCGGAGAGGGC
GATGGGCGACGCAAACCCCCTAAGAGGCAGGATTCCTTGTCTGGCGTCACCATGTCCAAGTTCACAGCGGCCGAG
GAACGGTTGGTTCTCGACAAGCTTCAGCTCATCGTCAAATGGGGCGGCGAACCGACGCACTCGGCGCGATATCAG
TCGCAGGAACTCGGTGAGAACATGCGCAACGATCTCATGTTGCTCAATAGGGACGTGCTCGACGAGGTACACGTC
TTCAGCAGCTCGGAGCGGCGCGTCACTGCCAGCGCTCAGATCTGGGCCGCCTCGTTTCTGGGTAGAAAGGACATA
CCCGAGGACTTTATCACGATCCGCAAGAACCTCCTGGACGACTCCAACGCGGCCAAGGACGAGACGGACAAGGTC
AAGAAGAAGCTCAAAGGCCTCCTCCGCAAGGGAAATGAGCGTCCCGCCCAGTTCGCTTGGCCGGAGAACATGCCG
GAGCCGTCCGAGGTGCAGACGAGGGTGGTGCAGCTCATGAACTTTCACCGACGCGTCATGCACTACAACTATGGC
AAGATTCGCAGCGGCAACGGCACCTCGCTGAGCTCCGTCTCCAACGCCAGCACGGAGAAGCTGACGGCCGAGGGC
TCCAACACATCGCTCTCATCGGCCGTATCTCACGCCAACGGCATCAACGGCATCCAGTCGCGATGGTGCAGCGGC
GAGGACGCCGACCTCTTCCGCGAGCGATGGGAGAAGCTGTTTGCCGAGTTCTGCGATGGCGACAAGGTGGATCCC
AGCAAGATCTCGGAGCTGTACGACACGATGAAGTTTGACGCCCTTCACAACCGGCAGTTCCTCGAATGGGTCTTT
ACGCCGCCCAAGGCCATGCTGGACGAGGAGTACTCGCTCAAGTCGACGACGGCCGACGACAACCGGGCGGTCGAG
GAGCAGCAAAAGGACGACAAGGGGGACTATGGCCTGGACAGGACGGATCCAAGCAGCCGGGGGGCAACGGTCCGG
AAGCTCTTCCGCAGACGCTCTTTTCTCAACAACCTGAGACACCAGCACGAAGACACGGCGGCCGAGCAGTACTTT
CGCCTCTACAAGGGCACGGCGCACAAGACGGCGGCCAAGGTGGACCCGCGGAACGAGCCGCTGCAGGAGCTGTAC
CGGCTGGCCAAGGTGCTGTTTGACTTTATCTGCCCGCAGGAATACGGCATCTCGGACAGCGAGAAGCTCGAGATT
GGGCTCCTGACGTCTCTGCCGCTGCTCAAGGAGATTGTGCAGGACCTGGAGGAGATGCAGGCATTTGCTTTGAGC
TGTACGAGTCTGAGGTGA
Transcript >Ophun1|1569
ATGGATGAAAAATTTGGGCGCGAGCTCGGTGTATGTATCAGTAGTGCCGAGGCTACGGCCCACAGGCCACTGGCC
AAACCGGTCAAGCGCATTGCTCCCATGATGGACGTCGCCACTCCCGACGACGGCTGCCACGATGACGGCTCCACC
GACGCTCCTCCTCCTCCTCCCCGTCAGCACTCGTCCCGCGCCCGCAGCATCTCTTCCTCGTCGGCCGCCGGCTCT
GTTGCCAGTAGGAAGAGTCGCTACGCTGAACCGGGCCTCTCCCACGTCAACGCTGAACGCACCAGCGTCGCCTCC
GCAACCCCCCACCACTCCCCACTGAGGGCCTCGAGGTCTCGCCGCCCCAATAGCAGCGTCTCGGACGACTGGAGC
GAGGAAGCCGTGTCCGCTAGCCCTGACATCGACACGCCTAGGCCCCGTCCGTTGTCCACCGTGGACCTCGCCTCC
CTCCCCGAGCCTGCTCTGGCAGCCCGTCCGTCCTTTTCCGAGATTCAGTCAAGGCGTCTGTCGGCCAACTCGCTT
GCTTCGGCCCGCAGCCTTGTCGTCTCGTCTCCGCAGGCCGATATCGGAAATCCGCCGCGTTCCGTCCCGAGCTAC
ATCATGGCCGCCGGCAAGAGCCCGACATCTTCCTCTGCCGACCCGGGCGCACCCGCCAATTCGCCCGTCCAGGGG
CAGCACCATCTCGTCCAGCCCCTTGACCTCATGCGACGCAACCAGCGTAACGACGCCGCCATACGCCCCCAGCCT
GACCGCTCCCGCAGTAGGGCGAAGAGGAGGTTCAGTGGTAGCACCGCCGCCAGCAGCCACAGCCCAAGCAGTGAT
CGTGGTCCCCAATACCGCGACAAGGAAGAAGCGAAGCCGGCTCCATGGGGGGTCATTGGTATTTGCGCCCTTGAC
GTCAAGGCCAGAAGTAAGCCGAGCAGAAACATACTCAACCGTCTCATCGCGAATCGTGAATTCGACGTGGTTGTC
TTTGGCGACAAGGTCATTCTTGATGAAGCGGTCGAGAACTGGCCAATGTGTGACTATCTCATATCATTTTACTCC
GACGGCTTTCCTCTCGACAAGGCCATCGCCTACGTCAAGGCCCGAAAGCCATTCTCTGTCAACGATGTTCCCATG
CAGCAGGTTCTTTGGGACAGGCGAGTTTGTCTTCGGCTTCTTGATAAGATCCAGGTTCGGACCCCCAAGCGCCTC
GAGGTGAGCCGGGATGGCGGCCCCGCGATTTTGACCCCCGAAATGTCCAAGCACATCAAGGACATCTCTGGGATT
TGCCTAACTCCCACGGAGGCTCAAGGGGTGCCAGTGCCGCGGCATGTCGAGCTCATCGACGATGGCGATGTGTTG
AGCGTGGATGGTGCCCTGCTCCGGAAGCCATTCGTGGAGAAACCTACCAGTGGCGAAGACCACAACATCATCATC
TACTTTCCAAAGAGCTCCGGCGGCGGCGCGAGGAAGCTGTTCCGGAAGATTGGCAACAAGAGCTCCGACTATCTG
CCCGACCTCAACGTACCCAGAGCCATCTCGGAACCCGGCAGCAGCTACATCTATGAAAGCTTTATGAAAGTCGAT
AATGCGGAAGACGTCAAGGCCTACACCGTTGGGCCTCATTACTGCCACGCAGAGACACGCAAGTCCCCCGTCGTC
GATGGTATAGTCAGGCGCAACACGCACGGGAAAGAGCTGCGCTACGTAACTGCTTTGAGCGCTGAGGAAAAGGAC
GTTGCCAGCAAGATATCGACCACCTTTGGCCAACGCGTCTGCGGCTTCGACTTGCTGCGAGCGTCGGGCAAGAGC
TATGTCATTGATGTCAACGGATGGAGCTTCGTCAAGGACAACGACGACTACTACGATCATTGCGCGAATATTCTC
AAAGATATGTTTGTTAAGGAAAGGCTGCGTAGGGGAGGCGTCACTCCGCCGATGCCGTCACCAGCCTTTTCGGAC
ATTGATCCGCTGGCTCGAGCCGCACAGGCCATGAAGGATCGCGACCAACAGCAGCCACCCGGAACCAGCAGCGGC
TCTCAATCGGCGTCGAGAGCAGCTAGCGGAACCGGCGTGTTTTCCCAGGGGTCGCAGCATACTGATTCGACCCGG
GCTGCGAGCGAGGCAGCGTCTAACAAGGCCGAGAGCGCCCTCAACTCGTCGACGCAGAGCACAGAAACGAGCCCC
GTGCTGCCACCGCCGCCCCCGGAAGTGATGTCGGCCGGGTCCGTCTCGGCCTCTTCCTCCATCAGGACTGCGGCC
GCTCACGCGTCAAACGCCCAGCCACCGGAAGAAGAGGCTATGGCTGCTCCTCCGCCGCCGAAGCACTCTTGGAAG
CTCAAAGGCATGGTCTGCGTCATACGTCATGCCGATCGCACGCCCAAGCAAAAGTACAAGTTTACGTTTCACACC
GAGCCCTTCATCGCCCTTCTCAAGGGACATCAAGAAGAAGTGCTGCTCATAGGGGAAGCGGCGCTGGCGAGCGTC
ATCCAAGCCGTCGACGTGGCGCTCGAAGAGGGCATCGAGGACGGAGTCAAACTCAAGGCACTGCGTAACGTGCTC
GTCAAGAAGGGCAGCTGGGCGGGGACCAAGGTTCAGATCAAGCCCATGTTTCGCAACAAACCAGAGGCTCGGCCC
GCACCGGATACTTCTGAGGCGGGTGACAATGTCAGAGCCGCGAATGCCGAGGGCGTGGACGAGGGCGGAGAGGGC
GATGGGCGACGCAAACCCCCTAAGAGGCAGGATTCCTTGTCTGGCGTCACCATGTCCAAGTTCACAGCGGCCGAG
GAACGGTTGGTTCTCGACAAGCTTCAGCTCATCGTCAAATGGGGCGGCGAACCGACGCACTCGGCGCGATATCAG
TCGCAGGAACTCGGTGAGAACATGCGCAACGATCTCATGTTGCTCAATAGGGACGTGCTCGACGAGGTACACGTC
TTCAGCAGCTCGGAGCGGCGCGTCACTGCCAGCGCTCAGATCTGGGCCGCCTCGTTTCTGGGTAGAAAGGACATA
CCCGAGGACTTTATCACGATCCGCAAGAACCTCCTGGACGACTCCAACGCGGCCAAGGACGAGACGGACAAGGTC
AAGAAGAAGCTCAAAGGCCTCCTCCGCAAGGGAAATGAGCGTCCCGCCCAGTTCGCTTGGCCGGAGAACATGCCG
GAGCCGTCCGAGGTGCAGACGAGGGTGGTGCAGCTCATGAACTTTCACCGACGCGTCATGCACTACAACTATGGC
AAGATTCGCAGCGGCAACGGCACCTCGCTGAGCTCCGTCTCCAACGCCAGCACGGAGAAGCTGACGGCCGAGGGC
TCCAACACATCGCTCTCATCGGCCGTATCTCACGCCAACGGCATCAACGGCATCCAGTCGCGATGGTGCAGCGGC
GAGGACGCCGACCTCTTCCGCGAGCGATGGGAGAAGCTGTTTGCCGAGTTCTGCGATGGCGACAAGGTGGATCCC
AGCAAGATCTCGGAGCTGTACGACACGATGAAGTTTGACGCCCTTCACAACCGGCAGTTCCTCGAATGGGTCTTT
ACGCCGCCCAAGGCCATGCTGGACGAGGAGTACTCGCTCAAGTCGACGACGGCCGACGACAACCGGGCGGTCGAG
GAGCAGCAAAAGGACGACAAGGGGGACTATGGCCTGGACAGGACGGATCCAAGCAGCCGGGGGGCAACGGTCCGG
AAGCTCTTCCGCAGACGCTCTTTTCTCAACAACCTGAGACACCAGCACGAAGACACGGCGGCCGAGCAGTACTTT
CGCCTCTACAAGGGCACGGCGCACAAGACGGCGGCCAAGGTGGACCCGCGGAACGAGCCGCTGCAGGAGCTGTAC
CGGCTGGCCAAGGTGCTGTTTGACTTTATCTGCCCGCAGGAATACGGCATCTCGGACAGCGAGAAGCTCGAGATT
GGGCTCCTGACGTCTCTGCCGCTGCTCAAGGAGATTGTGCAGGACCTGGAGGAGATGCAGGCATTTGCTTTGAGC
TGTACGAGTCTGAGGTGA
Gene >Ophun1|1569
ATGGATGAAAAATTTGGGCGGTGAGGGGCAGATTGGTGGGTTTCTGCCGCAGCTTATCGATAGCGCGGCGGTTGA
GGATATCGGGTATTCAAAGGGCAGAGGCGGATCGGACGAATGCAACGTGAAGAGAGCACGGGATCACGTCAGAAC
TCGGATGCAGCGAGCTCGGTGTATGTATCAGTAGTGTGAGTCTATCGATGCGCAAAACCTGCCGAGACAAAGGTT
GAATCGTGGTCAAGGGTCATGGCTGGTGTTGTTTCTGAGGTACAAGGCTGGGCAGCACGCGGGACGCGACAAGAC
GCGTACCTCCCTCGGCGAGTCGGCCAGCAGACTTTTCAAATGCCTCGCCCTTGACCTTGACCTCCATCTTGACCT
CGACGCCAATCATCTGCGGGCGATGACGATCATCGTCGACAGCTCCGAGTCCTCCATTCTCTCCTTCTGCAGGCC
GAGGCTACGGCCCACAGGCCACTGGCCAAACCGGTCAAGCGCATTGCTCCCATGATGGACGTCGCCACTCCCGAC
GACGGCTGCCACGATGACGGCTCCACCGACGCTCCTCCTCCTCCTCCCCGTCAGCACTCGTCCCGCGCCCGCAGC
ATCTCTTCCTCGTCGGCCGCCGGCTCTGTTGCCAGTAGGAAGAGTCGCTACGCTGAACCGGGCCTCTCCCACGTC
AACGCTGAACGCACCAGCGTCGCCTCCGCAACCCCCCACCACTCCCCACTGAGGGCCTCGAGGTCTCGCCGCCCC
AATAGCAGCGTCTCGGACGACTGGAGCGAGGAAGCCGTGTCCGCTAGCCCTGACATCGACACGCCTAGGCCCCGT
CCGTTGTCCACCGTGGACCTCGCCTCCCTCCCCGAGCCTGCTCTGGCAGCCCGTCCGTCCTTTTCCGAGATTCAG
TCAAGGCGTCTGTCGGCCAACTCGCTTGCTTCGGCCCGCAGCCTTGTCGTCTCGTCTCCGCAGGCCGATATCGGA
AATCCGCCGCGTTCCGTCCCGAGCTACATCATGGCCGCCGGCAAGAGCCCGACATCTTCCTCTGCCGACCCGGGC
GCACCCGCCAATTCGCCCGTCCAGGGGCAGCACCATCTCGTCCAGCCCCTTGACCTCATGCGACGCAACCAGCGT
AACGACGCCGCCATACGCCCCCAGCCTGACCGCTCCCGCAGTAGGGCGAAGAGGAGGTTCAGTGGTAGCACCGCC
GCCAGCAGCCACAGCCCAAGCAGTGATCGTGGTCCCCAATACCGCGACAAGGAAGAAGGTGAGCCCTGTTTGACA
TGCGAATCGCCGGGCTTGCGTGGCAGTCCTGATCCCCTTGTAGCGAAGCCGGCTCCATGGGGGGTCATTGGTATT
TGCGCCCTTGACGTCAAGGCCAGAAGTAAGCCGAGCAGAAACATACTCAACCGTCTCATCGCGAATCGTGAATTC
GACGTGGTTGTCTTTGGCGACAAGGTCATTCTTGATGAAGGTTCGTCAACTTCACACCGGTAATCCTTCCAACCA
TGCTAATATTCATACTCAGCGGTCGAGAACTGGCCAATGTGGTGAGTTGCCAGCTCGGACCTTGGGAAAAAGATT
CTTCTCGCTAATGCCTCATAGTGACTATCTCATATCATTTTACTCCGACGGCTTTCCTCTCGACAAGGCCATCGC
CTACGTCAAGGCCCGAAAGCCATTCTCTGTCAACGATGTTCCCATGCAGCAGGTTCTTTGGGACAGGCGAGTTTG
TCTTCGGCTTCTTGATAAGATCCAGGTTCGGACCCCCAAGCGCCTCGAGGTGAGCCGGGATGGCGGCCCCGCGAT
TTTGACCCCCGAAATGTCCAAGCACATCAAGGACATCTCTGGGATTTGCCTAACTCCCACGGAGGCTCAAGGGGT
GCCAGTGCCGCGGCATGTCGAGCTCATCGACGATGGCGATGTGTTGAGCGTGGATGGTGCCCTGCTCCGGAAGCC
ATTCGTGGAGAAACCTACCAGTGGCGAAGACCACAACATCATCATCTACTTTCCAAAGAGCTCCGGCGGCGGCGC
GAGGAAGCTGTTCCGGAAGATTGGCAACAAGAGCTCCGACTATCTGCCCGACCTCAACGTACCCAGAGCCATCTC
GGAACCCGGCAGCAGCTACATCTATGAAAGCTTTATGAAAGTCGATAATGCGGAAGACGTCAAGGCCTACACCGT
TGGGCCTCATTACTGCCACGCAGAGACACGCAAGTCCCCCGTCGTCGATGGTATAGTCAGGCGCAACACGCACGG
GAAAGAGCTGCGCTACGTAACTGCTTTGAGCGCTGAGGAAAAGGACGTTGCCAGCAAGATATCGACCACCTTTGG
CCAACGCGTCTGCGGCTTCGACTTGCTGCGAGCGTCGGGCAAGAGCTATGTCATTGATGTCAACGGATGGAGCTT
CGTCAAGGACAACGACGACTACTACGATCATTGCGCGAATATTCTCAAAGATATGTTTGTTAAGGAAAGGCTGCG
TAGGGGAGGCGTCACTCCGCCGATGCCGTCACCAGCCTTTTCGGACATTGATCCGCTGGCTCGAGCCGCACAGGC
CATGAAGGATCGCGACCAACAGCAGCCACCCGGAACCAGCAGCGGCTCTCAATCGGCGTCGAGAGCAGCTAGCGG
AACCGGCGTGTTTTCCCAGGGGTCGCAGCATACTGATTCGACCCGGGCTGCGAGCGAGGCAGCGTCTAACAAGGC
CGAGAGCGCCCTCAACTCGTCGACGCAGAGCACAGAAACGAGCCCCGTGCTGCCACCGCCGCCCCCGGAAGTGAT
GTCGGCCGGGTCCGTCTCGGCCTCTTCCTCCATCAGGACTGCGGCCGCTCACGCGTCAAACGCCCAGCCACCGGA
AGAAGAGGCTATGGCTGCTCCTCCGCCGCCGAAGCACTCTTGGAAGCTCAAAGGCATGGTCTGCGTCATACGTCA
TGCCGATCGCACGCCCAAGCAAAAGTACAAGTTTACGTTTCACACCGAGCCCTTCATCGCCCTTCTCAAGGGACA
TCAAGAAGAAGTGCTGCTCATAGGGGAAGCGGCGCTGGCGAGCGTCATCCAAGCCGTCGACGTGGCGCTCGAAGA
GGGCATCGAGGACGGAGTCAAACTCAAGGCACTGCGTAACGTGCTCGTCAAGAAGGGCAGCTGGGCGGGGACCAA
GGTTCAGATCAAGCCCATGTTTCGCAACAAACCAGAGGCTCGGCCCGCACCGGATACTTCTGAGGCGGGTGACAA
TGTCAGAGCCGCGAATGCCGAGGGCGTGGACGAGGGCGGAGAGGGCGATGGGCGACGCAAACCCCCTAAGAGGCA
GGATTCCTTGTCTGGCGTCACCATGTCCAAGTTCACAGCGGCCGAGGAACGGTTGGTTCTCGACAAGCTTCAGCT
CATCGTCAAATGGGGCGGCGAACCGACGCACTCGGCGCGATATCAGTCGCAGGAACTCGGTGAGAACATGCGCAA
CGATCTCATGTTGCTCAATAGGGACGTGCTCGACGAGGTACACGTCTTCAGCAGCTCGGAGCGGCGCGTCACTGC
CAGCGCTCAGATCTGGGCCGCCTCGTTTCTGGGTAGAAAGGACATACCCGAGGACTTTATCACGATCCGCAAGAA
CCTCCTGGACGACTCCAACGCGGCCAAGGACGAGACGGACAAGGTCAAGAAGAAGCTCAAAGGCCTCCTCCGCAA
GGGAAATGAGCGTCCCGCCCAGTTCGCTTGGCCGGAGAACATGCCGGAGCCGTCCGAGGTGCAGACGAGGGTGGT
GCAGCTCATGAACTTTCACCGACGCGTCATGCACTACAACTATGGCAAGATTCGCAGCGGCAACGGCACCTCGCT
GAGCTCCGTCTCCAACGCCAGCACGGAGAAGCTGACGGCCGAGGGCTCCAACACATCGCTCTCATCGGCCGTATC
TCACGCCAACGGCATCAACGGCATCCAGTCGCGATGGTGCAGCGGCGAGGACGCCGACCTCTTCCGCGAGCGATG
GGAGAAGCTGTTTGCCGAGTTCTGCGATGGCGACAAGGTGGATCCCAGCAAGATCTCGGAGCTGTACGACACGAT
GAAGTTTGACGCCCTTCACAACCGGCAGTTCCTCGAATGGGTCTTTACGCCGCCCAAGGCCATGCTGGACGAGGA
GTACTCGCTCAAGTCGACGACGGCCGACGACAACCGGGCGGTCGAGGAGCAGCAAAAGGACGACAAGGGGGACTA
TGGCCTGGACAGGACGGATCCAAGCAGCCGGGGGGCAACGGTCCGGAAGCTCTTCCGCAGACGCTCTTTTCTCAA
CAACCTGAGACACCAGCACGAAGACACGGCGGCCGAGCAGTACTTTCGCCTCTACAAGGGCACGGCGCACAAGAC
GGCGGCCAAGGTGGACCCGCGGAACGAGCCGCTGCAGGAGCTGTACCGGCTGGCCAAGGTGCTGTTTGACTTTAT
CTGCCCGCAGGAATACGGCATCTCGGACAGCGAGAAGCTCGAGATTGGGCTCCTGACGTCTCTGCCGCTGCTCAA
GGAGATTGTGCAGGACCTGGAGGAGATGCAGGCGTCCAACGATGCCAAATCCTTCTTTTACTTTACCAAGGAATC
TCACATTTACACGCTGCTCAACTGCATCATCGAGGGCGGCATCGAGACCAAGATCAAGCGAAGCACGATTCCGGA
ACTCGATTACCTCTCGCAGATTTGCTTTGAGCTGTACGAGTCTGAGGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail