Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|1563
Gene name
LocationContig_166:5397..7215
Strand+
Gene length (bp)1818
Transcript length (bp)1818
Coding sequence length (bp)1818
Protein length (aa) 606

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01018 GTP1_OBG GTP1/OBG 2.4E-31 72 175
PF01018 GTP1_OBG GTP1/OBG 7.3E-07 295 350
PF01926 MMR_HSR1 50S ribosome-binding GTPase 1.9E-22 353 464

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P38860|MTG2_YEAST GTPase MTG2, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MTG2 PE=1 SV=2 70 481 8.0E-44
sp|Q9UT06|YLWB_SCHPO Uncharacterized GTP-binding protein P8A3.11c, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAP8A3.11c PE=3 SV=1 261 478 7.0E-39
sp|A8ZRY1|OBG_DESOH GTPase Obg OS=Desulfococcus oleovorans (strain DSM 6200 / Hxd3) GN=obg PE=3 SV=1 295 477 4.0E-36
sp|B2UQ30|OBG_AKKM8 GTPase Obg OS=Akkermansia muciniphila (strain ATCC BAA-835 / Muc) GN=obg PE=3 SV=2 296 595 4.0E-36
sp|C0QLE9|OBG_DESAH GTPase Obg OS=Desulfobacterium autotrophicum (strain ATCC 43914 / DSM 3382 / HRM2) GN=obg PE=3 SV=1 290 477 8.0E-36
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P38860|MTG2_YEAST GTPase MTG2, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MTG2 PE=1 SV=2 70 481 8.0E-44
sp|Q9UT06|YLWB_SCHPO Uncharacterized GTP-binding protein P8A3.11c, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAP8A3.11c PE=3 SV=1 261 478 7.0E-39
sp|A8ZRY1|OBG_DESOH GTPase Obg OS=Desulfococcus oleovorans (strain DSM 6200 / Hxd3) GN=obg PE=3 SV=1 295 477 4.0E-36
sp|B2UQ30|OBG_AKKM8 GTPase Obg OS=Akkermansia muciniphila (strain ATCC BAA-835 / Muc) GN=obg PE=3 SV=2 296 595 4.0E-36
sp|C0QLE9|OBG_DESAH GTPase Obg OS=Desulfobacterium autotrophicum (strain ATCC 43914 / DSM 3382 / HRM2) GN=obg PE=3 SV=1 290 477 8.0E-36
sp|B3CQ33|OBG_ORITI GTPase Obg OS=Orientia tsutsugamushi (strain Ikeda) GN=obg PE=3 SV=1 278 483 2.0E-35
sp|A5CDM6|OBG_ORITB GTPase Obg OS=Orientia tsutsugamushi (strain Boryong) GN=obg PE=3 SV=1 278 483 2.0E-35
sp|Q92G19|OBG_RICCN GTPase Obg OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=obg PE=3 SV=2 305 501 6.0E-35
sp|B2G6R9|OBG_LACRJ GTPase Obg OS=Lactobacillus reuteri (strain JCM 1112) GN=obg PE=3 SV=1 295 604 1.0E-34
sp|A5VJ99|OBG_LACRD GTPase Obg OS=Lactobacillus reuteri (strain DSM 20016) GN=obg PE=3 SV=1 295 604 1.0E-34
sp|Q9ZCB6|OBG_RICPR GTPase Obg OS=Rickettsia prowazekii (strain Madrid E) GN=obg PE=3 SV=1 275 501 3.0E-34
sp|A8GTZ9|OBG_RICRS GTPase Obg OS=Rickettsia rickettsii (strain Sheila Smith) GN=obg PE=3 SV=2 305 501 6.0E-34
sp|B0BVJ1|OBG_RICRO GTPase Obg OS=Rickettsia rickettsii (strain Iowa) GN=obg PE=3 SV=2 305 501 6.0E-34
sp|B5YJ65|OBG_THEYD GTPase Obg OS=Thermodesulfovibrio yellowstonii (strain ATCC 51303 / DSM 11347 / YP87) GN=obg PE=3 SV=1 295 598 1.0E-33
sp|Q5GTG3|OBG_WOLTR GTPase Obg OS=Wolbachia sp. subsp. Brugia malayi (strain TRS) GN=obg PE=3 SV=1 273 476 1.0E-33
sp|Q30QP0|OBG_SULDN GTPase Obg OS=Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251) GN=obg PE=3 SV=1 266 477 2.0E-33
sp|B1LA53|OBG_THESQ GTPase Obg OS=Thermotoga sp. (strain RQ2) GN=obg PE=3 SV=1 295 596 2.0E-33
sp|A5IKX2|OBG_THEP1 GTPase Obg OS=Thermotoga petrophila (strain RKU-1 / ATCC BAA-488 / DSM 13995) GN=obg PE=3 SV=1 295 596 3.0E-33
sp|B9L101|OBG_THERP GTPase Obg OS=Thermomicrobium roseum (strain ATCC 27502 / DSM 5159 / P-2) GN=obg PE=3 SV=1 291 605 4.0E-33
sp|A8F2Y3|OBG_RICM5 GTPase Obg OS=Rickettsia massiliae (strain Mtu5) GN=obg PE=3 SV=2 305 501 4.0E-33
sp|A8MHK8|OBG_ALKOO GTPase Obg OS=Alkaliphilus oremlandii (strain OhILAs) GN=obg PE=3 SV=1 290 509 4.0E-33
sp|Q5LRY4|OBG_RUEPO GTPase Obg OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=obg PE=3 SV=1 278 477 4.0E-33
sp|Q4UJV1|OBG_RICFE GTPase Obg OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=obg PE=3 SV=1 305 501 5.0E-33
sp|B0K414|OBG_THEPX GTPase Obg OS=Thermoanaerobacter sp. (strain X514) GN=obg PE=3 SV=1 288 478 5.0E-33
sp|B0KAB8|OBG_THEP3 GTPase Obg OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=obg PE=3 SV=1 288 478 5.0E-33
sp|Q68VS1|OBG_RICTY GTPase Obg OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=obg PE=3 SV=1 305 501 6.0E-33
sp|Q5FH94|OBG_EHRRG GTPase Obg OS=Ehrlichia ruminantium (strain Gardel) GN=obg PE=3 SV=1 265 483 6.0E-33
sp|Q88VG4|OBG_LACPL GTPase Obg OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=obg PE=3 SV=1 307 604 8.0E-33
sp|B3WE52|OBG_LACCB GTPase Obg OS=Lactobacillus casei (strain BL23) GN=obg PE=3 SV=1 295 557 8.0E-33
sp|Q0VSE6|OBG_ALCBS GTPase Obg OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=obg PE=3 SV=1 288 458 8.0E-33
sp|Q039J3|OBG_LACC3 GTPase Obg OS=Lactobacillus casei (strain ATCC 334) GN=obg PE=3 SV=1 295 557 8.0E-33
sp|Q10XA1|OBG_TRIEI GTPase Obg OS=Trichodesmium erythraeum (strain IMS101) GN=obg PE=3 SV=1 286 508 1.0E-32
sp|A8F063|OBG_RICCK GTPase Obg OS=Rickettsia canadensis (strain McKiel) GN=obg PE=3 SV=1 305 501 1.0E-32
sp|A8GQ55|OBG_RICAH GTPase Obg OS=Rickettsia akari (strain Hartford) GN=obg PE=3 SV=1 305 501 1.0E-32
sp|Q6AK07|OBG_DESPS GTPase Obg OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) GN=obg PE=3 SV=1 295 482 2.0E-32
sp|Q054P6|OBG_LEPBL GTPase Obg OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain L550) GN=obg PE=3 SV=1 305 476 2.0E-32
sp|Q04Q90|OBG_LEPBJ GTPase Obg OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) GN=obg PE=3 SV=1 305 476 2.0E-32
sp|B5YEQ1|OBG_DICT6 GTPase Obg OS=Dictyoglomus thermophilum (strain ATCC 35947 / DSM 3960 / H-6-12) GN=obg PE=3 SV=1 308 477 2.0E-32
sp|Q8F7U0|OBG_LEPIN GTPase Obg OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=obg PE=3 SV=1 295 476 2.0E-32
sp|Q72NQ7|OBG_LEPIC GTPase Obg OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) GN=obg PE=3 SV=1 295 476 2.0E-32
sp|Q5HB45|OBG_EHRRW GTPase Obg OS=Ehrlichia ruminantium (strain Welgevonden) GN=obg PE=3 SV=1 265 483 2.0E-32
sp|Q165Y6|OBG_ROSDO GTPase Obg OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) GN=obg PE=3 SV=1 265 485 2.0E-32
sp|Q3YRX8|OBG_EHRCJ GTPase Obg OS=Ehrlichia canis (strain Jake) GN=obg PE=3 SV=1 287 483 3.0E-32
sp|Q1GHD0|OBG_RUEST GTPase Obg OS=Ruegeria sp. (strain TM1040) GN=obg PE=3 SV=1 265 477 3.0E-32
sp|Q6MEQ6|OBG_PARUW GTPase Obg OS=Protochlamydia amoebophila (strain UWE25) GN=obg PE=3 SV=1 307 459 3.0E-32
sp|B8E0B2|OBG_DICTD GTPase Obg OS=Dictyoglomus turgidum (strain Z-1310 / DSM 6724) GN=obg PE=3 SV=1 308 477 4.0E-32
sp|A1B9C8|OBG_PARDP GTPase Obg OS=Paracoccus denitrificans (strain Pd 1222) GN=obg PE=3 SV=1 278 485 5.0E-32
sp|A0M5C6|OBG_GRAFK GTPase Obg OS=Gramella forsetii (strain KT0803) GN=obg PE=3 SV=1 305 485 5.0E-32
sp|B8I179|OBG_CLOCE GTPase Obg OS=Clostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10) GN=obg PE=3 SV=1 295 481 5.0E-32
sp|B8CXZ0|OBG_HALOH GTPase Obg OS=Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562) GN=obg PE=3 SV=1 288 459 6.0E-32
sp|A8LK09|OBG_DINSH GTPase Obg OS=Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12) GN=obg PE=3 SV=1 251 477 6.0E-32
sp|B0JI21|OBG_MICAN GTPase Obg OS=Microcystis aeruginosa (strain NIES-843) GN=obg PE=3 SV=1 286 478 8.0E-32
sp|B3DVG9|OBG_METI4 GTPase Obg OS=Methylacidiphilum infernorum (isolate V4) GN=obg PE=3 SV=2 292 478 1.0E-31
sp|B3EP74|OBG_CHLPB GTPase Obg OS=Chlorobium phaeobacteroides (strain BS1) GN=obg PE=3 SV=1 295 455 1.0E-31
sp|Q28Q12|OBG_JANSC GTPase Obg OS=Jannaschia sp. (strain CCS1) GN=obg PE=3 SV=2 265 477 1.0E-31
sp|Q8RBA5|OBG_CALS4 GTPase Obg OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=obg PE=3 SV=1 288 478 1.0E-31
sp|A7HJZ8|OBG_FERNB GTPase Obg OS=Fervidobacterium nodosum (strain ATCC 35602 / DSM 5306 / Rt17-B1) GN=obg PE=3 SV=1 295 459 2.0E-31
sp|O67849|OBG_AQUAE GTPase Obg OS=Aquifex aeolicus (strain VF5) GN=obg PE=3 SV=1 295 477 3.0E-31
sp|A0RR37|OBG_CAMFF GTPase Obg OS=Campylobacter fetus subsp. fetus (strain 82-40) GN=obg PE=3 SV=1 278 477 3.0E-31
sp|A1VF56|OBG_DESVV GTPase Obg OS=Desulfovibrio vulgaris subsp. vulgaris (strain DP4) GN=obg PE=3 SV=1 295 515 4.0E-31
sp|Q72DK0|OBG_DESVH GTPase Obg OS=Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) GN=obg PE=3 SV=1 295 515 4.0E-31
sp|Q7MA28|OBG_WOLSU GTPase Obg OS=Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / LMG 7466 / NCTC 11488 / FDC 602W) GN=obg PE=3 SV=1 265 458 4.0E-31
sp|B4S5P1|OBG_PROA2 GTPase Obg OS=Prosthecochloris aestuarii (strain DSM 271 / SK 413) GN=obg PE=3 SV=1 295 473 4.0E-31
sp|Q2JJ90|OBG_SYNJB GTPase Obg OS=Synechococcus sp. (strain JA-2-3B'a(2-13)) GN=obg PE=3 SV=1 307 483 4.0E-31
sp|B2GBD0|OBG_LACF3 GTPase Obg OS=Lactobacillus fermentum (strain NBRC 3956 / LMG 18251) GN=obg PE=3 SV=1 295 605 4.0E-31
sp|B8J4L3|OBG_DESDA GTPase Obg OS=Desulfovibrio desulfuricans (strain ATCC 27774 / DSM 6949) GN=obg PE=3 SV=1 295 458 5.0E-31
sp|Q043W1|OBG_LACGA GTPase Obg OS=Lactobacillus gasseri (strain ATCC 33323 / DSM 20243 / JCM 1131 / NCIMB 11718 / AM63) GN=obg PE=3 SV=1 287 602 6.0E-31
sp|Q89ZI9|OBG_BACTN GTPase Obg OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=obg PE=3 SV=1 308 485 7.0E-31
sp|B3CNP2|OBG_WOLPP GTPase Obg OS=Wolbachia pipientis subsp. Culex pipiens (strain wPip) GN=obg PE=3 SV=1 273 476 7.0E-31
sp|O25074|OBG_HELPY GTPase Obg OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=obg PE=3 SV=1 319 458 8.0E-31
sp|B5ZA69|OBG_HELPG GTPase Obg OS=Helicobacter pylori (strain G27) GN=obg PE=3 SV=1 319 458 8.0E-31
sp|B8DRN9|OBG_DESVM GTPase Obg OS=Desulfovibrio vulgaris (strain Miyazaki F / DSM 19637) GN=obg PE=3 SV=1 295 457 1.0E-30
sp|Q17Y93|OBG_HELAH GTPase Obg OS=Helicobacter acinonychis (strain Sheeba) GN=obg PE=3 SV=1 319 458 1.0E-30
sp|B7KIC1|OBG_CYAP7 GTPase Obg OS=Cyanothece sp. (strain PCC 7424) GN=obg PE=3 SV=1 307 478 1.0E-30
sp|Q74JN7|OBG_LACJO GTPase Obg OS=Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533) GN=obg PE=3 SV=1 287 602 2.0E-30
sp|Q9ZMD3|OBG_HELPJ GTPase Obg OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=obg PE=3 SV=1 319 458 2.0E-30
sp|Q1CUK0|OBG_HELPH GTPase Obg OS=Helicobacter pylori (strain HPAG1) GN=obg PE=3 SV=1 319 458 2.0E-30
sp|F4HSD4|OBGM_ARATH Probable GTP-binding protein OBGM, mitochondrial OS=Arabidopsis thaliana GN=ATOBGM PE=2 SV=1 129 460 2.0E-30
sp|B6JKN2|OBG_HELP2 GTPase Obg OS=Helicobacter pylori (strain P12) GN=obg PE=3 SV=1 297 458 2.0E-30
sp|B2USD4|OBG_HELPS GTPase Obg OS=Helicobacter pylori (strain Shi470) GN=obg PE=3 SV=1 319 458 2.0E-30
sp|A1KAD0|OBG_AZOSB GTPase Obg OS=Azoarcus sp. (strain BH72) GN=obg PE=3 SV=1 288 458 2.0E-30
sp|Q1RGV9|OBG_RICBR GTPase Obg OS=Rickettsia bellii (strain RML369-C) GN=obg PE=3 SV=1 305 483 2.0E-30
sp|A8GUG0|OBG_RICB8 GTPase Obg OS=Rickettsia bellii (strain OSU 85-389) GN=obg PE=3 SV=1 305 483 2.0E-30
sp|A1AT81|OBG_PELPD GTPase Obg OS=Pelobacter propionicus (strain DSM 2379) GN=obg PE=3 SV=1 298 558 4.0E-30
sp|B1VGL9|OBG_CORU7 GTPase Obg OS=Corynebacterium urealyticum (strain ATCC 43042 / DSM 7109) GN=obg PE=3 SV=1 288 476 4.0E-30
sp|Q73LW4|OBG_TREDE GTPase Obg OS=Treponema denticola (strain ATCC 35405 / CIP 103919 / DSM 14222) GN=obg PE=3 SV=1 296 554 5.0E-30
sp|Q4FP46|OBG_PELUB GTPase Obg OS=Pelagibacter ubique (strain HTCC1062) GN=obg PE=3 SV=1 278 478 5.0E-30
sp|Q03YT6|OBG_LEUMM GTPase Obg OS=Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / NCDO 523) GN=obg PE=3 SV=1 305 603 5.0E-30
sp|A1SMB4|OBG_NOCSJ GTPase Obg OS=Nocardioides sp. (strain BAA-499 / JS614) GN=obg PE=3 SV=1 288 508 6.0E-30
sp|B7J0M7|OBG_BORBZ GTPase Obg OS=Borrelia burgdorferi (strain ZS7) GN=obg PE=3 SV=1 307 498 7.0E-30
sp|O51722|OBG_BORBU GTPase Obg OS=Borrelia burgdorferi (strain ATCC 35210 / B31 / CIP 102532 / DSM 4680) GN=obg PE=3 SV=1 307 498 7.0E-30
sp|A6GZB7|OBG_FLAPJ GTPase Obg OS=Flavobacterium psychrophilum (strain JIP02/86 / ATCC 49511) GN=obg PE=3 SV=1 308 485 7.0E-30
sp|Q0SM73|OBG_BORAP GTPase Obg OS=Borrelia afzelii (strain PKo) GN=obg PE=3 SV=1 307 477 7.0E-30
sp|Q07U75|OBG_RHOP5 GTPase Obg OS=Rhodopseudomonas palustris (strain BisA53) GN=obg PE=3 SV=1 275 483 8.0E-30
sp|A5D410|OBG_PELTS GTPase Obg OS=Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI) GN=obg PE=3 SV=1 319 605 9.0E-30
sp|Q30XW0|OBG_DESAG GTPase Obg OS=Desulfovibrio alaskensis (strain G20) GN=obg PE=3 SV=2 295 458 1.0E-29
sp|Q7NZS1|OBG_CHRVO GTPase Obg OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=obg PE=3 SV=1 295 458 1.0E-29
sp|Q2GK25|OBG_ANAPZ GTPase Obg OS=Anaplasma phagocytophilum (strain HZ) GN=obg PE=3 SV=1 278 501 1.0E-29
sp|Q9Z808|OBG_CHLPN GTPase Obg OS=Chlamydia pneumoniae GN=obg PE=3 SV=1 307 458 1.0E-29
sp|A7NRU6|OBG_ROSCS GTPase Obg OS=Roseiflexus castenholzii (strain DSM 13941 / HLO8) GN=obg PE=3 SV=2 319 555 1.0E-29
sp|Q1MQQ1|OBG_LAWIP GTPase Obg OS=Lawsonia intracellularis (strain PHE/MN1-00) GN=obg PE=3 SV=1 295 455 1.0E-29
sp|Q824F3|OBG_CHLCV GTPase Obg OS=Chlamydophila caviae (strain GPIC) GN=obg PE=3 SV=1 295 485 2.0E-29
sp|Q04B11|OBG_LACDB GTPase Obg OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC BAA-365) GN=obg PE=3 SV=1 305 505 2.0E-29
sp|Q1GZ53|OBG_METFK GTPase Obg OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=obg PE=3 SV=1 278 458 2.0E-29
sp|Q87BL2|OBG_XYLFT GTPase Obg OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=obg PE=3 SV=1 307 459 2.0E-29
sp|B2I6V6|OBG_XYLF2 GTPase Obg OS=Xylella fastidiosa (strain M23) GN=obg PE=3 SV=1 307 459 2.0E-29
sp|B4U7P8|OBG_HYDS0 GTPase Obg OS=Hydrogenobaculum sp. (strain Y04AAS1) GN=obg PE=3 SV=1 308 476 2.0E-29
sp|B1X0M2|OBG_CYAA5 GTPase Obg OS=Cyanothece sp. (strain ATCC 51142) GN=obg PE=3 SV=1 291 482 2.0E-29
sp|Q21D04|OBG_RHOPB GTPase Obg OS=Rhodopseudomonas palustris (strain BisB18) GN=obg PE=3 SV=1 275 483 2.0E-29
sp|B9KW04|OBG_RHOSK GTPase Obg OS=Rhodobacter sphaeroides (strain KD131 / KCTC 12085) GN=obg PE=3 SV=1 265 534 2.0E-29
sp|Q1GAM3|OBG_LACDA GTPase Obg OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / JCM 1002 / NBRC 13953 / NCIMB 11778) GN=obg PE=3 SV=1 305 505 2.0E-29
sp|Q5L6R9|OBG_CHLAB GTPase Obg OS=Chlamydophila abortus (strain DSM 27085 / S26/3) GN=obg PE=3 SV=1 295 485 2.0E-29
sp|Q46X17|OBG_CUPPJ GTPase Obg OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=obg PE=3 SV=1 295 485 2.0E-29
sp|B0SRT7|OBG_LEPBP GTPase Obg OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / ATCC 23582 / Paris) GN=obg PE=3 SV=1 266 456 2.0E-29
sp|B0S9A3|OBG_LEPBA GTPase Obg OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / Ames) GN=obg PE=3 SV=1 266 456 2.0E-29
sp|B9MRB8|OBG_CALBD GTPase Obg OS=Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / Z-1320) GN=obg PE=3 SV=1 295 604 2.0E-29
sp|Q18B27|OBG_PEPD6 GTPase Obg OS=Peptoclostridium difficile (strain 630) GN=obg PE=3 SV=1 308 481 2.0E-29
sp|Q3IXX9|OBG_RHOS4 GTPase Obg OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=obg PE=3 SV=1 265 534 3.0E-29
sp|A3PQJ0|OBG_RHOS1 GTPase Obg OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) GN=obg PE=3 SV=1 265 534 3.0E-29
sp|A4WZ45|OBG_RHOS5 GTPase Obg OS=Rhodobacter sphaeroides (strain ATCC 17025 / ATH 2.4.3) GN=obg PE=3 SV=2 265 534 3.0E-29
sp|Q5FKH5|OBG_LACAC GTPase Obg OS=Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM) GN=obg PE=3 SV=1 305 509 3.0E-29
sp|C0R5N5|OBG_WOLWR GTPase Obg OS=Wolbachia sp. subsp. Drosophila simulans (strain wRi) GN=obg PE=3 SV=1 297 476 3.0E-29
sp|Q6NFV7|OBG_CORDI GTPase Obg OS=Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis) GN=obg PE=3 SV=1 298 484 3.0E-29
sp|A7HT67|OBG_PARL1 GTPase Obg OS=Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966) GN=obg PE=3 SV=1 251 483 3.0E-29
sp|A6QB70|OBG_SULNB GTPase Obg OS=Sulfurovum sp. (strain NBC37-1) GN=obg PE=3 SV=1 291 456 3.0E-29
sp|Q2GGS7|OBG_EHRCR GTPase Obg OS=Ehrlichia chaffeensis (strain ATCC CRL-10679 / Arkansas) GN=obg PE=3 SV=1 287 478 3.0E-29
sp|B2GGD9|OBG_KOCRD GTPase Obg OS=Kocuria rhizophila (strain ATCC 9341 / DSM 348 / NBRC 103217 / DC2201) GN=obg PE=3 SV=1 307 484 3.0E-29
sp|B1KZR3|OBG_CLOBM GTPase Obg OS=Clostridium botulinum (strain Loch Maree / Type A3) GN=obg PE=3 SV=1 295 459 4.0E-29
sp|Q9PAS3|OBG_XYLFA GTPase Obg OS=Xylella fastidiosa (strain 9a5c) GN=obg PE=3 SV=2 307 459 4.0E-29
sp|B9L605|OBG_NAUPA GTPase Obg OS=Nautilia profundicola (strain ATCC BAA-1463 / DSM 18972 / AmH) GN=obg PE=3 SV=1 319 484 4.0E-29
sp|Q38WT4|OBG_LACSS GTPase Obg OS=Lactobacillus sakei subsp. sakei (strain 23K) GN=obg PE=3 SV=1 298 603 4.0E-29
sp|A7I166|OBG_CAMHC GTPase Obg OS=Campylobacter hominis (strain ATCC BAA-381 / LMG 19568 / NCTC 13146 / CH001A) GN=obg PE=3 SV=1 318 478 4.0E-29
sp|Q0K6P6|OBG_CUPNH GTPase Obg OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=obg PE=3 SV=1 295 485 4.0E-29
sp|A6TQJ6|OBG_ALKMQ GTPase Obg OS=Alkaliphilus metalliredigens (strain QYMF) GN=obg PE=3 SV=1 290 481 4.0E-29
sp|C1F9K2|OBG_ACIC5 GTPase Obg OS=Acidobacterium capsulatum (strain ATCC 51196 / DSM 11244 / JCM 7670 / NBRC 15755 / NCIMB 13165 / 161) GN=obg PE=3 SV=1 295 458 5.0E-29
sp|A7GHK2|OBG_CLOBL GTPase Obg OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) GN=obg PE=3 SV=1 295 459 5.0E-29
sp|B1ILY5|OBG_CLOBK GTPase Obg OS=Clostridium botulinum (strain Okra / Type B1) GN=obg PE=3 SV=1 295 459 5.0E-29
sp|A9H0F1|OBG_GLUDA GTPase Obg OS=Gluconacetobacter diazotrophicus (strain ATCC 49037 / DSM 5601 / PAl5) GN=obg PE=3 SV=2 295 476 5.0E-29
sp|Q73HQ3|OBG_WOLPM GTPase Obg OS=Wolbachia pipientis wMel GN=obg PE=3 SV=1 297 476 5.0E-29
sp|A6T2D5|OBG_JANMA GTPase Obg OS=Janthinobacterium sp. (strain Marseille) GN=obg PE=3 SV=1 280 485 5.0E-29
sp|B7JVH9|OBG_CYAP8 GTPase Obg OS=Cyanothece sp. (strain PCC 8801) GN=obg PE=3 SV=1 305 482 5.0E-29
sp|P72931|OBG_SYNY3 GTPase Obg OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=obg PE=3 SV=1 298 478 5.0E-29
sp|A5I666|OBG_CLOBH GTPase Obg OS=Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A) GN=obg PE=3 SV=1 295 459 6.0E-29
sp|A7FXU6|OBG_CLOB1 GTPase Obg OS=Clostridium botulinum (strain ATCC 19397 / Type A) GN=obg PE=3 SV=1 295 459 6.0E-29
sp|A5UZ80|OBG_ROSS1 GTPase Obg OS=Roseiflexus sp. (strain RS-1) GN=obg PE=3 SV=1 319 476 6.0E-29
sp|B7IGK8|OBG_THEAB GTPase Obg OS=Thermosipho africanus (strain TCF52B) GN=obg PE=3 SV=1 295 459 6.0E-29
sp|A9KMF5|OBG_CLOPH GTPase Obg OS=Clostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg) GN=obg PE=3 SV=1 295 478 6.0E-29
sp|B2IE44|OBG_BEII9 GTPase Obg OS=Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIB 8712) GN=obg PE=3 SV=1 251 478 6.0E-29
sp|A4XJS8|OBG_CALS8 GTPase Obg OS=Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331) GN=obg PE=3 SV=2 295 604 7.0E-29
sp|A4G8R4|OBG_HERAR GTPase Obg OS=Herminiimonas arsenicoxydans GN=obg PE=3 SV=1 280 485 7.0E-29
sp|A4SVA3|OBG_POLSQ GTPase Obg OS=Polynucleobacter necessarius subsp. asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1) GN=obg PE=3 SV=1 307 458 7.0E-29
sp|Q1WT46|OBG_LACS1 GTPase Obg OS=Lactobacillus salivarius (strain UCC118) GN=obg PE=3 SV=1 307 604 9.0E-29
sp|B2S1C3|OBG_BORHD GTPase Obg OS=Borrelia hermsii (strain HS1 / DAH) GN=obg PE=3 SV=1 312 485 9.0E-29
sp|Q9WXV3|OBG_THEMA GTPase Obg OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=obg PE=3 SV=1 295 596 1.0E-28
sp|B3E609|OBG_GEOLS GTPase Obg OS=Geobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) GN=obg PE=3 SV=1 295 478 1.0E-28
sp|B9M3W3|OBG_GEODF GTPase Obg OS=Geobacter daltonii (strain DSM 22248 / JCM 15807 / FRC-32) GN=obg PE=3 SV=1 295 458 1.0E-28
sp|Q2QZ37|OBGM_ORYSJ Probable GTP-binding protein OBGM, mitochondrial OS=Oryza sativa subsp. japonica GN=OBGM PE=2 SV=1 296 459 1.0E-28
sp|Q7MW55|OBG_PORGI GTPase Obg OS=Porphyromonas gingivalis (strain ATCC BAA-308 / W83) GN=obg PE=3 SV=1 308 501 1.0E-28
sp|B2RIY7|OBG_PORG3 GTPase Obg OS=Porphyromonas gingivalis (strain ATCC 33277 / DSM 20709 / JCM 12257) GN=obg PE=3 SV=1 308 501 1.0E-28
sp|A4SCP4|OBG_CHLPM GTPase Obg OS=Chlorobium phaeovibrioides (strain DSM 265 / 1930) GN=obg PE=3 SV=1 295 478 1.0E-28
sp|A4XYL2|OBG_PSEMY GTPase Obg OS=Pseudomonas mendocina (strain ymp) GN=obg PE=3 SV=1 295 559 1.0E-28
sp|A8F478|OBG_PSELT GTPase Obg OS=Pseudothermotoga lettingae (strain ATCC BAA-301 / DSM 14385 / NBRC 107922 / TMO) GN=obg PE=3 SV=1 309 481 1.0E-28
sp|A0LCZ3|OBG_MAGMM GTPase Obg OS=Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1) GN=obg PE=3 SV=1 295 485 1.0E-28
sp|B0U3R3|OBG_XYLFM GTPase Obg OS=Xylella fastidiosa (strain M12) GN=obg PE=3 SV=1 307 459 1.0E-28
sp|Q253F8|OBG_CHLFF GTPase Obg OS=Chlamydophila felis (strain Fe/C-56) GN=obg PE=3 SV=1 295 485 1.0E-28
sp|Q0AAD6|OBG_ALKEH GTPase Obg OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=obg PE=3 SV=1 307 456 1.0E-28
sp|B5RMX3|OBG_BORDL GTPase Obg OS=Borrelia duttonii (strain Ly) GN=obg PE=3 SV=1 312 476 1.0E-28
sp|A9BK05|OBG_PETMO GTPase Obg OS=Petrotoga mobilis (strain DSM 10674 / SJ95) GN=obg PE=3 SV=1 298 459 1.0E-28
sp|A5IAS7|OBG_LEGPC GTPase Obg OS=Legionella pneumophila (strain Corby) GN=obg PE=3 SV=1 295 476 1.0E-28
sp|Q4AAV4|OBG_MYCHJ GTPase Obg OS=Mycoplasma hyopneumoniae (strain J / ATCC 25934 / NCTC 10110) GN=obg PE=3 SV=1 305 554 1.0E-28
sp|Q2Y807|OBG_NITMU GTPase Obg OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849) GN=obg PE=3 SV=1 296 481 1.0E-28
sp|Q65ZZ3|OBG_BORBP GTPase Obg OS=Borrelia bavariensis (strain ATCC BAA-2496 / DSM 23469 / PBi) GN=obg PE=3 SV=1 307 477 1.0E-28
sp|Q2IH84|OBG_ANADE GTPase Obg OS=Anaeromyxobacter dehalogenans (strain 2CP-C) GN=obg PE=3 SV=1 307 596 1.0E-28
sp|B5RQB8|OBG_BORRA GTPase Obg OS=Borrelia recurrentis (strain A1) GN=obg PE=3 SV=1 312 476 1.0E-28
sp|B3R898|OBG_CUPTR GTPase Obg OS=Cupriavidus taiwanensis (strain R1 / LMG 19424) GN=obg PE=3 SV=1 295 458 1.0E-28
sp|Q602A7|OBG_MYCH2 GTPase Obg OS=Mycoplasma hyopneumoniae (strain 232) GN=obg PE=3 SV=1 305 554 1.0E-28
sp|B2TK70|OBG_CLOBB GTPase Obg OS=Clostridium botulinum (strain Eklund 17B / Type B) GN=obg PE=3 SV=1 275 459 1.0E-28
sp|A6Q4D2|OBG_NITSB GTPase Obg OS=Nitratiruptor sp. (strain SB155-2) GN=obg PE=3 SV=1 295 459 1.0E-28
sp|Q89X89|OBG_BRADU GTPase Obg OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=obg PE=3 SV=1 275 483 1.0E-28
sp|B0CDA2|OBG_ACAM1 GTPase Obg OS=Acaryochloris marina (strain MBIC 11017) GN=obg PE=3 SV=1 309 478 1.0E-28
sp|B4SBR3|OBG_PELPB GTPase Obg OS=Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1) GN=obg PE=3 SV=1 295 485 2.0E-28
sp|Q9RY66|OBG_DEIRA GTPase Obg OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=obg PE=3 SV=1 308 476 2.0E-28
sp|B4UIU2|OBG_ANASK GTPase Obg OS=Anaeromyxobacter sp. (strain K) GN=obg PE=3 SV=1 307 596 2.0E-28
sp|Q5WTF1|OBG_LEGPL GTPase Obg OS=Legionella pneumophila (strain Lens) GN=obg PE=3 SV=1 295 476 2.0E-28
sp|Q4A8X1|OBG_MYCH7 GTPase Obg OS=Mycoplasma hyopneumoniae (strain 7448) GN=obg PE=3 SV=1 305 554 2.0E-28
sp|B0T310|OBG_CAUSK GTPase Obg OS=Caulobacter sp. (strain K31) GN=obg PE=3 SV=1 280 483 2.0E-28
sp|B1XT35|OBG_POLNS GTPase Obg OS=Polynucleobacter necessarius subsp. necessarius (strain STIR1) GN=obg PE=3 SV=1 307 458 2.0E-28
sp|Q31IT4|OBG_THICR GTPase Obg OS=Thiomicrospira crunogena (strain XCL-2) GN=obg PE=3 SV=1 291 485 2.0E-28
sp|Q5X1P1|OBG_LEGPA GTPase Obg OS=Legionella pneumophila (strain Paris) GN=obg PE=3 SV=1 295 476 2.0E-28
sp|Q2J3J8|OBG_RHOP2 GTPase Obg OS=Rhodopseudomonas palustris (strain HaA2) GN=obg PE=3 SV=1 275 483 2.0E-28
sp|A9NF57|OBG_ACHLI GTPase Obg OS=Acholeplasma laidlawii (strain PG-8A) GN=obg PE=3 SV=1 305 482 2.0E-28
sp|B3QRD8|OBG_CHLP8 GTPase Obg OS=Chlorobaculum parvum (strain NCIB 8327) GN=obg PE=3 SV=1 305 455 2.0E-28
sp|Q2LR77|OBG_SYNAS GTPase Obg OS=Syntrophus aciditrophicus (strain SB) GN=obg PE=3 SV=2 305 477 3.0E-28
sp|A1R0K4|OBG_BORT9 GTPase Obg OS=Borrelia turicatae (strain 91E135) GN=obg PE=3 SV=1 312 485 3.0E-28
sp|A9IFF9|OBG_BORPD GTPase Obg OS=Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448) GN=obg PE=3 SV=1 295 459 3.0E-28
sp|A0Q1T4|OBG_CLONN GTPase Obg OS=Clostridium novyi (strain NT) GN=obg PE=3 SV=1 296 477 3.0E-28
sp|A8YV14|OBG_LACH4 GTPase Obg OS=Lactobacillus helveticus (strain DPC 4571) GN=obg PE=3 SV=1 305 466 3.0E-28
sp|Q8KAF0|OBG_CHLTE GTPase Obg OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=obg PE=3 SV=1 295 455 3.0E-28
sp|Q5ZS70|OBG_LEGPH GTPase Obg OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=obg PE=3 SV=2 295 476 3.0E-28
sp|B2IYX1|OBG_NOSP7 GTPase Obg OS=Nostoc punctiforme (strain ATCC 29133 / PCC 73102) GN=obg PE=3 SV=1 298 478 4.0E-28
sp|A5GD29|OBG_GEOUR GTPase Obg OS=Geobacter uraniireducens (strain Rf4) GN=obg PE=3 SV=1 295 458 4.0E-28
sp|Q1LIQ0|OBG_CUPMC GTPase Obg OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=obg PE=3 SV=1 295 485 4.0E-28
sp|A8Z6G0|OBG_CAMC1 GTPase Obg OS=Campylobacter concisus (strain 13826) GN=obg PE=3 SV=1 319 554 4.0E-28
sp|Q3ZAJ2|OBG_DEHM1 GTPase Obg OS=Dehalococcoides mccartyi (strain ATCC BAA-2266 / KCTC 15142 / 195) GN=obg PE=3 SV=1 308 476 4.0E-28
sp|O84423|OBG_CHLTR GTPase Obg OS=Chlamydia trachomatis (strain D/UW-3/Cx) GN=obg PE=3 SV=1 307 484 4.0E-28
sp|B8EQH4|OBG_METSB GTPase Obg OS=Methylocella silvestris (strain BL2 / DSM 15510 / NCIMB 13906) GN=obg PE=3 SV=1 251 483 4.0E-28
sp|A8EV83|OBG_ARCB4 GTPase Obg OS=Arcobacter butzleri (strain RM4018) GN=obg PE=3 SV=1 295 537 5.0E-28
sp|Q3KLT5|OBG_CHLTA GTPase Obg OS=Chlamydia trachomatis serovar A (strain ATCC VR-571B / DSM 19440 / HAR-13) GN=obg PE=3 SV=1 307 484 5.0E-28
sp|Q8FYM2|OBG_BRUSU GTPase Obg OS=Brucella suis biovar 1 (strain 1330) GN=obg PE=3 SV=1 251 483 5.0E-28
sp|A9WWW9|OBG_BRUSI GTPase Obg OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=obg PE=3 SV=1 251 483 5.0E-28
sp|A5VSI5|OBG_BRUO2 GTPase Obg OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=obg PE=3 SV=2 251 483 5.0E-28
sp|Q8YJ80|OBG_BRUME GTPase Obg OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=obg PE=3 SV=2 251 483 5.0E-28
sp|A9M882|OBG_BRUC2 GTPase Obg OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=obg PE=3 SV=1 251 483 5.0E-28
sp|Q57B45|OBG_BRUAB GTPase Obg OS=Brucella abortus biovar 1 (strain 9-941) GN=obg PE=3 SV=1 251 483 5.0E-28
sp|Q2YLM2|OBG_BRUA2 GTPase Obg OS=Brucella abortus (strain 2308) GN=obg PE=3 SV=1 251 483 5.0E-28
sp|B2S806|OBG_BRUA1 GTPase Obg OS=Brucella abortus (strain S19) GN=obg PE=3 SV=1 251 483 5.0E-28
sp|Q9H4K7|MTG2_HUMAN Mitochondrial ribosome-associated GTPase 2 OS=Homo sapiens GN=MTG2 PE=1 SV=1 319 557 5.0E-28
sp|B8JBP2|OBG_ANAD2 GTPase Obg OS=Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258) GN=obg PE=3 SV=1 307 487 5.0E-28
sp|Q89AE7|OBG_BUCBP GTPase Obg OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=obg PE=3 SV=1 278 483 5.0E-28
sp|Q0SH51|OBG_RHOJR GTPase Obg OS=Rhodococcus jostii (strain RHA1) GN=obg PE=3 SV=1 307 476 5.0E-28
sp|Q2SZG0|OBG_BURTA GTPase Obg OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=obg PE=3 SV=1 295 458 6.0E-28
sp|Q2RV04|OBG_RHORT GTPase Obg OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) GN=obg PE=3 SV=1 295 478 6.0E-28
sp|A3NDS7|OBG_BURP6 GTPase Obg OS=Burkholderia pseudomallei (strain 668) GN=obg PE=3 SV=1 295 458 6.0E-28
sp|Q63QM0|OBG_BURPS GTPase Obg OS=Burkholderia pseudomallei (strain K96243) GN=obg PE=3 SV=1 295 458 6.0E-28
sp|Q3JNG0|OBG_BURP1 GTPase Obg OS=Burkholderia pseudomallei (strain 1710b) GN=obg PE=3 SV=1 295 458 6.0E-28
sp|A3NZJ0|OBG_BURP0 GTPase Obg OS=Burkholderia pseudomallei (strain 1106a) GN=obg PE=3 SV=1 295 458 6.0E-28
sp|A1V0P1|OBG_BURMS GTPase Obg OS=Burkholderia mallei (strain SAVP1) GN=obg PE=3 SV=1 295 458 6.0E-28
sp|Q62GV4|OBG_BURMA GTPase Obg OS=Burkholderia mallei (strain ATCC 23344) GN=obg PE=3 SV=1 295 458 6.0E-28
sp|A2S5R8|OBG_BURM9 GTPase Obg OS=Burkholderia mallei (strain NCTC 10229) GN=obg PE=3 SV=1 295 458 6.0E-28
sp|A3MR90|OBG_BURM7 GTPase Obg OS=Burkholderia mallei (strain NCTC 10247) GN=obg PE=3 SV=1 295 458 6.0E-28
sp|B9KER3|OBG_CAMLR GTPase Obg OS=Campylobacter lari (strain RM2100 / D67 / ATCC BAA-1060) GN=obg PE=3 SV=1 318 456 6.0E-28
sp|B0VCR5|OBG_ACIBY GTPase Obg OS=Acinetobacter baumannii (strain AYE) GN=obg PE=3 SV=1 295 469 7.0E-28
sp|A3M7M2|OBG_ACIBT GTPase Obg OS=Acinetobacter baumannii (strain ATCC 17978 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377) GN=obg PE=3 SV=2 295 469 7.0E-28
sp|B2HWM9|OBG_ACIBC GTPase Obg OS=Acinetobacter baumannii (strain ACICU) GN=obg PE=3 SV=1 295 469 7.0E-28
sp|B7I557|OBG_ACIB5 GTPase Obg OS=Acinetobacter baumannii (strain AB0057) GN=obg PE=3 SV=1 295 469 7.0E-28
sp|B7GYV1|OBG_ACIB3 GTPase Obg OS=Acinetobacter baumannii (strain AB307-0294) GN=obg PE=3 SV=1 295 469 7.0E-28
sp|Q5RDW1|MTG2_PONAB Mitochondrial ribosome-associated GTPase 2 OS=Pongo abelii GN=MTG2 PE=2 SV=1 319 516 7.0E-28
sp|B0VTQ1|OBG_ACIBS GTPase Obg OS=Acinetobacter baumannii (strain SDF) GN=obg PE=3 SV=1 295 469 7.0E-28
sp|B6JD21|OBG_OLICO GTPase Obg OS=Oligotropha carboxidovorans (strain ATCC 49405 / DSM 1227 / OM5) GN=obg PE=3 SV=1 307 483 8.0E-28
sp|P0CB41|OBG_CAUCR GTPase Obg OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=obg PE=3 SV=1 278 483 9.0E-28
sp|B8GYI7|OBG_CAUCN GTPase Obg/CgtA OS=Caulobacter crescentus (strain NA1000 / CB15N) GN=cgtA PE=1 SV=1 278 483 9.0E-28
sp|B0BC53|OBG_CHLTB GTPase Obg OS=Chlamydia trachomatis serovar L2b (strain UCH-1/proctitis) GN=obg PE=3 SV=1 307 484 9.0E-28
sp|B0B7Y8|OBG_CHLT2 GTPase Obg OS=Chlamydia trachomatis serovar L2 (strain 434/Bu / ATCC VR-902B) GN=obg PE=3 SV=1 307 484 9.0E-28
sp|Q13U15|OBG_BURXL GTPase Obg OS=Burkholderia xenovorans (strain LB400) GN=obg PE=3 SV=1 295 458 9.0E-28
sp|Q5P7Z4|OBG_AROAE GTPase Obg OS=Aromatoleum aromaticum (strain EbN1) GN=obg PE=3 SV=1 288 458 9.0E-28
sp|B1X580|OBG_PAUCH Putative GTPase Obg OS=Paulinella chromatophora GN=obg PE=3 SV=1 289 485 9.0E-28
sp|Q9HVL8|OBG_PSEAE GTPase Obg OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=obg PE=3 SV=1 295 458 1.0E-27
sp|Q02GB1|OBG_PSEAB GTPase Obg OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=obg PE=1 SV=1 295 458 1.0E-27
sp|B7V0A9|OBG_PSEA8 GTPase Obg OS=Pseudomonas aeruginosa (strain LESB58) GN=obg PE=3 SV=1 295 458 1.0E-27
sp|Q13DL7|OBG_RHOPS GTPase Obg OS=Rhodopseudomonas palustris (strain BisB5) GN=obg PE=3 SV=1 275 534 1.0E-27
sp|C1DEA4|OBG_AZOVD GTPase Obg OS=Azotobacter vinelandii (strain DJ / ATCC BAA-1303) GN=obg PE=3 SV=1 295 485 1.0E-27
sp|B1M697|OBG_METRJ GTPase Obg OS=Methylobacterium radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831) GN=obg PE=3 SV=1 278 478 1.0E-27
sp|Q39JU7|OBG_BURL3 GTPase Obg OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=obg PE=3 SV=1 295 458 1.0E-27
sp|Q6NDE6|OBG_RHOPA GTPase Obg OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=obg PE=3 SV=1 275 483 1.0E-27
sp|A6VBV3|OBG_PSEA7 GTPase Obg OS=Pseudomonas aeruginosa (strain PA7) GN=obg PE=3 SV=1 295 458 1.0E-27
sp|C1A1L5|OBG_RHOE4 GTPase Obg OS=Rhodococcus erythropolis (strain PR4 / NBRC 100887) GN=obg PE=3 SV=1 310 476 1.0E-27
sp|B3QVU6|OBG_CHLT3 GTPase Obg OS=Chloroherpeton thalassium (strain ATCC 35110 / GB-78) GN=obg PE=3 SV=1 308 455 1.0E-27
sp|A1BJ56|OBG_CHLPD GTPase Obg OS=Chlorobium phaeobacteroides (strain DSM 266) GN=obg PE=3 SV=1 295 476 1.0E-27
sp|B3Q731|OBG_RHOPT GTPase Obg OS=Rhodopseudomonas palustris (strain TIE-1) GN=obg PE=3 SV=1 275 483 1.0E-27
sp|B5ZBV6|OBG_UREU1 GTPase Obg OS=Ureaplasma urealyticum serovar 10 (strain ATCC 33699 / Western) GN=obg PE=3 SV=1 305 478 1.0E-27
sp|A6LJZ0|OBG_THEM4 GTPase Obg OS=Thermosipho melanesiensis (strain DSM 12029 / CIP 104789 / BI429) GN=obg PE=3 SV=1 295 459 1.0E-27
sp|A6WXS0|OBG_OCHA4 GTPase Obg OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=obg PE=3 SV=1 251 483 1.0E-27
sp|B0RDG3|OBG_CLAMS GTPase Obg OS=Clavibacter michiganensis subsp. sepedonicus (strain ATCC 33113 / DSM 20744 / JCM 9667 / LMG 2889 / C-1) GN=obg PE=3 SV=1 254 476 1.0E-27
sp|A7HIF8|OBG_ANADF GTPase Obg OS=Anaeromyxobacter sp. (strain Fw109-5) GN=obg PE=3 SV=1 288 477 1.0E-27
sp|Q82V20|OBG_NITEU GTPase Obg OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=obg PE=3 SV=1 278 458 1.0E-27
sp|Q11Z03|OBG_CYTH3 GTPase Obg OS=Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469) GN=obg PE=3 SV=1 305 485 2.0E-27
sp|B2JHD7|OBG_BURP8 GTPase Obg OS=Burkholderia phymatum (strain DSM 17167 / STM815) GN=obg PE=3 SV=1 295 458 2.0E-27
sp|Q04EZ8|OBG_OENOB GTPase Obg OS=Oenococcus oeni (strain ATCC BAA-331 / PSU-1) GN=obg PE=3 SV=1 296 557 2.0E-27
sp|A1URN4|OBG_BARBK GTPase Obg OS=Bartonella bacilliformis (strain ATCC 35685 / KC583) GN=obg PE=3 SV=1 278 483 2.0E-27
sp|Q2NCX8|OBG_ERYLH GTPase Obg OS=Erythrobacter litoralis (strain HTCC2594) GN=obg PE=3 SV=1 278 483 2.0E-27
sp|B0TBW1|OBG_HELMI GTPase Obg OS=Heliobacterium modesticaldum (strain ATCC 51547 / Ice1) GN=obg PE=3 SV=1 319 605 2.0E-27
sp|A7H029|OBG_CAMC5 GTPase Obg OS=Campylobacter curvus (strain 525.92) GN=obg PE=3 SV=1 318 564 2.0E-27
sp|Q6KHM2|OBG_MYCMO GTPase Obg OS=Mycoplasma mobile (strain ATCC 43663 / 163K / NCTC 11711) GN=obg PE=3 SV=1 305 478 2.0E-27
sp|B1ZZ37|OBG_OPITP GTPase Obg OS=Opitutus terrae (strain DSM 11246 / PB90-1) GN=obg PE=3 SV=1 290 476 2.0E-27
sp|B2SYV2|OBG_BURPP GTPase Obg OS=Burkholderia phytofirmans (strain DSM 17436 / PsJN) GN=obg PE=3 SV=1 295 485 2.0E-27
sp|B9E021|OBG_CLOK1 GTPase Obg OS=Clostridium kluyveri (strain NBRC 12016) GN=obg PE=3 SV=2 295 459 2.0E-27
sp|Q3B6H6|OBG_CHLL7 GTPase Obg OS=Chlorobium luteolum (strain DSM 273 / 2530) GN=obg PE=3 SV=1 308 478 2.0E-27
sp|Q03QP2|OBG_LACBA GTPase Obg OS=Lactobacillus brevis (strain ATCC 367 / JCM 1170) GN=obg PE=3 SV=1 295 557 2.0E-27
sp|A4JBB8|OBG_BURVG GTPase Obg OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=obg PE=3 SV=1 295 458 2.0E-27
sp|Q3AM97|OBG_SYNSC GTPase Obg OS=Synechococcus sp. (strain CC9605) GN=obg PE=3 SV=1 266 485 2.0E-27
sp|B1HVB2|OBG_LYSSC GTPase Obg OS=Lysinibacillus sphaericus (strain C3-41) GN=obg PE=3 SV=2 267 459 3.0E-27
sp|Q2K2X6|OBG_RHIEC GTPase Obg OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=obg PE=3 SV=1 280 483 3.0E-27
sp|A5E965|OBG_BRASB GTPase Obg OS=Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182) GN=obg PE=3 SV=1 275 483 3.0E-27
sp|Q3ZW89|OBG_DEHMC GTPase Obg OS=Dehalococcoides mccartyi (strain CBDB1) GN=obg PE=3 SV=1 308 476 3.0E-27
sp|A5FP49|OBG_DEHMB GTPase Obg OS=Dehalococcoides mccartyi (strain ATCC BAA-2100 / JCM 16839 / KCTC 5957 / BAV1) GN=obg PE=3 SV=1 308 476 3.0E-27
sp|A4YKF3|OBG_BRASO GTPase Obg OS=Bradyrhizobium sp. (strain ORS278) GN=obg PE=3 SV=1 307 483 3.0E-27
sp|Q0BRE9|OBG_GRABC GTPase Obg OS=Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1) GN=obg PE=3 SV=2 280 506 3.0E-27
sp|Q64XA5|OBG_BACFR GTPase Obg OS=Bacteroides fragilis (strain YCH46) GN=obg PE=3 SV=1 319 549 3.0E-27
sp|Q5LGG9|OBG_BACFN GTPase Obg OS=Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / JCM 11019 / NCTC 9343) GN=obg PE=3 SV=2 319 549 3.0E-27
sp|Q2VZU2|OBG_MAGSA GTPase Obg OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) GN=obg PE=3 SV=1 278 524 3.0E-27
sp|Q2L062|OBG_BORA1 GTPase Obg OS=Bordetella avium (strain 197N) GN=obg PE=3 SV=1 295 459 4.0E-27
sp|A5CR32|OBG_CLAM3 GTPase Obg OS=Clavibacter michiganensis subsp. michiganensis (strain NCPPB 382) GN=obg PE=3 SV=1 254 476 4.0E-27
sp|Q1IW72|OBG_DEIGD GTPase Obg OS=Deinococcus geothermalis (strain DSM 11300) GN=obg PE=3 SV=1 308 476 4.0E-27
sp|Q47AD0|OBG_DECAR GTPase Obg OS=Dechloromonas aromatica (strain RCB) GN=obg PE=3 SV=1 295 458 4.0E-27
sp|Q1LSJ9|OBG_BAUCH GTPase Obg OS=Baumannia cicadellinicola subsp. Homalodisca coagulata GN=obg PE=3 SV=1 280 458 4.0E-27
sp|Q11CP6|OBG_CHESB GTPase Obg OS=Chelativorans sp. (strain BNC1) GN=obg PE=3 SV=1 278 483 4.0E-27
sp|Q98QK8|OBG_MYCPU GTPase Obg OS=Mycoplasma pulmonis (strain UAB CTIP) GN=obg PE=3 SV=1 305 484 4.0E-27
sp|Q9CNS4|OBG_PASMU GTPase Obg OS=Pasteurella multocida (strain Pm70) GN=obg PE=3 SV=1 280 485 4.0E-27
sp|Q4JWT6|OBG_CORJK GTPase Obg OS=Corynebacterium jeikeium (strain K411) GN=obg PE=3 SV=1 288 478 4.0E-27
sp|Q6F9D8|OBG_ACIAD GTPase Obg OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=obg PE=3 SV=1 295 458 5.0E-27
sp|Q8DUU2|OBG_STRMU GTPase Obg OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=obg PE=3 SV=1 295 603 5.0E-27
sp|Q1MA76|OBG_RHIL3 GTPase Obg OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=obg PE=3 SV=1 280 483 5.0E-27
sp|B4SP14|OBG_STRM5 GTPase Obg OS=Stenotrophomonas maltophilia (strain R551-3) GN=obg PE=3 SV=1 295 558 5.0E-27
sp|B2FTD3|OBG_STRMK GTPase Obg OS=Stenotrophomonas maltophilia (strain K279a) GN=obg PE=3 SV=1 295 558 5.0E-27
sp|Q1QA43|OBG_PSYCK GTPase Obg OS=Psychrobacter cryohalolentis (strain K5) GN=obg PE=3 SV=1 305 457 5.0E-27
sp|Q65S59|OBG_MANSM GTPase Obg OS=Mannheimia succiniciproducens (strain MBEL55E) GN=obg PE=3 SV=1 280 485 5.0E-27
sp|B2UCV3|OBG_RALPJ GTPase Obg OS=Ralstonia pickettii (strain 12J) GN=obg PE=3 SV=1 307 458 5.0E-27
sp|A3DBS5|OBG_CLOTH GTPase Obg OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=obg PE=3 SV=1 295 476 5.0E-27
sp|Q4ZYK1|OBG_PSEU2 GTPase Obg OS=Pseudomonas syringae pv. syringae (strain B728a) GN=obg PE=3 SV=1 278 458 6.0E-27
sp|Q48NL2|OBG_PSE14 GTPase Obg OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=obg PE=3 SV=1 278 458 6.0E-27
sp|B5Y805|OBG_COPPD GTPase Obg OS=Coprothermobacter proteolyticus (strain ATCC 35245 / DSM 5265 / BT) GN=obg PE=3 SV=1 296 468 6.0E-27
sp|Q4FRK6|OBG_PSYA2 GTPase Obg OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=obg PE=3 SV=1 305 457 6.0E-27
sp|B8FM68|OBG_DESAA GTPase Obg OS=Desulfatibacillum alkenivorans (strain AK-01) GN=obg PE=3 SV=1 295 478 6.0E-27
sp|Q5N4J6|OBG_SYNP6 GTPase Obg OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=obg PE=3 SV=1 309 482 6.0E-27
sp|Q31PN0|OBG_SYNE7 GTPase Obg OS=Synechococcus elongatus (strain PCC 7942) GN=obg PE=3 SV=1 309 482 6.0E-27
sp|Q9PJX7|OBG_CHLMU GTPase Obg OS=Chlamydia muridarum (strain MoPn / Nigg) GN=obg PE=3 SV=1 308 459 6.0E-27
sp|Q9PQ29|OBG_UREPA GTPase Obg OS=Ureaplasma parvum serovar 3 (strain ATCC 700970) GN=obg PE=3 SV=1 305 478 6.0E-27
sp|B1AJA2|OBG_UREP2 GTPase Obg OS=Ureaplasma parvum serovar 3 (strain ATCC 27815 / 27 / NCTC 11736) GN=obg PE=3 SV=1 305 478 6.0E-27
sp|B0S3Z4|OBG_FINM2 GTPase Obg OS=Finegoldia magna (strain ATCC 29328) GN=obg PE=3 SV=1 288 476 6.0E-27
sp|A9AXD9|OBG_HERA2 GTPase Obg OS=Herpetosiphon aurantiacus (strain ATCC 23779 / DSM 785) GN=obg PE=3 SV=1 291 456 6.0E-27
sp|Q97JL4|OBG_CLOAB GTPase Obg OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=obg PE=3 SV=1 295 459 7.0E-27
sp|Q47MV6|OBG_THEFY GTPase Obg OS=Thermobifida fusca (strain YX) GN=obg PE=3 SV=1 307 478 7.0E-27
sp|Q2GDW7|OBG_NEOSM GTPase Obg OS=Neorickettsia sennetsu (strain Miyayama) GN=obg PE=3 SV=1 298 478 7.0E-27
sp|B3PRZ3|OBG_RHIE6 GTPase Obg OS=Rhizobium etli (strain CIAT 652) GN=obg PE=3 SV=1 280 483 8.0E-27
sp|Q39QR4|OBG_GEOMG GTPase Obg OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=obg PE=3 SV=1 295 477 8.0E-27
sp|B4RD64|OBG_PHEZH GTPase Obg OS=Phenylobacterium zucineum (strain HLK1) GN=obg PE=3 SV=1 295 483 8.0E-27
sp|Q0AKX2|OBG_MARMM GTPase Obg OS=Maricaulis maris (strain MCS10) GN=obg PE=3 SV=1 278 477 9.0E-27
sp|Q3APF4|OBG_CHLCH GTPase Obg OS=Chlorobium chlorochromatii (strain CaD3) GN=obg PE=3 SV=1 258 455 9.0E-27
sp|B3PIU9|OBG_CELJU GTPase Obg OS=Cellvibrio japonicus (strain Ueda107) GN=obg PE=3 SV=1 309 485 9.0E-27
sp|B3QZT1|OBG_PHYMT GTPase Obg OS=Phytoplasma mali (strain AT) GN=obg PE=3 SV=1 328 478 9.0E-27
sp|Q8CNZ7|OBG_STAES GTPase Obg OS=Staphylococcus epidermidis (strain ATCC 12228) GN=obg PE=3 SV=1 319 605 1.0E-26
sp|Q5HNQ7|OBG_STAEQ GTPase Obg OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=obg PE=3 SV=1 319 605 1.0E-26
sp|Q7VK84|OBG_HELHP GTPase Obg OS=Helicobacter hepaticus (strain ATCC 51449 / 3B1) GN=obg PE=3 SV=1 318 475 1.0E-26
sp|B1JF57|OBG_PSEPW GTPase Obg OS=Pseudomonas putida (strain W619) GN=obg PE=3 SV=1 295 458 1.0E-26
sp|B8D7S4|OBG_BUCAT GTPase Obg OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7) GN=obg PE=3 SV=1 295 457 1.0E-26
sp|P57469|OBG_BUCAI GTPase Obg OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=obg PE=3 SV=1 295 457 1.0E-26
sp|B8D9H2|OBG_BUCA5 GTPase Obg OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A) GN=obg PE=3 SV=1 295 457 1.0E-26
sp|A1TYY4|OBG_MARHV GTPase Obg OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=obg PE=3 SV=1 309 458 1.0E-26
sp|Q5SHE9|OBG_THET8 GTPase Obg OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=obg PE=1 SV=1 278 476 1.0E-26
sp|Q2S3C0|OBG_SALRD GTPase Obg OS=Salinibacter ruber (strain DSM 13855 / M31) GN=obg PE=3 SV=1 309 473 1.0E-26
sp|Q0AWJ4|OBG_SYNWW GTPase Obg OS=Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen) GN=obg PE=3 SV=1 319 604 1.0E-26
sp|Q8XVL0|OBG_RALSO GTPase Obg OS=Ralstonia solanacearum (strain GMI1000) GN=obg PE=3 SV=1 307 458 1.0E-26
sp|Q7A0Q3|OBG_STAAW GTPase Obg OS=Staphylococcus aureus (strain MW2) GN=obg PE=3 SV=1 319 482 1.0E-26
sp|A8Z2H2|OBG_STAAT GTPase Obg OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=obg PE=3 SV=1 319 482 1.0E-26
sp|Q6G8S5|OBG_STAAS GTPase Obg OS=Staphylococcus aureus (strain MSSA476) GN=obg PE=3 SV=1 319 482 1.0E-26
sp|Q7A584|OBG_STAAN GTPase Obg OS=Staphylococcus aureus (strain N315) GN=obg PE=1 SV=1 319 482 1.0E-26
sp|Q99TK9|OBG_STAAM GTPase Obg OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=obg PE=3 SV=1 319 482 1.0E-26
sp|A6QHI6|OBG_STAAE GTPase Obg OS=Staphylococcus aureus (strain Newman) GN=obg PE=3 SV=1 319 482 1.0E-26
sp|A5ITG8|OBG_STAA9 GTPase Obg OS=Staphylococcus aureus (strain JH9) GN=obg PE=3 SV=1 319 482 1.0E-26
sp|Q2FXT1|OBG_STAA8 GTPase Obg OS=Staphylococcus aureus (strain NCTC 8325) GN=obg PE=3 SV=1 319 482 1.0E-26
sp|Q2FG83|OBG_STAA3 GTPase Obg OS=Staphylococcus aureus (strain USA300) GN=obg PE=3 SV=1 319 482 1.0E-26
sp|A6U2B2|OBG_STAA2 GTPase Obg OS=Staphylococcus aureus (strain JH1) GN=obg PE=3 SV=1 319 482 1.0E-26
sp|A7X361|OBG_STAA1 GTPase Obg OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=obg PE=3 SV=1 319 482 1.0E-26
sp|Q6GG60|OBG_STAAR GTPase Obg OS=Staphylococcus aureus (strain MRSA252) GN=obg PE=3 SV=1 319 482 1.0E-26
sp|Q5HFB9|OBG_STAAC GTPase Obg OS=Staphylococcus aureus (strain COL) GN=obg PE=3 SV=1 319 482 1.0E-26
sp|Q2JS78|OBG_SYNJA GTPase Obg OS=Synechococcus sp. (strain JA-3-3Ab) GN=obg PE=3 SV=1 298 483 1.0E-26
sp|Q1QQU0|OBG_NITHX GTPase Obg OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=obg PE=3 SV=1 307 477 1.0E-26
sp|A5WFV1|OBG_PSYWF GTPase Obg OS=Psychrobacter sp. (strain PRwf-1) GN=obg PE=3 SV=1 280 457 1.0E-26
sp|Q605N2|OBG_METCA GTPase Obg OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=obg PE=3 SV=1 288 457 1.0E-26
sp|Q1IF13|OBG_PSEE4 GTPase Obg OS=Pseudomonas entomophila (strain L48) GN=obg PE=3 SV=1 295 458 2.0E-26
sp|B9LC30|OBG_CHLSY GTPase Obg OS=Chloroflexus aurantiacus (strain ATCC 29364 / DSM 637 / Y-400-fl) GN=obg PE=3 SV=1 319 456 2.0E-26
sp|A9WK62|OBG_CHLAA GTPase Obg OS=Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl) GN=obg PE=3 SV=1 319 456 2.0E-26
sp|A8FJQ1|OBG_CAMJ8 GTPase Obg OS=Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828) GN=obg PE=3 SV=1 295 456 2.0E-26
sp|A6W352|OBG_MARMS GTPase Obg OS=Marinomonas sp. (strain MWYL1) GN=obg PE=3 SV=1 309 469 2.0E-26
sp|Q2YT86|OBG_STAAB GTPase Obg OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=obg PE=3 SV=1 319 482 2.0E-26
sp|Q3J6S0|OBG_NITOC GTPase Obg OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=obg PE=3 SV=1 298 605 2.0E-26
sp|Q88Q08|OBG_PSEPK GTPase Obg OS=Pseudomonas putida (strain KT2440) GN=obg PE=3 SV=1 295 458 2.0E-26
sp|A5VYC6|OBG_PSEP1 GTPase Obg OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=obg PE=3 SV=1 295 458 2.0E-26
sp|B5ZUE3|OBG_RHILW GTPase Obg OS=Rhizobium leguminosarum bv. trifolii (strain WSM2304) GN=obg PE=3 SV=1 280 483 2.0E-26
sp|A7H1H0|OBG_CAMJD GTPase Obg OS=Campylobacter jejuni subsp. doylei (strain ATCC BAA-1458 / RM4099 / 269.97) GN=obg PE=3 SV=1 295 456 2.0E-26
sp|A4VI54|OBG_PSEU5 GTPase Obg OS=Pseudomonas stutzeri (strain A1501) GN=obg PE=3 SV=1 295 458 2.0E-26
sp|Q2NW34|OBG_SODGM GTPase Obg OS=Sodalis glossinidius (strain morsitans) GN=obg PE=3 SV=1 275 458 2.0E-26
sp|A8HS51|OBG_AZOC5 GTPase Obg OS=Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571) GN=obg PE=3 SV=1 278 477 2.0E-26
sp|B0KMF6|OBG_PSEPG GTPase Obg OS=Pseudomonas putida (strain GB-1) GN=obg PE=3 SV=1 295 458 2.0E-26
sp|Q2S9T3|OBG_HAHCH GTPase Obg OS=Hahella chejuensis (strain KCTC 2396) GN=obg PE=3 SV=1 309 458 3.0E-26
sp|B7GNK1|OBG_BIFLS GTPase Obg OS=Bifidobacterium longum subsp. infantis (strain ATCC 15697 / DSM 20088 / JCM 1222 / NCTC 11817 / S12) GN=obg PE=3 SV=1 308 477 3.0E-26
sp|Q8G4U0|OBG_BIFLO GTPase Obg OS=Bifidobacterium longum (strain NCC 2705) GN=obg PE=3 SV=1 308 477 3.0E-26
sp|Q72HR4|OBG_THET2 GTPase Obg OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=obg PE=3 SV=1 278 476 3.0E-26
sp|Q5HX70|OBG_CAMJR GTPase Obg OS=Campylobacter jejuni (strain RM1221) GN=obg PE=3 SV=1 295 456 3.0E-26
sp|B8F871|OBG_HAEPS GTPase Obg OS=Haemophilus parasuis serovar 5 (strain SH0165) GN=obg PE=3 SV=1 280 483 3.0E-26
sp|C0QX49|OBG_BRAHW GTPase Obg OS=Brachyspira hyodysenteriae (strain ATCC 49526 / WA1) GN=obg PE=3 SV=1 319 478 3.0E-26
sp|Q3K6K9|OBG_PSEPF GTPase Obg OS=Pseudomonas fluorescens (strain Pf0-1) GN=obg PE=3 SV=1 278 458 3.0E-26
sp|Q1IVS5|OBG_KORVE GTPase Obg OS=Koribacter versatilis (strain Ellin345) GN=obg PE=3 SV=1 319 476 4.0E-26
sp|A3PAT7|OBG_PROM0 GTPase Obg OS=Prochlorococcus marinus (strain MIT 9301) GN=obg PE=3 SV=1 295 485 4.0E-26
sp|A1VK90|OBG_POLNA GTPase Obg OS=Polaromonas naphthalenivorans (strain CJ2) GN=obg PE=3 SV=1 295 458 4.0E-26
sp|B8GA36|OBG_CHLAD GTPase Obg OS=Chloroflexus aggregans (strain MD-66 / DSM 9485) GN=obg PE=3 SV=1 319 456 4.0E-26
sp|B1H0I4|OBG_UNCTG GTPase Obg OS=Uncultured termite group 1 bacterium phylotype Rs-D17 GN=obg PE=3 SV=1 308 459 5.0E-26
sp|Q8K013|GTPBA_MOUSE GTP-binding protein 10 OS=Mus musculus GN=Gtpbp10 PE=2 SV=1 308 521 6.0E-26
sp|A9IMA6|OBG_BART1 GTPase Obg OS=Bartonella tribocorum (strain CIP 105476 / IBS 506) GN=obg PE=3 SV=1 278 483 6.0E-26
sp|B8IEL9|OBG_METNO GTPase Obg OS=Methylobacterium nodulans (strain ORS2060 / LMG 21967) GN=obg PE=3 SV=1 296 478 6.0E-26
sp|B3DPS4|OBG_BIFLD GTPase Obg OS=Bifidobacterium longum (strain DJO10A) GN=obg PE=3 SV=1 308 477 6.0E-26
sp|A7IH06|OBG_XANP2 GTPase Obg OS=Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2) GN=obg PE=3 SV=1 278 477 6.0E-26
sp|A2BP15|OBG_PROMS GTPase Obg OS=Prochlorococcus marinus (strain AS9601) GN=obg PE=3 SV=1 309 485 6.0E-26
sp|Q98EZ3|OBG_RHILO GTPase Obg OS=Rhizobium loti (strain MAFF303099) GN=obg PE=3 SV=1 251 478 6.0E-26
sp|A2SD36|OBG_METPP GTPase Obg OS=Methylibium petroleiphilum (strain PM1) GN=obg PE=3 SV=1 296 458 7.0E-26
sp|A5IYU8|OBG_MYCAP GTPase Obg OS=Mycoplasma agalactiae (strain PG2) GN=obg PE=3 SV=1 264 478 7.0E-26
sp|A1VXH9|OBG_CAMJJ GTPase Obg OS=Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176) GN=obg PE=3 SV=1 295 456 8.0E-26
sp|Q12F99|OBG_POLSJ GTPase Obg OS=Polaromonas sp. (strain JS666 / ATCC BAA-500) GN=obg PE=3 SV=1 295 458 8.0E-26
sp|B6IQZ9|OBG_RHOCS GTPase Obg OS=Rhodospirillum centenum (strain ATCC 51521 / SW) GN=obg PE=3 SV=1 267 477 8.0E-26
sp|Q0PC41|OBG_CAMJE GTPase Obg OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=obg PE=3 SV=1 295 456 8.0E-26
sp|Q3MHG6|GTPBA_BOVIN GTP-binding protein 10 OS=Bos taurus GN=GTPBP10 PE=2 SV=1 307 595 8.0E-26
sp|B3ER55|OBG_AMOA5 GTPase Obg OS=Amoebophilus asiaticus (strain 5a2) GN=obg PE=3 SV=1 295 478 9.0E-26
sp|B8CSY3|OBG_SHEPW GTPase Obg OS=Shewanella piezotolerans (strain WP3 / JCM 13877) GN=obg PE=3 SV=1 305 457 9.0E-26
sp|A6WDM9|OBG_KINRD GTPase Obg OS=Kineococcus radiotolerans (strain ATCC BAA-149 / DSM 14245 / SRS30216) GN=obg PE=3 SV=1 295 476 9.0E-26
sp|B0UMS4|OBG_METS4 GTPase Obg OS=Methylobacterium sp. (strain 4-46) GN=obg PE=3 SV=1 278 483 1.0E-25
sp|B9DNE7|OBG_STACT GTPase Obg OS=Staphylococcus carnosus (strain TM300) GN=obg PE=3 SV=1 288 482 1.0E-25
sp|A9VYM4|OBG_METEP GTPase Obg OS=Methylobacterium extorquens (strain PA1) GN=obg PE=3 SV=1 309 483 1.0E-25
sp|B7KSH0|OBG_METC4 GTPase Obg OS=Methylobacterium extorquens (strain CM4 / NCIMB 13688) GN=obg PE=3 SV=1 309 483 1.0E-25
sp|B1N057|OBG_LEUCK GTPase Obg OS=Leuconostoc citreum (strain KM20) GN=obg PE=3 SV=2 319 603 1.0E-25
sp|B1ZL15|OBG_METPB GTPase Obg OS=Methylobacterium populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001) GN=obg PE=3 SV=1 309 483 1.0E-25
sp|B1XN32|OBG_SYNP2 GTPase Obg OS=Synechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6) GN=obg PE=3 SV=1 321 478 1.0E-25
sp|Q0I1P5|OBG_HAES1 GTPase Obg OS=Haemophilus somnus (strain 129Pt) GN=obg PE=3 SV=1 280 458 1.0E-25
sp|B0UVI2|OBG_HISS2 GTPase Obg OS=Histophilus somni (strain 2336) GN=obg PE=3 SV=1 280 458 1.0E-25
sp|B2VGT5|OBG_ERWT9 GTPase Obg OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=obg PE=3 SV=1 280 458 1.0E-25
sp|A6L100|OBG_BACV8 GTPase Obg OS=Bacteroides vulgatus (strain ATCC 8482 / DSM 1447 / NCTC 11154) GN=obg PE=3 SV=1 319 485 1.0E-25
sp|Q5R039|OBG_IDILO GTPase Obg OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=obg PE=3 SV=1 307 458 1.0E-25
sp|Q6F0U3|OBG_MESFL GTPase Obg OS=Mesoplasma florum (strain ATCC 33453 / NBRC 100688 / NCTC 11704 / L1) GN=obg PE=3 SV=1 275 464 1.0E-25
sp|Q31CW3|OBG_PROM9 GTPase Obg OS=Prochlorococcus marinus (strain MIT 9312) GN=obg PE=3 SV=1 309 485 1.0E-25
sp|B5E958|OBG_GEOBB GTPase Obg OS=Geobacter bemidjiensis (strain Bem / ATCC BAA-1014 / DSM 16622) GN=obg PE=3 SV=1 295 476 1.0E-25
sp|A4D1E9|GTPBA_HUMAN GTP-binding protein 10 OS=Homo sapiens GN=GTPBP10 PE=1 SV=1 307 595 2.0E-25
sp|Q6A9H8|OBG_PROAC GTPase Obg OS=Propionibacterium acnes (strain KPA171202 / DSM 16379) GN=obg PE=3 SV=1 307 458 2.0E-25
sp|Q6MGS5|OBG_BDEBA GTPase Obg OS=Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100) GN=obg PE=3 SV=2 319 484 2.0E-25
sp|Q15PF0|OBG_PSEA6 GTPase Obg OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=obg PE=3 SV=1 310 457 2.0E-25
sp|Q3SVI2|OBG_NITWN GTPase Obg OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=obg PE=3 SV=1 275 477 2.0E-25
sp|Q4K5T8|OBG_PSEF5 GTPase Obg OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=obg PE=3 SV=1 295 458 2.0E-25
sp|B2V968|OBG_SULSY GTPase Obg OS=Sulfurihydrogenibium sp. (strain YO3AOP1) GN=obg PE=3 SV=1 295 557 2.0E-25
sp|A8G2M6|OBG_PROM2 GTPase Obg OS=Prochlorococcus marinus (strain MIT 9215) GN=obg PE=3 SV=1 309 485 2.0E-25
sp|Q6G0S8|OBG_BARQU GTPase Obg OS=Bartonella quintana (strain Toulouse) GN=obg PE=3 SV=1 278 483 2.0E-25
sp|Q6G4Z2|OBG_BARHE GTPase Obg OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=obg PE=3 SV=1 251 483 2.0E-25
sp|Q21YZ9|OBG_RHOFT GTPase Obg OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) GN=obg PE=3 SV=1 295 458 2.0E-25
sp|B2KAW2|OBG_ELUMP GTPase Obg OS=Elusimicrobium minutum (strain Pei191) GN=obg PE=3 SV=1 295 476 2.0E-25
sp|A1TTD3|OBG_ACIAC GTPase Obg OS=Acidovorax citrulli (strain AAC00-1) GN=obg PE=3 SV=1 295 458 2.0E-25
sp|Q8DYL0|OBG_STRA5 GTPase Obg OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=obg PE=3 SV=1 295 603 2.0E-25
sp|Q8E465|OBG_STRA3 GTPase Obg OS=Streptococcus agalactiae serotype III (strain NEM316) GN=obg PE=3 SV=1 295 603 2.0E-25
sp|Q3K046|OBG_STRA1 GTPase Obg OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=obg PE=3 SV=1 295 603 2.0E-25
sp|Q83ED8|OBG_COXBU GTPase Obg OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=obg PE=3 SV=1 307 485 2.0E-25
sp|A9KEJ7|OBG_COXBN GTPase Obg OS=Coxiella burnetii (strain Dugway 5J108-111) GN=obg PE=3 SV=1 307 485 2.0E-25
sp|B6J1S8|OBG_COXB2 GTPase Obg OS=Coxiella burnetii (strain CbuG_Q212) GN=obg PE=3 SV=1 307 485 2.0E-25
sp|B8ZPS8|OBG_STRPJ GTPase Obg OS=Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1) GN=obg PE=3 SV=1 305 604 2.0E-25
sp|Q5FUL2|OBG_GLUOX GTPase Obg OS=Gluconobacter oxydans (strain 621H) GN=obg PE=3 SV=2 305 476 3.0E-25
sp|A9BP68|OBG_DELAS GTPase Obg OS=Delftia acidovorans (strain DSM 14801 / SPH-1) GN=obg PE=3 SV=1 309 458 3.0E-25
sp|Q6AFY1|OBG_LEIXX GTPase Obg OS=Leifsonia xyli subsp. xyli (strain CTCB07) GN=obg PE=3 SV=1 298 476 3.0E-25
sp|Q2RKZ8|OBG_MOOTA GTPase Obg OS=Moorella thermoacetica (strain ATCC 39073) GN=obg PE=3 SV=1 322 458 3.0E-25
sp|B6J9K2|OBG_COXB1 GTPase Obg OS=Coxiella burnetii (strain CbuK_Q154) GN=obg PE=3 SV=1 307 485 3.0E-25
sp|Q6YRC6|OBG_ONYPE GTPase Obg OS=Onion yellows phytoplasma (strain OY-M) GN=obg PE=3 SV=1 330 476 3.0E-25
sp|A6LD68|OBG_PARD8 GTPase Obg OS=Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / NCTC 11152) GN=obg PE=3 SV=1 319 476 3.0E-25
sp|Q8K9G1|OBG_BUCAP GTPase Obg OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=obg PE=3 SV=1 295 476 3.0E-25
sp|Q7NB30|OBG_MYCGA GTPase Obg OS=Mycoplasma gallisepticum (strain R(low / passage 15 / clone 2)) GN=obg PE=3 SV=2 266 557 3.0E-25
sp|A2BUJ6|OBG_PROM5 GTPase Obg OS=Prochlorococcus marinus (strain MIT 9515) GN=obg PE=3 SV=1 309 485 3.0E-25
sp|B4F2A8|OBG_PROMH GTPase Obg OS=Proteus mirabilis (strain HI4320) GN=obg PE=3 SV=1 295 477 3.0E-25
sp|B1Y280|OBG_LEPCP GTPase Obg OS=Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6) GN=obg PE=3 SV=1 307 458 4.0E-25
sp|Q9I7M2|GTPBA_DROME GTP-binding protein 10 homolog OS=Drosophila melanogaster GN=CG10628 PE=2 SV=2 343 457 4.0E-25
sp|Q7UVH6|OBG_RHOBA GTPase Obg OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=obg PE=3 SV=2 295 484 4.0E-25
sp|B4RZH3|OBG_ALTMD GTPase Obg OS=Alteromonas macleodii (strain DSM 17117 / Deep ecotype) GN=obg1 PE=3 SV=1 309 457 4.0E-25
sp|B9MDZ7|OBG_ACIET GTPase Obg OS=Acidovorax ebreus (strain TPSY) GN=obg PE=3 SV=1 295 458 4.0E-25
sp|A4VUC8|OBG_STRSY GTPase Obg OS=Streptococcus suis (strain 05ZYH33) GN=obg PE=3 SV=1 295 604 4.0E-25
sp|Q2NIK0|OBG_AYWBP GTPase Obg OS=Aster yellows witches'-broom phytoplasma (strain AYWB) GN=obg PE=3 SV=1 330 476 4.0E-25
sp|A4F9L3|OBG_SACEN GTPase Obg OS=Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338) GN=obg PE=3 SV=1 307 476 4.0E-25
sp|A4W0M2|OBG_STRS2 GTPase Obg OS=Streptococcus suis (strain 98HAH33) GN=obg PE=3 SV=1 278 604 5.0E-25
sp|A8Z631|OBG_SULMW GTPase Obg OS=Sulcia muelleri (strain GWSS) GN=obg PE=3 SV=1 319 476 5.0E-25
sp|B5XLZ0|OBG_STRPZ GTPase Obg OS=Streptococcus pyogenes serotype M49 (strain NZ131) GN=obg PE=3 SV=1 319 603 5.0E-25
sp|Q834V4|OBG_ENTFA GTPase Obg OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=obg PE=3 SV=1 319 604 5.0E-25
sp|B9K736|OBG_THENN GTPase Obg OS=Thermotoga neapolitana (strain ATCC 49049 / DSM 4359 / NS-E) GN=obg PE=3 SV=1 295 459 5.0E-25
sp|A1W4B0|OBG_ACISJ GTPase Obg OS=Acidovorax sp. (strain JS42) GN=obg PE=3 SV=2 309 458 6.0E-25
sp|B2A6B7|OBG_NATTJ GTPase Obg OS=Natranaerobius thermophilus (strain ATCC BAA-1301 / DSM 18059 / JW/NM-WN-LF) GN=obg PE=3 SV=1 319 459 6.0E-25
sp|A1WY48|OBG_HALHL GTPase Obg OS=Halorhodospira halophila (strain DSM 244 / SL1) GN=obg PE=3 SV=1 286 456 6.0E-25
sp|B1KGH1|OBG_SHEWM GTPase Obg OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=obg PE=3 SV=1 307 457 6.0E-25
sp|A5FMX0|OBG_FLAJ1 GTPase Obg OS=Flavobacterium johnsoniae (strain ATCC 17061 / DSM 2064 / UW101) GN=obg PE=3 SV=1 319 485 7.0E-25
sp|Q5KWP5|OBG_GEOKA GTPase Obg OS=Geobacillus kaustophilus (strain HTA426) GN=obg PE=3 SV=1 267 459 7.0E-25
sp|Q1R0C0|OBG_CHRSD GTPase Obg OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=obg PE=3 SV=1 295 458 7.0E-25
sp|Q1AVU3|OBG_RUBXD GTPase Obg OS=Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129) GN=obg PE=3 SV=1 295 458 7.0E-25
sp|Q747Q2|OBG_GEOSL GTPase Obg OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=obg PE=3 SV=1 291 483 7.0E-25
sp|Q7V368|OBG_PROMP GTPase Obg OS=Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4) GN=obg PE=3 SV=1 295 485 8.0E-25
sp|A3QB95|OBG_SHELP GTPase Obg OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=obg PE=3 SV=1 305 458 8.0E-25
sp|B2SEA8|OBG_FRATM GTPase Obg OS=Francisella tularensis subsp. mediasiatica (strain FSC147) GN=obg PE=3 SV=1 305 485 8.0E-25
sp|A1WPR5|OBG_VEREI GTPase Obg OS=Verminephrobacter eiseniae (strain EF01-2) GN=obg PE=3 SV=1 288 459 8.0E-25
sp|Q5NR23|OBG_ZYMMO GTPase Obg OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=obg PE=3 SV=1 275 477 8.0E-25
sp|Q5NEB0|OBG_FRATT GTPase Obg OS=Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4) GN=obg PE=3 SV=1 305 485 8.0E-25
sp|A0Q8K2|OBG_FRATN GTPase Obg OS=Francisella tularensis subsp. novicida (strain U112) GN=obg PE=3 SV=1 305 485 8.0E-25
sp|Q14FR3|OBG_FRAT1 GTPase Obg OS=Francisella tularensis subsp. tularensis (strain FSC 198) GN=obg PE=3 SV=1 305 485 8.0E-25
sp|Q3BW46|OBG_XANC5 GTPase Obg OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=obg PE=3 SV=1 307 558 9.0E-25
sp|A4IVW3|OBG_FRATW GTPase Obg OS=Francisella tularensis subsp. tularensis (strain WY96-3418) GN=obg PE=3 SV=1 305 485 9.0E-25
sp|A6VMU1|OBG_ACTSZ GTPase Obg OS=Actinobacillus succinogenes (strain ATCC 55618 / 130Z) GN=obg PE=3 SV=1 280 485 9.0E-25
sp|Q3SKG2|OBG_THIDA GTPase Obg OS=Thiobacillus denitrificans (strain ATCC 25259) GN=obg PE=3 SV=1 319 485 9.0E-25
sp|Q8PN23|OBG_XANAC GTPase Obg OS=Xanthomonas axonopodis pv. citri (strain 306) GN=obg PE=3 SV=1 295 558 9.0E-25
sp|B6YRA6|OBG_AZOPC GTPase Obg OS=Azobacteroides pseudotrichonymphae genomovar. CFP2 GN=obg PE=3 SV=1 344 476 1.0E-24
sp|Q057J0|OBG_BUCCC GTPase Obg OS=Buchnera aphidicola subsp. Cinara cedri (strain Cc) GN=obg PE=3 SV=1 305 458 1.0E-24
sp|A9FJF8|OBG_SORC5 GTPase Obg OS=Sorangium cellulosum (strain So ce56) GN=obg PE=3 SV=1 308 562 1.0E-24
sp|A9NBL5|OBG_COXBR GTPase Obg OS=Coxiella burnetii (strain RSA 331 / Henzerling II) GN=obg PE=3 SV=1 307 485 1.0E-24
sp|Q0BK24|OBG_FRATO GTPase Obg OS=Francisella tularensis subsp. holarctica (strain OSU18) GN=obg PE=3 SV=1 305 485 1.0E-24
sp|Q2A1B4|OBG_FRATH GTPase Obg OS=Francisella tularensis subsp. holarctica (strain LVS) GN=obg PE=3 SV=1 305 485 1.0E-24
sp|A7NEQ3|OBG_FRATF GTPase Obg OS=Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA) GN=obg PE=3 SV=1 305 485 1.0E-24
sp|A4IRC7|OBG_GEOTN GTPase Obg OS=Geobacillus thermodenitrificans (strain NG80-2) GN=obg PE=3 SV=1 267 459 1.0E-24
sp|Q8DPV8|OBG_STRR6 GTPase Obg OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=obg PE=3 SV=1 305 604 1.0E-24
sp|Q04KK7|OBG_STRP2 GTPase Obg OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=obg PE=3 SV=1 305 604 1.0E-24
sp|B2IQ29|OBG_STRPS GTPase Obg OS=Streptococcus pneumoniae (strain CGSP14) GN=obg PE=3 SV=1 305 604 1.0E-24
sp|A8AQ74|OBG_CITK8 GTPase Obg OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=obg PE=3 SV=1 280 575 1.0E-24
sp|Q5PAS5|OBG1_ANAMM GTPase Obg 1 OS=Anaplasma marginale (strain St. Maries) GN=obg1 PE=3 SV=1 273 478 1.0E-24
sp|C0MDB4|OBG_STRS7 GTPase Obg OS=Streptococcus equi subsp. zooepidemicus (strain H70) GN=obg PE=3 SV=1 305 599 1.0E-24
sp|Q1JGD5|OBG_STRPD GTPase Obg OS=Streptococcus pyogenes serotype M2 (strain MGAS10270) GN=obg PE=3 SV=1 319 603 1.0E-24
sp|B3QVU6|OBG_CHLT3 GTPase Obg OS=Chloroherpeton thalassium (strain ATCC 35110 / GB-78) GN=obg PE=3 SV=1 70 174 1.0E-15
sp|B2V968|OBG_SULSY GTPase Obg OS=Sulfurihydrogenibium sp. (strain YO3AOP1) GN=obg PE=3 SV=1 70 178 1.0E-14
sp|A1BJ56|OBG_CHLPD GTPase Obg OS=Chlorobium phaeobacteroides (strain DSM 266) GN=obg PE=3 SV=1 70 182 7.0E-14
sp|Q5ZS70|OBG_LEGPH GTPase Obg OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=obg PE=3 SV=2 70 177 9.0E-14
sp|A1TYY4|OBG_MARHV GTPase Obg OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=obg PE=3 SV=1 70 177 9.0E-14
sp|Q1LSJ9|OBG_BAUCH GTPase Obg OS=Baumannia cicadellinicola subsp. Homalodisca coagulata GN=obg PE=3 SV=1 70 163 2.0E-13
sp|Q5WTF1|OBG_LEGPL GTPase Obg OS=Legionella pneumophila (strain Lens) GN=obg PE=3 SV=1 70 177 3.0E-13
sp|Q5X1P1|OBG_LEGPA GTPase Obg OS=Legionella pneumophila (strain Paris) GN=obg PE=3 SV=1 70 177 3.0E-13
sp|B2VGT5|OBG_ERWT9 GTPase Obg OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=obg PE=3 SV=1 70 163 3.0E-13
sp|A5IAS7|OBG_LEGPC GTPase Obg OS=Legionella pneumophila (strain Corby) GN=obg PE=3 SV=1 70 177 4.0E-13
sp|B0VTQ1|OBG_ACIBS GTPase Obg OS=Acinetobacter baumannii (strain SDF) GN=obg PE=3 SV=1 70 174 5.0E-13
sp|Q6F9D8|OBG_ACIAD GTPase Obg OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=obg PE=3 SV=1 70 178 7.0E-13
sp|B2FTD3|OBG_STRMK GTPase Obg OS=Stenotrophomonas maltophilia (strain K279a) GN=obg PE=3 SV=1 70 177 7.0E-13
sp|B0VCR5|OBG_ACIBY GTPase Obg OS=Acinetobacter baumannii (strain AYE) GN=obg PE=3 SV=1 70 174 8.0E-13
sp|A3M7M2|OBG_ACIBT GTPase Obg OS=Acinetobacter baumannii (strain ATCC 17978 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377) GN=obg PE=3 SV=2 70 174 8.0E-13
sp|B2HWM9|OBG_ACIBC GTPase Obg OS=Acinetobacter baumannii (strain ACICU) GN=obg PE=3 SV=1 70 174 8.0E-13
sp|B7I557|OBG_ACIB5 GTPase Obg OS=Acinetobacter baumannii (strain AB0057) GN=obg PE=3 SV=1 70 174 8.0E-13
sp|B7GYV1|OBG_ACIB3 GTPase Obg OS=Acinetobacter baumannii (strain AB307-0294) GN=obg PE=3 SV=1 70 174 8.0E-13
sp|B4F2A8|OBG_PROMH GTPase Obg OS=Proteus mirabilis (strain HI4320) GN=obg PE=3 SV=1 70 176 8.0E-13
sp|B4SP14|OBG_STRM5 GTPase Obg OS=Stenotrophomonas maltophilia (strain R551-3) GN=obg PE=3 SV=1 70 177 9.0E-13
sp|Q1MQQ1|OBG_LAWIP GTPase Obg OS=Lawsonia intracellularis (strain PHE/MN1-00) GN=obg PE=3 SV=1 70 165 1.0E-12
sp|Q8PN23|OBG_XANAC GTPase Obg OS=Xanthomonas axonopodis pv. citri (strain 306) GN=obg PE=3 SV=1 70 177 1.0E-12
sp|B3EP74|OBG_CHLPB GTPase Obg OS=Chlorobium phaeobacteroides (strain BS1) GN=obg PE=3 SV=1 70 181 2.0E-12
sp|Q605N2|OBG_METCA GTPase Obg OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=obg PE=3 SV=1 70 163 2.0E-12
sp|Q3J6S0|OBG_NITOC GTPase Obg OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=obg PE=3 SV=1 70 161 2.0E-12
sp|Q2NW34|OBG_SODGM GTPase Obg OS=Sodalis glossinidius (strain morsitans) GN=obg PE=3 SV=1 70 163 2.0E-12
sp|B8E0B2|OBG_DICTD GTPase Obg OS=Dictyoglomus turgidum (strain Z-1310 / DSM 6724) GN=obg PE=3 SV=1 70 174 3.0E-12
sp|B4S5P1|OBG_PROA2 GTPase Obg OS=Prosthecochloris aestuarii (strain DSM 271 / SK 413) GN=obg PE=3 SV=1 70 164 3.0E-12
sp|Q8KAF0|OBG_CHLTE GTPase Obg OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=obg PE=3 SV=1 70 186 3.0E-12
sp|B8J4L3|OBG_DESDA GTPase Obg OS=Desulfovibrio desulfuricans (strain ATCC 27774 / DSM 6949) GN=obg PE=3 SV=1 70 163 4.0E-12
sp|A4SCP4|OBG_CHLPM GTPase Obg OS=Chlorobium phaeovibrioides (strain DSM 265 / 1930) GN=obg PE=3 SV=1 70 177 4.0E-12
sp|B3QRD8|OBG_CHLP8 GTPase Obg OS=Chlorobaculum parvum (strain NCIB 8327) GN=obg PE=3 SV=1 70 186 4.0E-12
sp|Q3B6H6|OBG_CHLL7 GTPase Obg OS=Chlorobium luteolum (strain DSM 273 / 2530) GN=obg PE=3 SV=1 70 176 4.0E-12
sp|B5YEQ1|OBG_DICT6 GTPase Obg OS=Dictyoglomus thermophilum (strain ATCC 35947 / DSM 3960 / H-6-12) GN=obg PE=3 SV=1 70 174 5.0E-12
sp|B4SBR3|OBG_PELPB GTPase Obg OS=Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1) GN=obg PE=3 SV=1 70 176 5.0E-12
sp|Q5R039|OBG_IDILO GTPase Obg OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=obg PE=3 SV=1 70 161 5.0E-12
sp|B1KGH1|OBG_SHEWM GTPase Obg OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=obg PE=3 SV=1 70 161 6.0E-12
sp|Q3BW46|OBG_XANC5 GTPase Obg OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=obg PE=3 SV=1 70 177 6.0E-12
sp|B8FM68|OBG_DESAA GTPase Obg OS=Desulfatibacillum alkenivorans (strain AK-01) GN=obg PE=3 SV=1 70 174 7.0E-12
sp|Q3APF4|OBG_CHLCH GTPase Obg OS=Chlorobium chlorochromatii (strain CaD3) GN=obg PE=3 SV=1 70 177 7.0E-12
sp|C1A1L5|OBG_RHOE4 GTPase Obg OS=Rhodococcus erythropolis (strain PR4 / NBRC 100887) GN=obg PE=3 SV=1 70 163 9.0E-12
sp|B3E609|OBG_GEOLS GTPase Obg OS=Geobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) GN=obg PE=3 SV=1 70 177 1.0E-11
sp|B8DRN9|OBG_DESVM GTPase Obg OS=Desulfovibrio vulgaris (strain Miyazaki F / DSM 19637) GN=obg PE=3 SV=1 70 166 2.0E-11
sp|Q83ED8|OBG_COXBU GTPase Obg OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=obg PE=3 SV=1 70 163 2.0E-11
sp|A9KEJ7|OBG_COXBN GTPase Obg OS=Coxiella burnetii (strain Dugway 5J108-111) GN=obg PE=3 SV=1 70 163 2.0E-11
sp|B6J1S8|OBG_COXB2 GTPase Obg OS=Coxiella burnetii (strain CbuG_Q212) GN=obg PE=3 SV=1 70 163 2.0E-11
sp|B6J9K2|OBG_COXB1 GTPase Obg OS=Coxiella burnetii (strain CbuK_Q154) GN=obg PE=3 SV=1 70 163 2.0E-11
sp|A9NBL5|OBG_COXBR GTPase Obg OS=Coxiella burnetii (strain RSA 331 / Henzerling II) GN=obg PE=3 SV=1 70 163 2.0E-11
sp|A1B9C8|OBG_PARDP GTPase Obg OS=Paracoccus denitrificans (strain Pd 1222) GN=obg PE=3 SV=1 70 177 3.0E-11
sp|Q87BL2|OBG_XYLFT GTPase Obg OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=obg PE=3 SV=1 70 174 3.0E-11
sp|B2I6V6|OBG_XYLF2 GTPase Obg OS=Xylella fastidiosa (strain M23) GN=obg PE=3 SV=1 70 174 3.0E-11
sp|B0U3R3|OBG_XYLFM GTPase Obg OS=Xylella fastidiosa (strain M12) GN=obg PE=3 SV=1 70 174 3.0E-11
sp|A7IH06|OBG_XANP2 GTPase Obg OS=Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2) GN=obg PE=3 SV=1 70 177 3.0E-11
sp|Q1R0C0|OBG_CHRSD GTPase Obg OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=obg PE=3 SV=1 70 177 3.0E-11
sp|A1VF56|OBG_DESVV GTPase Obg OS=Desulfovibrio vulgaris subsp. vulgaris (strain DP4) GN=obg PE=3 SV=1 70 166 4.0E-11
sp|Q72DK0|OBG_DESVH GTPase Obg OS=Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) GN=obg PE=3 SV=1 70 166 4.0E-11
sp|Q9PAS3|OBG_XYLFA GTPase Obg OS=Xylella fastidiosa (strain 9a5c) GN=obg PE=3 SV=2 70 174 4.0E-11
sp|A6WXS0|OBG_OCHA4 GTPase Obg OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=obg PE=3 SV=1 70 186 4.0E-11
sp|Q11CP6|OBG_CHESB GTPase Obg OS=Chelativorans sp. (strain BNC1) GN=obg PE=3 SV=1 70 179 4.0E-11
sp|B2KAW2|OBG_ELUMP GTPase Obg OS=Elusimicrobium minutum (strain Pei191) GN=obg PE=3 SV=1 69 165 4.0E-11
sp|B4RZH3|OBG_ALTMD GTPase Obg OS=Alteromonas macleodii (strain DSM 17117 / Deep ecotype) GN=obg1 PE=3 SV=1 70 161 4.0E-11
sp|A8AQ74|OBG_CITK8 GTPase Obg OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=obg PE=3 SV=1 70 163 4.0E-11
sp|B8CXZ0|OBG_HALOH GTPase Obg OS=Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562) GN=obg PE=3 SV=1 70 182 8.0E-11
sp|Q9WXV3|OBG_THEMA GTPase Obg OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=obg PE=3 SV=1 70 165 8.0E-11
sp|B5ZBV6|OBG_UREU1 GTPase Obg OS=Ureaplasma urealyticum serovar 10 (strain ATCC 33699 / Western) GN=obg PE=3 SV=1 69 174 8.0E-11
sp|B1H0I4|OBG_UNCTG GTPase Obg OS=Uncultured termite group 1 bacterium phylotype Rs-D17 GN=obg PE=3 SV=1 70 163 9.0E-11
sp|B9K736|OBG_THENN GTPase Obg OS=Thermotoga neapolitana (strain ATCC 49049 / DSM 4359 / NS-E) GN=obg PE=3 SV=1 64 165 9.0E-11
sp|Q8FYM2|OBG_BRUSU GTPase Obg OS=Brucella suis biovar 1 (strain 1330) GN=obg PE=3 SV=1 70 186 1.0E-10
sp|A9WWW9|OBG_BRUSI GTPase Obg OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=obg PE=3 SV=1 70 186 1.0E-10
sp|A5VSI5|OBG_BRUO2 GTPase Obg OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=obg PE=3 SV=2 70 186 1.0E-10
sp|Q8YJ80|OBG_BRUME GTPase Obg OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=obg PE=3 SV=2 70 186 1.0E-10
sp|A9M882|OBG_BRUC2 GTPase Obg OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=obg PE=3 SV=1 70 186 1.0E-10
sp|Q57B45|OBG_BRUAB GTPase Obg OS=Brucella abortus biovar 1 (strain 9-941) GN=obg PE=3 SV=1 70 186 1.0E-10
sp|Q2YLM2|OBG_BRUA2 GTPase Obg OS=Brucella abortus (strain 2308) GN=obg PE=3 SV=1 70 186 1.0E-10
sp|B2S806|OBG_BRUA1 GTPase Obg OS=Brucella abortus (strain S19) GN=obg PE=3 SV=1 70 186 1.0E-10
sp|Q13DL7|OBG_RHOPS GTPase Obg OS=Rhodopseudomonas palustris (strain BisB5) GN=obg PE=3 SV=1 70 163 1.0E-10
sp|Q9PQ29|OBG_UREPA GTPase Obg OS=Ureaplasma parvum serovar 3 (strain ATCC 700970) GN=obg PE=3 SV=1 69 175 1.0E-10
sp|B1AJA2|OBG_UREP2 GTPase Obg OS=Ureaplasma parvum serovar 3 (strain ATCC 27815 / 27 / NCTC 11736) GN=obg PE=3 SV=1 69 175 1.0E-10
sp|Q39QR4|OBG_GEOMG GTPase Obg OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=obg PE=3 SV=1 70 177 1.0E-10
sp|B8D7S4|OBG_BUCAT GTPase Obg OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7) GN=obg PE=3 SV=1 70 177 1.0E-10
sp|P57469|OBG_BUCAI GTPase Obg OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=obg PE=3 SV=1 70 177 1.0E-10
sp|B8D9H2|OBG_BUCA5 GTPase Obg OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A) GN=obg PE=3 SV=1 70 177 1.0E-10
sp|B8CSY3|OBG_SHEPW GTPase Obg OS=Shewanella piezotolerans (strain WP3 / JCM 13877) GN=obg PE=3 SV=1 70 161 1.0E-10
sp|Q3SKG2|OBG_THIDA GTPase Obg OS=Thiobacillus denitrificans (strain ATCC 25259) GN=obg PE=3 SV=1 70 174 1.0E-10
sp|B1LA53|OBG_THESQ GTPase Obg OS=Thermotoga sp. (strain RQ2) GN=obg PE=3 SV=1 70 165 2.0E-10
sp|A5IKX2|OBG_THEP1 GTPase Obg OS=Thermotoga petrophila (strain RKU-1 / ATCC BAA-488 / DSM 13995) GN=obg PE=3 SV=1 70 165 2.0E-10
sp|A5D410|OBG_PELTS GTPase Obg OS=Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI) GN=obg PE=3 SV=1 70 165 2.0E-10
sp|A8F478|OBG_PSELT GTPase Obg OS=Pseudothermotoga lettingae (strain ATCC BAA-301 / DSM 14385 / NBRC 107922 / TMO) GN=obg PE=3 SV=1 70 174 2.0E-10
sp|Q6NDE6|OBG_RHOPA GTPase Obg OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=obg PE=3 SV=1 70 177 2.0E-10
sp|B3Q731|OBG_RHOPT GTPase Obg OS=Rhodopseudomonas palustris (strain TIE-1) GN=obg PE=3 SV=1 70 177 2.0E-10
sp|Q2K2X6|OBG_RHIEC GTPase Obg OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=obg PE=3 SV=1 70 179 2.0E-10
sp|B3QZT1|OBG_PHYMT GTPase Obg OS=Phytoplasma mali (strain AT) GN=obg PE=3 SV=1 70 169 2.0E-10
sp|Q2YT86|OBG_STAAB GTPase Obg OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=obg PE=3 SV=1 70 178 2.0E-10
sp|A8HS51|OBG_AZOC5 GTPase Obg OS=Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571) GN=obg PE=3 SV=1 70 180 2.0E-10
sp|Q2S9T3|OBG_HAHCH GTPase Obg OS=Hahella chejuensis (strain KCTC 2396) GN=obg PE=3 SV=1 70 163 2.0E-10
sp|Q3K6K9|OBG_PSEPF GTPase Obg OS=Pseudomonas fluorescens (strain Pf0-1) GN=obg PE=3 SV=1 70 177 2.0E-10
sp|B2SEA8|OBG_FRATM GTPase Obg OS=Francisella tularensis subsp. mediasiatica (strain FSC147) GN=obg PE=3 SV=1 70 183 2.0E-10
sp|Q5NEB0|OBG_FRATT GTPase Obg OS=Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4) GN=obg PE=3 SV=1 70 183 2.0E-10
sp|Q14FR3|OBG_FRAT1 GTPase Obg OS=Francisella tularensis subsp. tularensis (strain FSC 198) GN=obg PE=3 SV=1 70 183 2.0E-10
sp|A1AT81|OBG_PELPD GTPase Obg OS=Pelobacter propionicus (strain DSM 2379) GN=obg PE=3 SV=1 70 174 3.0E-10
sp|Q21D04|OBG_RHOPB GTPase Obg OS=Rhodopseudomonas palustris (strain BisB18) GN=obg PE=3 SV=1 70 177 3.0E-10
sp|A7HT67|OBG_PARL1 GTPase Obg OS=Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966) GN=obg PE=3 SV=1 70 177 3.0E-10
sp|Q4JWT6|OBG_CORJK GTPase Obg OS=Corynebacterium jeikeium (strain K411) GN=obg PE=3 SV=1 68 163 3.0E-10
sp|Q0AKX2|OBG_MARMM GTPase Obg OS=Maricaulis maris (strain MCS10) GN=obg PE=3 SV=1 70 177 3.0E-10
sp|Q7A0Q3|OBG_STAAW GTPase Obg OS=Staphylococcus aureus (strain MW2) GN=obg PE=3 SV=1 70 178 3.0E-10
sp|A8Z2H2|OBG_STAAT GTPase Obg OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=obg PE=3 SV=1 70 178 3.0E-10
sp|Q6G8S5|OBG_STAAS GTPase Obg OS=Staphylococcus aureus (strain MSSA476) GN=obg PE=3 SV=1 70 178 3.0E-10
sp|Q7A584|OBG_STAAN GTPase Obg OS=Staphylococcus aureus (strain N315) GN=obg PE=1 SV=1 70 178 3.0E-10
sp|Q99TK9|OBG_STAAM GTPase Obg OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=obg PE=3 SV=1 70 178 3.0E-10
sp|A6QHI6|OBG_STAAE GTPase Obg OS=Staphylococcus aureus (strain Newman) GN=obg PE=3 SV=1 70 178 3.0E-10
sp|A5ITG8|OBG_STAA9 GTPase Obg OS=Staphylococcus aureus (strain JH9) GN=obg PE=3 SV=1 70 178 3.0E-10
sp|Q2FXT1|OBG_STAA8 GTPase Obg OS=Staphylococcus aureus (strain NCTC 8325) GN=obg PE=3 SV=1 70 178 3.0E-10
sp|Q2FG83|OBG_STAA3 GTPase Obg OS=Staphylococcus aureus (strain USA300) GN=obg PE=3 SV=1 70 178 3.0E-10
sp|A6U2B2|OBG_STAA2 GTPase Obg OS=Staphylococcus aureus (strain JH1) GN=obg PE=3 SV=1 70 178 3.0E-10
sp|A7X361|OBG_STAA1 GTPase Obg OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=obg PE=3 SV=1 70 178 3.0E-10
sp|Q6GG60|OBG_STAAR GTPase Obg OS=Staphylococcus aureus (strain MRSA252) GN=obg PE=3 SV=1 70 178 3.0E-10
sp|Q5HFB9|OBG_STAAC GTPase Obg OS=Staphylococcus aureus (strain COL) GN=obg PE=3 SV=1 70 178 3.0E-10
sp|A0Q8K2|OBG_FRATN GTPase Obg OS=Francisella tularensis subsp. novicida (strain U112) GN=obg PE=3 SV=1 70 183 3.0E-10
sp|Q0BK24|OBG_FRATO GTPase Obg OS=Francisella tularensis subsp. holarctica (strain OSU18) GN=obg PE=3 SV=1 70 183 3.0E-10
sp|Q2A1B4|OBG_FRATH GTPase Obg OS=Francisella tularensis subsp. holarctica (strain LVS) GN=obg PE=3 SV=1 70 183 3.0E-10
sp|A7NEQ3|OBG_FRATF GTPase Obg OS=Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA) GN=obg PE=3 SV=1 70 183 3.0E-10
sp|Q9UT06|YLWB_SCHPO Uncharacterized GTP-binding protein P8A3.11c, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAP8A3.11c PE=3 SV=1 56 182 4.0E-10
sp|Q4FP46|OBG_PELUB GTPase Obg OS=Pelagibacter ubique (strain HTCC1062) GN=obg PE=3 SV=1 70 165 4.0E-10
sp|B4U7P8|OBG_HYDS0 GTPase Obg OS=Hydrogenobaculum sp. (strain Y04AAS1) GN=obg PE=3 SV=1 70 174 4.0E-10
sp|B2TK70|OBG_CLOBB GTPase Obg OS=Clostridium botulinum (strain Eklund 17B / Type B) GN=obg PE=3 SV=1 70 182 4.0E-10
sp|Q1IF13|OBG_PSEE4 GTPase Obg OS=Pseudomonas entomophila (strain L48) GN=obg PE=3 SV=1 70 163 4.0E-10
sp|B8IEL9|OBG_METNO GTPase Obg OS=Methylobacterium nodulans (strain ORS2060 / LMG 21967) GN=obg PE=3 SV=1 70 177 4.0E-10
sp|A4IVW3|OBG_FRATW GTPase Obg OS=Francisella tularensis subsp. tularensis (strain WY96-3418) GN=obg PE=3 SV=1 70 183 4.0E-10
sp|B6JD21|OBG_OLICO GTPase Obg OS=Oligotropha carboxidovorans (strain ATCC 49405 / DSM 1227 / OM5) GN=obg PE=3 SV=1 70 163 5.0E-10
sp|Q89X89|OBG_BRADU GTPase Obg OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=obg PE=3 SV=1 70 177 6.0E-10
sp|Q6G4Z2|OBG_BARHE GTPase Obg OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=obg PE=3 SV=1 70 186 7.0E-10
sp|B5YJ65|OBG_THEYD GTPase Obg OS=Thermodesulfovibrio yellowstonii (strain ATCC 51303 / DSM 11347 / YP87) GN=obg PE=3 SV=1 70 179 8.0E-10
sp|A0LCZ3|OBG_MAGMM GTPase Obg OS=Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1) GN=obg PE=3 SV=1 70 165 8.0E-10
sp|Q4K5T8|OBG_PSEF5 GTPase Obg OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=obg PE=3 SV=1 70 177 8.0E-10
sp|Q1GHD0|OBG_RUEST GTPase Obg OS=Ruegeria sp. (strain TM1040) GN=obg PE=3 SV=1 70 177 9.0E-10
sp|Q31IT4|OBG_THICR GTPase Obg OS=Thiomicrospira crunogena (strain XCL-2) GN=obg PE=3 SV=1 70 174 9.0E-10
sp|Q9CNS4|OBG_PASMU GTPase Obg OS=Pasteurella multocida (strain Pm70) GN=obg PE=3 SV=1 70 161 9.0E-10
sp|A2SD36|OBG_METPP GTPase Obg OS=Methylibium petroleiphilum (strain PM1) GN=obg PE=3 SV=1 70 174 9.0E-10
sp|Q0I1P5|OBG_HAES1 GTPase Obg OS=Haemophilus somnus (strain 129Pt) GN=obg PE=3 SV=1 70 161 9.0E-10
sp|A8ZRY1|OBG_DESOH GTPase Obg OS=Desulfococcus oleovorans (strain DSM 6200 / Hxd3) GN=obg PE=3 SV=1 70 163 1.0E-09
sp|A8F063|OBG_RICCK GTPase Obg OS=Rickettsia canadensis (strain McKiel) GN=obg PE=3 SV=1 70 163 1.0E-09
sp|B2GBD0|OBG_LACF3 GTPase Obg OS=Lactobacillus fermentum (strain NBRC 3956 / LMG 18251) GN=obg PE=3 SV=1 68 186 1.0E-09
sp|Q30XW0|OBG_DESAG GTPase Obg OS=Desulfovibrio alaskensis (strain G20) GN=obg PE=3 SV=2 70 165 1.0E-09
sp|C0R5N5|OBG_WOLWR GTPase Obg OS=Wolbachia sp. subsp. Drosophila simulans (strain wRi) GN=obg PE=3 SV=1 69 160 1.0E-09
sp|Q73HQ3|OBG_WOLPM GTPase Obg OS=Wolbachia pipientis wMel GN=obg PE=3 SV=1 69 160 1.0E-09
sp|Q2J3J8|OBG_RHOP2 GTPase Obg OS=Rhodopseudomonas palustris (strain HaA2) GN=obg PE=3 SV=1 70 163 1.0E-09
sp|A6VBV3|OBG_PSEA7 GTPase Obg OS=Pseudomonas aeruginosa (strain PA7) GN=obg PE=3 SV=1 70 177 1.0E-09
sp|Q4ZYK1|OBG_PSEU2 GTPase Obg OS=Pseudomonas syringae pv. syringae (strain B728a) GN=obg PE=3 SV=1 70 177 1.0E-09
sp|Q48NL2|OBG_PSE14 GTPase Obg OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=obg PE=3 SV=1 70 177 1.0E-09
sp|Q8CNZ7|OBG_STAES GTPase Obg OS=Staphylococcus epidermidis (strain ATCC 12228) GN=obg PE=3 SV=1 70 178 1.0E-09
sp|Q5HNQ7|OBG_STAEQ GTPase Obg OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=obg PE=3 SV=1 70 178 1.0E-09
sp|Q88Q08|OBG_PSEPK GTPase Obg OS=Pseudomonas putida (strain KT2440) GN=obg PE=3 SV=1 70 163 1.0E-09
sp|A5VYC6|OBG_PSEP1 GTPase Obg OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=obg PE=3 SV=1 70 163 1.0E-09
sp|B0KMF6|OBG_PSEPG GTPase Obg OS=Pseudomonas putida (strain GB-1) GN=obg PE=3 SV=1 70 163 1.0E-09
sp|B8F871|OBG_HAEPS GTPase Obg OS=Haemophilus parasuis serovar 5 (strain SH0165) GN=obg PE=3 SV=1 70 161 1.0E-09
sp|B9DNE7|OBG_STACT GTPase Obg OS=Staphylococcus carnosus (strain TM300) GN=obg PE=3 SV=1 70 174 1.0E-09
sp|B0UVI2|OBG_HISS2 GTPase Obg OS=Histophilus somni (strain 2336) GN=obg PE=3 SV=1 70 161 1.0E-09
sp|Q15PF0|OBG_PSEA6 GTPase Obg OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=obg PE=3 SV=1 70 161 1.0E-09
sp|Q9ZCB6|OBG_RICPR GTPase Obg OS=Rickettsia prowazekii (strain Madrid E) GN=obg PE=3 SV=1 70 163 2.0E-09
sp|A8MHK8|OBG_ALKOO GTPase Obg OS=Alkaliphilus oremlandii (strain OhILAs) GN=obg PE=3 SV=1 70 176 2.0E-09
sp|Q0AAD6|OBG_ALKEH GTPase Obg OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=obg PE=3 SV=1 70 174 2.0E-09
sp|Q2LR77|OBG_SYNAS GTPase Obg OS=Syntrophus aciditrophicus (strain SB) GN=obg PE=3 SV=2 70 182 2.0E-09
sp|Q9HVL8|OBG_PSEAE GTPase Obg OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=obg PE=3 SV=1 70 177 2.0E-09
sp|Q02GB1|OBG_PSEAB GTPase Obg OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=obg PE=1 SV=1 70 177 2.0E-09
sp|B7V0A9|OBG_PSEA8 GTPase Obg OS=Pseudomonas aeruginosa (strain LESB58) GN=obg PE=3 SV=1 70 177 2.0E-09
sp|Q6KHM2|OBG_MYCMO GTPase Obg OS=Mycoplasma mobile (strain ATCC 43663 / 163K / NCTC 11711) GN=obg PE=3 SV=1 70 186 2.0E-09
sp|A4YKF3|OBG_BRASO GTPase Obg OS=Bradyrhizobium sp. (strain ORS278) GN=obg PE=3 SV=1 70 179 2.0E-09
sp|Q2VZU2|OBG_MAGSA GTPase Obg OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) GN=obg PE=3 SV=1 70 176 2.0E-09
sp|Q65S59|OBG_MANSM GTPase Obg OS=Mannheimia succiniciproducens (strain MBEL55E) GN=obg PE=3 SV=1 70 161 2.0E-09
sp|Q47MV6|OBG_THEFY GTPase Obg OS=Thermobifida fusca (strain YX) GN=obg PE=3 SV=1 70 163 2.0E-09
sp|B3PRZ3|OBG_RHIE6 GTPase Obg OS=Rhizobium etli (strain CIAT 652) GN=obg PE=3 SV=1 70 179 2.0E-09
sp|B1JF57|OBG_PSEPW GTPase Obg OS=Pseudomonas putida (strain W619) GN=obg PE=3 SV=1 70 163 2.0E-09
sp|Q0AWJ4|OBG_SYNWW GTPase Obg OS=Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen) GN=obg PE=3 SV=1 70 165 2.0E-09
sp|B0UMS4|OBG_METS4 GTPase Obg OS=Methylobacterium sp. (strain 4-46) GN=obg PE=3 SV=1 70 177 2.0E-09
sp|A6VMU1|OBG_ACTSZ GTPase Obg OS=Actinobacillus succinogenes (strain ATCC 55618 / 130Z) GN=obg PE=3 SV=1 70 161 2.0E-09
sp|Q5LRY4|OBG_RUEPO GTPase Obg OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=obg PE=3 SV=1 70 177 3.0E-09
sp|B3CNP2|OBG_WOLPP GTPase Obg OS=Wolbachia pipientis subsp. Culex pipiens (strain wPip) GN=obg PE=3 SV=1 70 163 3.0E-09
sp|Q07U75|OBG_RHOP5 GTPase Obg OS=Rhodopseudomonas palustris (strain BisA53) GN=obg PE=3 SV=1 70 177 3.0E-09
sp|A9BK05|OBG_PETMO GTPase Obg OS=Petrotoga mobilis (strain DSM 10674 / SJ95) GN=obg PE=3 SV=1 70 174 3.0E-09
sp|A5GD29|OBG_GEOUR GTPase Obg OS=Geobacter uraniireducens (strain Rf4) GN=obg PE=3 SV=1 69 165 3.0E-09
sp|Q2RV04|OBG_RHORT GTPase Obg OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) GN=obg PE=3 SV=1 70 180 3.0E-09
sp|A1URN4|OBG_BARBK GTPase Obg OS=Bartonella bacilliformis (strain ATCC 35685 / KC583) GN=obg PE=3 SV=1 70 177 3.0E-09
sp|Q47AD0|OBG_DECAR GTPase Obg OS=Dechloromonas aromatica (strain RCB) GN=obg PE=3 SV=1 70 177 3.0E-09
sp|Q97JL4|OBG_CLOAB GTPase Obg OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=obg PE=3 SV=1 70 167 3.0E-09
sp|B1Y280|OBG_LEPCP GTPase Obg OS=Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6) GN=obg PE=3 SV=1 70 174 3.0E-09
sp|Q747Q2|OBG_GEOSL GTPase Obg OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=obg PE=3 SV=1 70 174 3.0E-09
sp|Q5FH94|OBG_EHRRG GTPase Obg OS=Ehrlichia ruminantium (strain Gardel) GN=obg PE=3 SV=1 69 165 4.0E-09
sp|Q5HB45|OBG_EHRRW GTPase Obg OS=Ehrlichia ruminantium (strain Welgevonden) GN=obg PE=3 SV=1 69 165 4.0E-09
sp|Q04EZ8|OBG_OENOB GTPase Obg OS=Oenococcus oeni (strain ATCC BAA-331 / PSU-1) GN=obg PE=3 SV=1 69 182 4.0E-09
sp|Q6G0S8|OBG_BARQU GTPase Obg OS=Bartonella quintana (strain Toulouse) GN=obg PE=3 SV=1 70 186 4.0E-09
sp|Q8K9G1|OBG_BUCAP GTPase Obg OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=obg PE=3 SV=1 70 174 4.0E-09
sp|A3QB95|OBG_SHELP GTPase Obg OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=obg PE=3 SV=1 70 177 4.0E-09
sp|Q165Y6|OBG_ROSDO GTPase Obg OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) GN=obg PE=3 SV=1 70 177 5.0E-09
sp|Q3ZAJ2|OBG_DEHM1 GTPase Obg OS=Dehalococcoides mccartyi (strain ATCC BAA-2266 / KCTC 15142 / 195) GN=obg PE=3 SV=1 72 162 5.0E-09
sp|B6IQZ9|OBG_RHOCS GTPase Obg OS=Rhodospirillum centenum (strain ATCC 51521 / SW) GN=obg PE=3 SV=1 70 177 5.0E-09
sp|Q7UVH6|OBG_RHOBA GTPase Obg OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=obg PE=3 SV=2 70 163 5.0E-09
sp|Q6NFV7|OBG_CORDI GTPase Obg OS=Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis) GN=obg PE=3 SV=1 70 163 6.0E-09
sp|Q3ZW89|OBG_DEHMC GTPase Obg OS=Dehalococcoides mccartyi (strain CBDB1) GN=obg PE=3 SV=1 72 162 6.0E-09
sp|A5FP49|OBG_DEHMB GTPase Obg OS=Dehalococcoides mccartyi (strain ATCC BAA-2100 / JCM 16839 / KCTC 5957 / BAV1) GN=obg PE=3 SV=1 72 162 6.0E-09
sp|Q1IVS5|OBG_KORVE GTPase Obg OS=Koribacter versatilis (strain Ellin345) GN=obg PE=3 SV=1 70 163 6.0E-09
sp|Q2NCX8|OBG_ERYLH GTPase Obg OS=Erythrobacter litoralis (strain HTCC2594) GN=obg PE=3 SV=1 70 177 7.0E-09
sp|A5E965|OBG_BRASB GTPase Obg OS=Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182) GN=obg PE=3 SV=1 70 179 7.0E-09
sp|Q1QQU0|OBG_NITHX GTPase Obg OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=obg PE=3 SV=1 70 179 7.0E-09
sp|A0Q1T4|OBG_CLONN GTPase Obg OS=Clostridium novyi (strain NT) GN=obg PE=3 SV=1 70 167 8.0E-09
sp|C0QLE9|OBG_DESAH GTPase Obg OS=Desulfobacterium autotrophicum (strain ATCC 43914 / DSM 3382 / HRM2) GN=obg PE=3 SV=1 70 163 1.0E-08
sp|Q68VS1|OBG_RICTY GTPase Obg OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=obg PE=3 SV=1 70 163 1.0E-08
sp|A8GQ55|OBG_RICAH GTPase Obg OS=Rickettsia akari (strain Hartford) GN=obg PE=3 SV=1 70 163 1.0E-08
sp|Q6AK07|OBG_DESPS GTPase Obg OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) GN=obg PE=3 SV=1 69 165 1.0E-08
sp|Q1RGV9|OBG_RICBR GTPase Obg OS=Rickettsia bellii (strain RML369-C) GN=obg PE=3 SV=1 70 163 1.0E-08
sp|A8GUG0|OBG_RICB8 GTPase Obg OS=Rickettsia bellii (strain OSU 85-389) GN=obg PE=3 SV=1 70 163 1.0E-08
sp|A6QB70|OBG_SULNB GTPase Obg OS=Sulfurovum sp. (strain NBC37-1) GN=obg PE=3 SV=1 70 167 1.0E-08
sp|B0T310|OBG_CAUSK GTPase Obg OS=Caulobacter sp. (strain K31) GN=obg PE=3 SV=1 70 174 1.0E-08
sp|C1DEA4|OBG_AZOVD GTPase Obg OS=Azotobacter vinelandii (strain DJ / ATCC BAA-1303) GN=obg PE=3 SV=1 70 163 1.0E-08
sp|B0TBW1|OBG_HELMI GTPase Obg OS=Heliobacterium modesticaldum (strain ATCC 51547 / Ice1) GN=obg PE=3 SV=1 70 165 1.0E-08
sp|Q7VK84|OBG_HELHP GTPase Obg OS=Helicobacter hepaticus (strain ATCC 51449 / 3B1) GN=obg PE=3 SV=1 70 174 1.0E-08
sp|A9VYM4|OBG_METEP GTPase Obg OS=Methylobacterium extorquens (strain PA1) GN=obg PE=3 SV=1 70 186 1.0E-08
sp|B7KSH0|OBG_METC4 GTPase Obg OS=Methylobacterium extorquens (strain CM4 / NCIMB 13688) GN=obg PE=3 SV=1 70 186 1.0E-08
sp|B1ZL15|OBG_METPB GTPase Obg OS=Methylobacterium populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001) GN=obg PE=3 SV=1 70 186 1.0E-08
sp|Q3SVI2|OBG_NITWN GTPase Obg OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=obg PE=3 SV=1 70 177 1.0E-08
sp|A2BUJ6|OBG_PROM5 GTPase Obg OS=Prochlorococcus marinus (strain MIT 9515) GN=obg PE=3 SV=1 70 167 1.0E-08
sp|Q5GTG3|OBG_WOLTR GTPase Obg OS=Wolbachia sp. subsp. Brugia malayi (strain TRS) GN=obg PE=3 SV=1 70 161 2.0E-08
sp|Q1GZ53|OBG_METFK GTPase Obg OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=obg PE=3 SV=1 70 163 2.0E-08
sp|A9KMF5|OBG_CLOPH GTPase Obg OS=Clostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg) GN=obg PE=3 SV=1 70 165 2.0E-08
sp|B5E958|OBG_GEOBB GTPase Obg OS=Geobacter bemidjiensis (strain Bem / ATCC BAA-1014 / DSM 16622) GN=obg PE=3 SV=1 69 174 2.0E-08
sp|Q6A9H8|OBG_PROAC GTPase Obg OS=Propionibacterium acnes (strain KPA171202 / DSM 16379) GN=obg PE=3 SV=1 68 163 2.0E-08
sp|Q2RKZ8|OBG_MOOTA GTPase Obg OS=Moorella thermoacetica (strain ATCC 39073) GN=obg PE=3 SV=1 70 165 2.0E-08
sp|Q4UJV1|OBG_RICFE GTPase Obg OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=obg PE=3 SV=1 70 163 3.0E-08
sp|Q82V20|OBG_NITEU GTPase Obg OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=obg PE=3 SV=1 70 163 3.0E-08
sp|Q5SHE9|OBG_THET8 GTPase Obg OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=obg PE=1 SV=1 70 177 3.0E-08
sp|Q72HR4|OBG_THET2 GTPase Obg OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=obg PE=3 SV=1 70 177 3.0E-08
sp|B2A6B7|OBG_NATTJ GTPase Obg OS=Natranaerobius thermophilus (strain ATCC BAA-1301 / DSM 18059 / JW/NM-WN-LF) GN=obg PE=3 SV=1 70 165 3.0E-08
sp|Q057J0|OBG_BUCCC GTPase Obg OS=Buchnera aphidicola subsp. Cinara cedri (strain Cc) GN=obg PE=3 SV=1 70 161 3.0E-08
sp|B3WE52|OBG_LACCB GTPase Obg OS=Lactobacillus casei (strain BL23) GN=obg PE=3 SV=1 70 163 4.0E-08
sp|Q0VSE6|OBG_ALCBS GTPase Obg OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=obg PE=3 SV=1 70 176 4.0E-08
sp|Q039J3|OBG_LACC3 GTPase Obg OS=Lactobacillus casei (strain ATCC 334) GN=obg PE=3 SV=1 70 177 4.0E-08
sp|Q73LW4|OBG_TREDE GTPase Obg OS=Treponema denticola (strain ATCC 35405 / CIP 103919 / DSM 14222) GN=obg PE=3 SV=1 70 165 4.0E-08
sp|A6TQJ6|OBG_ALKMQ GTPase Obg OS=Alkaliphilus metalliredigens (strain QYMF) GN=obg PE=3 SV=1 70 177 4.0E-08
sp|B9M3W3|OBG_GEODF GTPase Obg OS=Geobacter daltonii (strain DSM 22248 / JCM 15807 / FRC-32) GN=obg PE=3 SV=1 69 177 4.0E-08
sp|A9IMA6|OBG_BART1 GTPase Obg OS=Bartonella tribocorum (strain CIP 105476 / IBS 506) GN=obg PE=3 SV=1 70 186 4.0E-08
sp|B5RQB8|OBG_BORRA GTPase Obg OS=Borrelia recurrentis (strain A1) GN=obg PE=3 SV=1 70 158 5.0E-08
sp|A2BP15|OBG_PROMS GTPase Obg OS=Prochlorococcus marinus (strain AS9601) GN=obg PE=3 SV=1 70 166 5.0E-08
sp|Q5PAS5|OBG1_ANAMM GTPase Obg 1 OS=Anaplasma marginale (strain St. Maries) GN=obg1 PE=3 SV=1 69 161 5.0E-08
sp|Q92G19|OBG_RICCN GTPase Obg OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=obg PE=3 SV=2 70 163 6.0E-08
sp|A8GTZ9|OBG_RICRS GTPase Obg OS=Rickettsia rickettsii (strain Sheila Smith) GN=obg PE=3 SV=2 70 163 6.0E-08
sp|B0BVJ1|OBG_RICRO GTPase Obg OS=Rickettsia rickettsii (strain Iowa) GN=obg PE=3 SV=2 70 163 6.0E-08
sp|A8F2Y3|OBG_RICM5 GTPase Obg OS=Rickettsia massiliae (strain Mtu5) GN=obg PE=3 SV=2 70 163 6.0E-08
sp|Q824F3|OBG_CHLCV GTPase Obg OS=Chlamydophila caviae (strain GPIC) GN=obg PE=3 SV=1 70 190 6.0E-08
sp|B5RMX3|OBG_BORDL GTPase Obg OS=Borrelia duttonii (strain Ly) GN=obg PE=3 SV=1 70 158 6.0E-08
sp|A9IFF9|OBG_BORPD GTPase Obg OS=Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448) GN=obg PE=3 SV=1 70 165 6.0E-08
sp|Q0SH51|OBG_RHOJR GTPase Obg OS=Rhodococcus jostii (strain RHA1) GN=obg PE=3 SV=1 70 163 6.0E-08
sp|B9L101|OBG_THERP GTPase Obg OS=Thermomicrobium roseum (strain ATCC 27502 / DSM 5159 / P-2) GN=obg PE=3 SV=1 70 163 7.0E-08
sp|A6T2D5|OBG_JANMA GTPase Obg OS=Janthinobacterium sp. (strain Marseille) GN=obg PE=3 SV=1 70 181 7.0E-08
sp|B1M697|OBG_METRJ GTPase Obg OS=Methylobacterium radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831) GN=obg PE=3 SV=1 70 186 7.0E-08
sp|A3PAT7|OBG_PROM0 GTPase Obg OS=Prochlorococcus marinus (strain MIT 9301) GN=obg PE=3 SV=1 70 166 7.0E-08
sp|Q98EZ3|OBG_RHILO GTPase Obg OS=Rhizobium loti (strain MAFF303099) GN=obg PE=3 SV=1 70 179 7.0E-08
sp|A6Q4D2|OBG_NITSB GTPase Obg OS=Nitratiruptor sp. (strain SB155-2) GN=obg PE=3 SV=1 70 163 8.0E-08
sp|Q89AE7|OBG_BUCBP GTPase Obg OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=obg PE=3 SV=1 70 175 8.0E-08
sp|A4VI54|OBG_PSEU5 GTPase Obg OS=Pseudomonas stutzeri (strain A1501) GN=obg PE=3 SV=1 70 177 8.0E-08
sp|O67849|OBG_AQUAE GTPase Obg OS=Aquifex aeolicus (strain VF5) GN=obg PE=3 SV=1 70 174 9.0E-08
sp|B3CQ33|OBG_ORITI GTPase Obg OS=Orientia tsutsugamushi (strain Ikeda) GN=obg PE=3 SV=1 70 182 1.0E-07
sp|A5CDM6|OBG_ORITB GTPase Obg OS=Orientia tsutsugamushi (strain Boryong) GN=obg PE=3 SV=1 70 182 1.0E-07
sp|B2G6R9|OBG_LACRJ GTPase Obg OS=Lactobacillus reuteri (strain JCM 1112) GN=obg PE=3 SV=1 70 186 1.0E-07
sp|A5VJ99|OBG_LACRD GTPase Obg OS=Lactobacillus reuteri (strain DSM 20016) GN=obg PE=3 SV=1 70 186 1.0E-07
sp|Q88VG4|OBG_LACPL GTPase Obg OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=obg PE=3 SV=1 70 165 1.0E-07
sp|A7I166|OBG_CAMHC GTPase Obg OS=Campylobacter hominis (strain ATCC BAA-381 / LMG 19568 / NCTC 13146 / CH001A) GN=obg PE=3 SV=1 70 161 1.0E-07
sp|C1F9K2|OBG_ACIC5 GTPase Obg OS=Acidobacterium capsulatum (strain ATCC 51196 / DSM 11244 / JCM 7670 / NBRC 15755 / NCIMB 13165 / 161) GN=obg PE=3 SV=1 70 163 1.0E-07
sp|A4XYL2|OBG_PSEMY GTPase Obg OS=Pseudomonas mendocina (strain ymp) GN=obg PE=3 SV=1 70 174 1.0E-07
sp|A8EV83|OBG_ARCB4 GTPase Obg OS=Arcobacter butzleri (strain RM4018) GN=obg PE=3 SV=1 70 163 1.0E-07
sp|Q9PJX7|OBG_CHLMU GTPase Obg OS=Chlamydia muridarum (strain MoPn / Nigg) GN=obg PE=3 SV=1 70 177 1.0E-07
sp|B4RD64|OBG_PHEZH GTPase Obg OS=Phenylobacterium zucineum (strain HLK1) GN=obg PE=3 SV=1 70 163 1.0E-07
sp|B1N057|OBG_LEUCK GTPase Obg OS=Leuconostoc citreum (strain KM20) GN=obg PE=3 SV=2 69 186 1.0E-07
sp|Q31CW3|OBG_PROM9 GTPase Obg OS=Prochlorococcus marinus (strain MIT 9312) GN=obg PE=3 SV=1 70 165 1.0E-07
sp|A8G2M6|OBG_PROM2 GTPase Obg OS=Prochlorococcus marinus (strain MIT 9215) GN=obg PE=3 SV=1 70 166 1.0E-07
sp|Q7NZS1|OBG_CHRVO GTPase Obg OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=obg PE=3 SV=1 70 177 2.0E-07
sp|B2GGD9|OBG_KOCRD GTPase Obg OS=Kocuria rhizophila (strain ATCC 9341 / DSM 348 / NBRC 103217 / DC2201) GN=obg PE=3 SV=1 69 165 2.0E-07
sp|B9L605|OBG_NAUPA GTPase Obg OS=Nautilia profundicola (strain ATCC BAA-1463 / DSM 18972 / AmH) GN=obg PE=3 SV=1 70 164 2.0E-07
sp|P72931|OBG_SYNY3 GTPase Obg OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=obg PE=3 SV=1 70 166 2.0E-07
sp|Q253F8|OBG_CHLFF GTPase Obg OS=Chlamydophila felis (strain Fe/C-56) GN=obg PE=3 SV=1 70 177 2.0E-07
sp|A1R0K4|OBG_BORT9 GTPase Obg OS=Borrelia turicatae (strain 91E135) GN=obg PE=3 SV=1 69 179 2.0E-07
sp|O84423|OBG_CHLTR GTPase Obg OS=Chlamydia trachomatis (strain D/UW-3/Cx) GN=obg PE=3 SV=1 70 165 2.0E-07
sp|A6LJZ0|OBG_THEM4 GTPase Obg OS=Thermosipho melanesiensis (strain DSM 12029 / CIP 104789 / BI429) GN=obg PE=3 SV=1 70 174 2.0E-07
sp|Q0BRE9|OBG_GRABC GTPase Obg OS=Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1) GN=obg PE=3 SV=2 70 174 2.0E-07
sp|A6WDM9|OBG_KINRD GTPase Obg OS=Kineococcus radiotolerans (strain ATCC BAA-149 / DSM 14245 / SRS30216) GN=obg PE=3 SV=1 70 164 2.0E-07
sp|Q6MGS5|OBG_BDEBA GTPase Obg OS=Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100) GN=obg PE=3 SV=2 70 166 2.0E-07
sp|A6LD68|OBG_PARD8 GTPase Obg OS=Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / NCTC 11152) GN=obg PE=3 SV=1 70 177 2.0E-07
sp|Q5KWP5|OBG_GEOKA GTPase Obg OS=Geobacillus kaustophilus (strain HTA426) GN=obg PE=3 SV=1 70 179 2.0E-07
sp|Q5NR23|OBG_ZYMMO GTPase Obg OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=obg PE=3 SV=1 70 163 2.0E-07
sp|A4IRC7|OBG_GEOTN GTPase Obg OS=Geobacillus thermodenitrificans (strain NG80-2) GN=obg PE=3 SV=1 70 179 2.0E-07
sp|Q30QP0|OBG_SULDN GTPase Obg OS=Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251) GN=obg PE=3 SV=1 70 163 3.0E-07
sp|B1VGL9|OBG_CORU7 GTPase Obg OS=Corynebacterium urealyticum (strain ATCC 43042 / DSM 7109) GN=obg PE=3 SV=1 70 163 3.0E-07
sp|Q9Z808|OBG_CHLPN GTPase Obg OS=Chlamydia pneumoniae GN=obg PE=3 SV=1 70 165 3.0E-07
sp|Q5FKH5|OBG_LACAC GTPase Obg OS=Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM) GN=obg PE=3 SV=1 68 186 3.0E-07
sp|A4G8R4|OBG_HERAR GTPase Obg OS=Herminiimonas arsenicoxydans GN=obg PE=3 SV=1 70 181 3.0E-07
sp|Q2QZ37|OBGM_ORYSJ Probable GTP-binding protein OBGM, mitochondrial OS=Oryza sativa subsp. japonica GN=OBGM PE=2 SV=1 43 171 3.0E-07
sp|A6GZB7|OBG_FLAPJ GTPase Obg OS=Flavobacterium psychrophilum (strain JIP02/86 / ATCC 49511) GN=obg PE=3 SV=1 70 177 4.0E-07
sp|Q5L6R9|OBG_CHLAB GTPase Obg OS=Chlamydophila abortus (strain DSM 27085 / S26/3) GN=obg PE=3 SV=1 70 170 4.0E-07
sp|B7IGK8|OBG_THEAB GTPase Obg OS=Thermosipho africanus (strain TCF52B) GN=obg PE=3 SV=1 70 174 4.0E-07
sp|A8YV14|OBG_LACH4 GTPase Obg OS=Lactobacillus helveticus (strain DPC 4571) GN=obg PE=3 SV=1 68 186 4.0E-07
sp|Q1IW72|OBG_DEIGD GTPase Obg OS=Deinococcus geothermalis (strain DSM 11300) GN=obg PE=3 SV=1 69 161 4.0E-07
sp|B3PIU9|OBG_CELJU GTPase Obg OS=Cellvibrio japonicus (strain Ueda107) GN=obg PE=3 SV=1 70 177 4.0E-07
sp|A6W352|OBG_MARMS GTPase Obg OS=Marinomonas sp. (strain MWYL1) GN=obg PE=3 SV=1 70 163 4.0E-07
sp|A5FMX0|OBG_FLAJ1 GTPase Obg OS=Flavobacterium johnsoniae (strain ATCC 17061 / DSM 2064 / UW101) GN=obg PE=3 SV=1 70 177 4.0E-07
sp|A1KAD0|OBG_AZOSB GTPase Obg OS=Azoarcus sp. (strain BH72) GN=obg PE=3 SV=1 70 174 5.0E-07
sp|B8EQH4|OBG_METSB GTPase Obg OS=Methylocella silvestris (strain BL2 / DSM 15510 / NCIMB 13906) GN=obg PE=3 SV=1 70 177 5.0E-07
sp|B0BC53|OBG_CHLTB GTPase Obg OS=Chlamydia trachomatis serovar L2b (strain UCH-1/proctitis) GN=obg PE=3 SV=1 70 165 5.0E-07
sp|B0B7Y8|OBG_CHLT2 GTPase Obg OS=Chlamydia trachomatis serovar L2 (strain 434/Bu / ATCC VR-902B) GN=obg PE=3 SV=1 70 165 5.0E-07
sp|Q7NB30|OBG_MYCGA GTPase Obg OS=Mycoplasma gallisepticum (strain R(low / passage 15 / clone 2)) GN=obg PE=3 SV=2 70 182 5.0E-07
sp|A7HJZ8|OBG_FERNB GTPase Obg OS=Fervidobacterium nodosum (strain ATCC 35602 / DSM 5306 / Rt17-B1) GN=obg PE=3 SV=1 70 174 6.0E-07
sp|Q03YT6|OBG_LEUMM GTPase Obg OS=Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / NCDO 523) GN=obg PE=3 SV=1 69 186 6.0E-07
sp|B2S1C3|OBG_BORHD GTPase Obg OS=Borrelia hermsii (strain HS1 / DAH) GN=obg PE=3 SV=1 72 166 6.0E-07
sp|Q2Y807|OBG_NITMU GTPase Obg OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849) GN=obg PE=3 SV=1 70 177 6.0E-07
sp|A8LK09|OBG_DINSH GTPase Obg OS=Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12) GN=obg PE=3 SV=1 70 177 7.0E-07
sp|Q7MA28|OBG_WOLSU GTPase Obg OS=Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / LMG 7466 / NCTC 11488 / FDC 602W) GN=obg PE=3 SV=1 70 163 7.0E-07
sp|B9KW04|OBG_RHOSK GTPase Obg OS=Rhodobacter sphaeroides (strain KD131 / KCTC 12085) GN=obg PE=3 SV=1 70 177 7.0E-07
sp|Q3IXX9|OBG_RHOS4 GTPase Obg OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=obg PE=3 SV=1 70 177 7.0E-07
sp|A3PQJ0|OBG_RHOS1 GTPase Obg OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) GN=obg PE=3 SV=1 70 177 7.0E-07
sp|Q1LIQ0|OBG_CUPMC GTPase Obg OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=obg PE=3 SV=1 70 177 7.0E-07
sp|A4F9L3|OBG_SACEN GTPase Obg OS=Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338) GN=obg PE=3 SV=1 70 163 7.0E-07
sp|B5Y805|OBG_COPPD GTPase Obg OS=Coprothermobacter proteolyticus (strain ATCC 35245 / DSM 5265 / BT) GN=obg PE=3 SV=1 70 172 8.0E-07
sp|B3ER55|OBG_AMOA5 GTPase Obg OS=Amoebophilus asiaticus (strain 5a2) GN=obg PE=3 SV=1 70 177 9.0E-07
sp|A9BP68|OBG_DELAS GTPase Obg OS=Delftia acidovorans (strain DSM 14801 / SPH-1) GN=obg PE=3 SV=1 70 163 9.0E-07
sp|B7KIC1|OBG_CYAP7 GTPase Obg OS=Cyanothece sp. (strain PCC 7424) GN=obg PE=3 SV=1 70 174 1.0E-06
sp|Q18B27|OBG_PEPD6 GTPase Obg OS=Peptoclostridium difficile (strain 630) GN=obg PE=3 SV=1 70 165 1.0E-06
sp|A4WZ45|OBG_RHOS5 GTPase Obg OS=Rhodobacter sphaeroides (strain ATCC 17025 / ATH 2.4.3) GN=obg PE=3 SV=2 70 177 1.0E-06
sp|Q38WT4|OBG_LACSS GTPase Obg OS=Lactobacillus sakei subsp. sakei (strain 23K) GN=obg PE=3 SV=1 70 186 1.0E-06
sp|B1ILY5|OBG_CLOBK GTPase Obg OS=Clostridium botulinum (strain Okra / Type B1) GN=obg PE=3 SV=1 70 167 1.0E-06
sp|Q9RY66|OBG_DEIRA GTPase Obg OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=obg PE=3 SV=1 69 161 1.0E-06
sp|Q3KLT5|OBG_CHLTA GTPase Obg OS=Chlamydia trachomatis serovar A (strain ATCC VR-571B / DSM 19440 / HAR-13) GN=obg PE=3 SV=1 70 165 1.0E-06
sp|Q5P7Z4|OBG_AROAE GTPase Obg OS=Aromatoleum aromaticum (strain EbN1) GN=obg PE=3 SV=1 70 174 1.0E-06
sp|Q12F99|OBG_POLSJ GTPase Obg OS=Polaromonas sp. (strain JS666 / ATCC BAA-500) GN=obg PE=3 SV=1 70 163 1.0E-06
sp|Q5FUL2|OBG_GLUOX GTPase Obg OS=Gluconobacter oxydans (strain 621H) GN=obg PE=3 SV=2 70 174 1.0E-06
sp|Q6YRC6|OBG_ONYPE GTPase Obg OS=Onion yellows phytoplasma (strain OY-M) GN=obg PE=3 SV=1 70 162 1.0E-06
sp|Q2NIK0|OBG_AYWBP GTPase Obg OS=Aster yellows witches'-broom phytoplasma (strain AYWB) GN=obg PE=3 SV=1 70 162 1.0E-06
sp|C0MDB4|OBG_STRS7 GTPase Obg OS=Streptococcus equi subsp. zooepidemicus (strain H70) GN=obg PE=3 SV=1 70 186 1.0E-06
sp|B0K414|OBG_THEPX GTPase Obg OS=Thermoanaerobacter sp. (strain X514) GN=obg PE=3 SV=1 70 163 2.0E-06
sp|B0KAB8|OBG_THEP3 GTPase Obg OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=obg PE=3 SV=1 70 163 2.0E-06
sp|Q6MEQ6|OBG_PARUW GTPase Obg OS=Protochlamydia amoebophila (strain UWE25) GN=obg PE=3 SV=1 70 179 2.0E-06
sp|Q04B11|OBG_LACDB GTPase Obg OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC BAA-365) GN=obg PE=3 SV=1 70 186 2.0E-06
sp|Q1GAM3|OBG_LACDA GTPase Obg OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / JCM 1002 / NBRC 13953 / NCIMB 11778) GN=obg PE=3 SV=1 70 186 2.0E-06
sp|Q46X17|OBG_CUPPJ GTPase Obg OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=obg PE=3 SV=1 70 177 2.0E-06
sp|Q0K6P6|OBG_CUPNH GTPase Obg OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=obg PE=3 SV=1 70 177 2.0E-06
sp|A9H0F1|OBG_GLUDA GTPase Obg OS=Gluconacetobacter diazotrophicus (strain ATCC 49037 / DSM 5601 / PAl5) GN=obg PE=3 SV=2 70 177 2.0E-06
sp|B2IE44|OBG_BEII9 GTPase Obg OS=Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIB 8712) GN=obg PE=3 SV=1 70 177 2.0E-06
sp|Q7MW55|OBG_PORGI GTPase Obg OS=Porphyromonas gingivalis (strain ATCC BAA-308 / W83) GN=obg PE=3 SV=1 70 177 2.0E-06
sp|B2RIY7|OBG_PORG3 GTPase Obg OS=Porphyromonas gingivalis (strain ATCC 33277 / DSM 20709 / JCM 12257) GN=obg PE=3 SV=1 70 177 2.0E-06
sp|Q03QP2|OBG_LACBA GTPase Obg OS=Lactobacillus brevis (strain ATCC 367 / JCM 1170) GN=obg PE=3 SV=1 70 165 2.0E-06
sp|Q2L062|OBG_BORA1 GTPase Obg OS=Bordetella avium (strain 197N) GN=obg PE=3 SV=1 70 165 2.0E-06
sp|Q98QK8|OBG_MYCPU GTPase Obg OS=Mycoplasma pulmonis (strain UAB CTIP) GN=obg PE=3 SV=1 70 165 2.0E-06
sp|A3DBS5|OBG_CLOTH GTPase Obg OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=obg PE=3 SV=1 70 165 2.0E-06
sp|A1VK90|OBG_POLNA GTPase Obg OS=Polaromonas naphthalenivorans (strain CJ2) GN=obg PE=3 SV=1 70 163 2.0E-06
sp|A1TTD3|OBG_ACIAC GTPase Obg OS=Acidovorax citrulli (strain AAC00-1) GN=obg PE=3 SV=1 70 165 2.0E-06
sp|Q6AFY1|OBG_LEIXX GTPase Obg OS=Leifsonia xyli subsp. xyli (strain CTCB07) GN=obg PE=3 SV=1 70 164 2.0E-06
sp|A1WY48|OBG_HALHL GTPase Obg OS=Halorhodospira halophila (strain DSM 244 / SL1) GN=obg PE=3 SV=1 70 163 2.0E-06
sp|A0M5C6|OBG_GRAFK GTPase Obg OS=Gramella forsetii (strain KT0803) GN=obg PE=3 SV=1 70 182 3.0E-06
sp|Q8RBA5|OBG_CALS4 GTPase Obg OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=obg PE=3 SV=1 69 163 3.0E-06
sp|B3R898|OBG_CUPTR GTPase Obg OS=Cupriavidus taiwanensis (strain R1 / LMG 19424) GN=obg PE=3 SV=1 70 177 3.0E-06
sp|Q602A7|OBG_MYCH2 GTPase Obg OS=Mycoplasma hyopneumoniae (strain 232) GN=obg PE=3 SV=1 70 163 3.0E-06
sp|Q4A8X1|OBG_MYCH7 GTPase Obg OS=Mycoplasma hyopneumoniae (strain 7448) GN=obg PE=3 SV=1 70 163 3.0E-06
sp|B9KER3|OBG_CAMLR GTPase Obg OS=Campylobacter lari (strain RM2100 / D67 / ATCC BAA-1060) GN=obg PE=3 SV=1 70 163 3.0E-06
sp|B2JHD7|OBG_BURP8 GTPase Obg OS=Burkholderia phymatum (strain DSM 17167 / STM815) GN=obg PE=3 SV=1 70 177 3.0E-06
sp|B1ZZ37|OBG_OPITP GTPase Obg OS=Opitutus terrae (strain DSM 11246 / PB90-1) GN=obg PE=3 SV=1 70 177 3.0E-06
sp|B1HVB2|OBG_LYSSC GTPase Obg OS=Lysinibacillus sphaericus (strain C3-41) GN=obg PE=3 SV=2 70 163 3.0E-06
sp|C0QX49|OBG_BRAHW GTPase Obg OS=Brachyspira hyodysenteriae (strain ATCC 49526 / WA1) GN=obg PE=3 SV=1 70 163 3.0E-06
sp|Q21YZ9|OBG_RHOFT GTPase Obg OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) GN=obg PE=3 SV=1 70 165 3.0E-06
sp|Q8DYL0|OBG_STRA5 GTPase Obg OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=obg PE=3 SV=1 70 165 3.0E-06
sp|Q8E465|OBG_STRA3 GTPase Obg OS=Streptococcus agalactiae serotype III (strain NEM316) GN=obg PE=3 SV=1 70 165 3.0E-06
sp|Q3K046|OBG_STRA1 GTPase Obg OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=obg PE=3 SV=1 70 165 3.0E-06
sp|B5XLZ0|OBG_STRPZ GTPase Obg OS=Streptococcus pyogenes serotype M49 (strain NZ131) GN=obg PE=3 SV=1 70 165 3.0E-06
sp|Q1JGD5|OBG_STRPD GTPase Obg OS=Streptococcus pyogenes serotype M2 (strain MGAS10270) GN=obg PE=3 SV=1 70 165 3.0E-06
sp|B6JKN2|OBG_HELP2 GTPase Obg OS=Helicobacter pylori (strain P12) GN=obg PE=3 SV=1 70 163 4.0E-06
sp|A7GHK2|OBG_CLOBL GTPase Obg OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) GN=obg PE=3 SV=1 70 165 4.0E-06
sp|Q4AAV4|OBG_MYCHJ GTPase Obg OS=Mycoplasma hyopneumoniae (strain J / ATCC 25934 / NCTC 10110) GN=obg PE=3 SV=1 70 163 4.0E-06
sp|A3NDS7|OBG_BURP6 GTPase Obg OS=Burkholderia pseudomallei (strain 668) GN=obg PE=3 SV=1 70 177 4.0E-06
sp|Q63QM0|OBG_BURPS GTPase Obg OS=Burkholderia pseudomallei (strain K96243) GN=obg PE=3 SV=1 70 177 4.0E-06
sp|Q3JNG0|OBG_BURP1 GTPase Obg OS=Burkholderia pseudomallei (strain 1710b) GN=obg PE=3 SV=1 70 177 4.0E-06
sp|A3NZJ0|OBG_BURP0 GTPase Obg OS=Burkholderia pseudomallei (strain 1106a) GN=obg PE=3 SV=1 70 177 4.0E-06
sp|A1V0P1|OBG_BURMS GTPase Obg OS=Burkholderia mallei (strain SAVP1) GN=obg PE=3 SV=1 70 177 4.0E-06
sp|Q62GV4|OBG_BURMA GTPase Obg OS=Burkholderia mallei (strain ATCC 23344) GN=obg PE=3 SV=1 70 177 4.0E-06
sp|A2S5R8|OBG_BURM9 GTPase Obg OS=Burkholderia mallei (strain NCTC 10229) GN=obg PE=3 SV=1 70 177 4.0E-06
sp|A3MR90|OBG_BURM7 GTPase Obg OS=Burkholderia mallei (strain NCTC 10247) GN=obg PE=3 SV=1 70 177 4.0E-06
sp|Q2S3C0|OBG_SALRD GTPase Obg OS=Salinibacter ruber (strain DSM 13855 / M31) GN=obg PE=3 SV=1 70 164 4.0E-06
sp|A8Z631|OBG_SULMW GTPase Obg OS=Sulcia muelleri (strain GWSS) GN=obg PE=3 SV=1 70 165 4.0E-06
sp|B1KZR3|OBG_CLOBM GTPase Obg OS=Clostridium botulinum (strain Loch Maree / Type A3) GN=obg PE=3 SV=1 70 165 5.0E-06
sp|A5I666|OBG_CLOBH GTPase Obg OS=Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A) GN=obg PE=3 SV=1 70 165 5.0E-06
sp|A7FXU6|OBG_CLOB1 GTPase Obg OS=Clostridium botulinum (strain ATCC 19397 / Type A) GN=obg PE=3 SV=1 70 165 5.0E-06
sp|Q2SZG0|OBG_BURTA GTPase Obg OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=obg PE=3 SV=1 70 177 5.0E-06
sp|B8I179|OBG_CLOCE GTPase Obg OS=Clostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10) GN=obg PE=3 SV=1 70 165 6.0E-06
sp|B0S3Z4|OBG_FINM2 GTPase Obg OS=Finegoldia magna (strain ATCC 29328) GN=obg PE=3 SV=1 70 181 6.0E-06
sp|B3DVG9|OBG_METI4 GTPase Obg OS=Methylacidiphilum infernorum (isolate V4) GN=obg PE=3 SV=2 70 166 7.0E-06
sp|Q17Y93|OBG_HELAH GTPase Obg OS=Helicobacter acinonychis (strain Sheeba) GN=obg PE=3 SV=1 70 163 7.0E-06
sp|A5IYU8|OBG_MYCAP GTPase Obg OS=Mycoplasma agalactiae (strain PG2) GN=obg PE=3 SV=1 70 163 7.0E-06
sp|B9MDZ7|OBG_ACIET GTPase Obg OS=Acidovorax ebreus (strain TPSY) GN=obg PE=3 SV=1 70 165 8.0E-06
sp|Q2GDW7|OBG_NEOSM GTPase Obg OS=Neorickettsia sennetsu (strain Miyayama) GN=obg PE=3 SV=1 70 163 9.0E-06
sp|Q834V4|OBG_ENTFA GTPase Obg OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=obg PE=3 SV=1 70 165 9.0E-06
sp|A7NRU6|OBG_ROSCS GTPase Obg OS=Roseiflexus castenholzii (strain DSM 13941 / HLO8) GN=obg PE=3 SV=2 67 166 1.0E-05
sp|B0RDG3|OBG_CLAMS GTPase Obg OS=Clavibacter michiganensis subsp. sepedonicus (strain ATCC 33113 / DSM 20744 / JCM 9667 / LMG 2889 / C-1) GN=obg PE=3 SV=1 70 165 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0005525 GTP binding Yes
GO:0097367 carbohydrate derivative binding No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0043168 anion binding No
GO:0032555 purine ribonucleotide binding No
GO:0005488 binding No
GO:0043167 ion binding No
GO:1901363 heterocyclic compound binding No
GO:0036094 small molecule binding No
GO:0032561 guanyl ribonucleotide binding No
GO:0097159 organic cyclic compound binding No
GO:0032553 ribonucleotide binding No
GO:0000166 nucleotide binding No
GO:0003674 molecular_function No
GO:0019001 guanyl nucleotide binding No
GO:0017076 purine nucleotide binding No
GO:1901265 nucleoside phosphate binding No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup3404
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3648
Ophiocordyceps australis map64 (Brazil) OphauB2|1245
Ophiocordyceps camponoti-floridani Ophcf2|02743
Ophiocordyceps camponoti-rufipedis Ophun1|1563 (this protein)
Ophiocordyceps kimflemingae Ophio5|244
Ophiocordyceps subramaniannii Hirsu2|6373

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|1563
MASRCTSTASCPLSVLLRPSIRRPISSSLSLAPPRYRPSSTTSSPETPEVNGLPESRLNPRPDDYKAPAFADKAE
LILSAGRGGHGCISFLREAFNPDGPANGGDGGHGGSIYIQAAHGETSLHKLARQRHIRASRGKNGQGASKTGTRG
DDIVITVPVGTLVREVHRRDPVAEETQRFREWRATKKRKAREQREAEASNKLADEQDVDEDAFDQYPIDEEVIYD
SEDANPQAYGKSRHSIQGQTEEDEEDIEHQNPHRHKWLLHPGMSKSEAQKTPVPRLPRRLRRLHQPPAPIVLDLS
QPSVKPFLLAAGGIGGLGNPHFVSRDYPRPLFATKGDDAISMTISLELKLLADVGLVGLPNAGKSTLLRAITNSR
TRVGAWAFTTLQPNIGTVILDRYSGRPIFRPRSSDPNAEARTRFTVADIPGLVQGAHLDRGLGIAFLRHVERAGL
LAFVVDLSAGNAVQALNALWSEVALYAQMRSDEDRRRREADGPADCSIVTDIPGATINLMDAMDQIPAPLDAPSP
AADIAAKPWFVVATKADLPGTQANFAELKAYLDAITAGKAPHPSRLDGAWTGRCAAIPVSAINGQGVDRIVHWTV
ALLED*
Coding >Ophun1|1563
ATGGCATCCCGCTGCACCTCAACAGCCTCGTGCCCTCTCTCTGTCCTCCTCCGCCCATCAATCCGTCGTCCAATC
TCATCGTCCCTCAGCCTCGCACCGCCACGCTACCGGCCGTCATCGACAACGTCTTCCCCAGAGACGCCCGAGGTC
AACGGCCTACCGGAGTCGCGCCTCAACCCGCGGCCAGACGACTACAAGGCCCCAGCCTTCGCCGATAAAGCCGAG
CTTATCCTCAGCGCCGGACGCGGCGGCCACGGCTGCATCTCCTTTCTGCGCGAGGCCTTTAACCCTGACGGACCG
GCCAACGGTGGCGACGGCGGTCATGGTGGTAGCATCTACATCCAGGCTGCTCACGGGGAGACTTCGCTGCACAAG
CTCGCTCGCCAACGCCATATCCGAGCCAGTCGCGGGAAGAATGGCCAGGGTGCCTCCAAGACGGGCACTCGGGGC
GACGACATTGTCATTACCGTTCCCGTCGGCACTCTTGTCCGCGAGGTACATCGTCGAGATCCAGTAGCTGAAGAG
ACCCAGCGCTTCCGCGAATGGCGAGCCACCAAGAAGAGGAAGGCTCGCGAGCAGCGCGAAGCAGAGGCTTCCAAT
AAGCTGGCCGACGAACAAGACGTCGATGAAGATGCCTTTGACCAATACCCAATTGACGAGGAAGTCATCTACGAC
TCCGAAGATGCCAACCCTCAAGCTTACGGGAAAAGCCGTCATTCAATTCAAGGACAAACCGAAGAAGACGAAGAA
GACATCGAGCATCAAAACCCCCATCGTCACAAATGGCTCCTCCACCCTGGCATGTCCAAATCCGAAGCCCAAAAA
ACTCCCGTCCCCCGTTTACCTCGTCGCCTCCGCCGTCTCCACCAACCACCGGCCCCCATCGTCCTCGACCTCTCG
CAGCCGTCCGTCAAGCCATTCCTCCTGGCAGCCGGCGGCATCGGCGGGCTAGGAAACCCGCACTTTGTGTCGCGC
GATTACCCTCGTCCCCTCTTCGCGACAAAGGGCGACGACGCCATCTCCATGACCATCTCTCTCGAGCTCAAGCTC
TTGGCAGACGTCGGTCTCGTCGGCCTCCCCAACGCAGGGAAAAGCACCCTCCTACGAGCCATAACCAACAGCCGC
ACCCGCGTCGGCGCCTGGGCCTTCACCACTCTCCAACCCAACATCGGCACCGTCATCCTCGACCGCTACTCCGGC
AGACCCATCTTCCGCCCTCGCTCTTCCGATCCAAACGCAGAGGCCCGCACGCGCTTTACCGTCGCCGACATCCCA
GGCCTCGTTCAAGGCGCTCATCTAGACCGCGGCCTCGGCATCGCCTTCTTACGCCACGTCGAACGCGCAGGCCTC
CTAGCCTTCGTCGTCGACCTCTCTGCCGGCAACGCCGTGCAAGCCCTCAACGCCCTCTGGAGCGAAGTTGCCCTC
TACGCCCAGATGCGCAGCGACGAAGACCGCCGTCGACGCGAAGCCGACGGTCCCGCCGACTGCAGCATCGTTACG
GATATCCCCGGCGCAACCATCAACCTCATGGACGCAATGGATCAGATTCCCGCTCCGCTGGACGCTCCCTCTCCC
GCCGCCGACATCGCCGCCAAGCCCTGGTTCGTCGTCGCCACAAAGGCGGATCTGCCCGGTACGCAGGCCAACTTT
GCAGAGCTCAAGGCCTATCTCGATGCCATCACCGCCGGCAAGGCTCCGCATCCGAGCCGGCTCGACGGGGCATGG
ACCGGCAGGTGCGCCGCCATCCCGGTCAGCGCCATCAACGGCCAGGGCGTCGATCGCATCGTTCACTGGACAGTT
GCCCTGCTTGAAGACTGA
Transcript >Ophun1|1563
ATGGCATCCCGCTGCACCTCAACAGCCTCGTGCCCTCTCTCTGTCCTCCTCCGCCCATCAATCCGTCGTCCAATC
TCATCGTCCCTCAGCCTCGCACCGCCACGCTACCGGCCGTCATCGACAACGTCTTCCCCAGAGACGCCCGAGGTC
AACGGCCTACCGGAGTCGCGCCTCAACCCGCGGCCAGACGACTACAAGGCCCCAGCCTTCGCCGATAAAGCCGAG
CTTATCCTCAGCGCCGGACGCGGCGGCCACGGCTGCATCTCCTTTCTGCGCGAGGCCTTTAACCCTGACGGACCG
GCCAACGGTGGCGACGGCGGTCATGGTGGTAGCATCTACATCCAGGCTGCTCACGGGGAGACTTCGCTGCACAAG
CTCGCTCGCCAACGCCATATCCGAGCCAGTCGCGGGAAGAATGGCCAGGGTGCCTCCAAGACGGGCACTCGGGGC
GACGACATTGTCATTACCGTTCCCGTCGGCACTCTTGTCCGCGAGGTACATCGTCGAGATCCAGTAGCTGAAGAG
ACCCAGCGCTTCCGCGAATGGCGAGCCACCAAGAAGAGGAAGGCTCGCGAGCAGCGCGAAGCAGAGGCTTCCAAT
AAGCTGGCCGACGAACAAGACGTCGATGAAGATGCCTTTGACCAATACCCAATTGACGAGGAAGTCATCTACGAC
TCCGAAGATGCCAACCCTCAAGCTTACGGGAAAAGCCGTCATTCAATTCAAGGACAAACCGAAGAAGACGAAGAA
GACATCGAGCATCAAAACCCCCATCGTCACAAATGGCTCCTCCACCCTGGCATGTCCAAATCCGAAGCCCAAAAA
ACTCCCGTCCCCCGTTTACCTCGTCGCCTCCGCCGTCTCCACCAACCACCGGCCCCCATCGTCCTCGACCTCTCG
CAGCCGTCCGTCAAGCCATTCCTCCTGGCAGCCGGCGGCATCGGCGGGCTAGGAAACCCGCACTTTGTGTCGCGC
GATTACCCTCGTCCCCTCTTCGCGACAAAGGGCGACGACGCCATCTCCATGACCATCTCTCTCGAGCTCAAGCTC
TTGGCAGACGTCGGTCTCGTCGGCCTCCCCAACGCAGGGAAAAGCACCCTCCTACGAGCCATAACCAACAGCCGC
ACCCGCGTCGGCGCCTGGGCCTTCACCACTCTCCAACCCAACATCGGCACCGTCATCCTCGACCGCTACTCCGGC
AGACCCATCTTCCGCCCTCGCTCTTCCGATCCAAACGCAGAGGCCCGCACGCGCTTTACCGTCGCCGACATCCCA
GGCCTCGTTCAAGGCGCTCATCTAGACCGCGGCCTCGGCATCGCCTTCTTACGCCACGTCGAACGCGCAGGCCTC
CTAGCCTTCGTCGTCGACCTCTCTGCCGGCAACGCCGTGCAAGCCCTCAACGCCCTCTGGAGCGAAGTTGCCCTC
TACGCCCAGATGCGCAGCGACGAAGACCGCCGTCGACGCGAAGCCGACGGTCCCGCCGACTGCAGCATCGTTACG
GATATCCCCGGCGCAACCATCAACCTCATGGACGCAATGGATCAGATTCCCGCTCCGCTGGACGCTCCCTCTCCC
GCCGCCGACATCGCCGCCAAGCCCTGGTTCGTCGTCGCCACAAAGGCGGATCTGCCCGGTACGCAGGCCAACTTT
GCAGAGCTCAAGGCCTATCTCGATGCCATCACCGCCGGCAAGGCTCCGCATCCGAGCCGGCTCGACGGGGCATGG
ACCGGCAGGTGCGCCGCCATCCCGGTCAGCGCCATCAACGGCCAGGGCGTCGATCGCATCGTTCACTGGACAGTT
GCCCTGCTTGAAGACTGA
Gene >Ophun1|1563
ATGGCATCCCGCTGCACCTCAACAGCCTCGTGCCCTCTCTCTGTCCTCCTCCGCCCATCAATCCGTCGTCCAATC
TCATCGTCCCTCAGCCTCGCACCGCCACGCTACCGGCCGTCATCGACAACGTCTTCCCCAGAGACGCCCGAGGTC
AACGGCCTACCGGAGTCGCGCCTCAACCCGCGGCCAGACGACTACAAGGCCCCAGCCTTCGCCGATAAAGCCGAG
CTTATCCTCAGCGCCGGACGCGGCGGCCACGGCTGCATCTCCTTTCTGCGCGAGGCCTTTAACCCTGACGGACCG
GCCAACGGTGGCGACGGCGGTCATGGTGGTAGCATCTACATCCAGGCTGCTCACGGGGAGACTTCGCTGCACAAG
CTCGCTCGCCAACGCCATATCCGAGCCAGTCGCGGGAAGAATGGCCAGGGTGCCTCCAAGACGGGCACTCGGGGC
GACGACATTGTCATTACCGTTCCCGTCGGCACTCTTGTCCGCGAGGTACATCGTCGAGATCCAGTAGCTGAAGAG
ACCCAGCGCTTCCGCGAATGGCGAGCCACCAAGAAGAGGAAGGCTCGCGAGCAGCGCGAAGCAGAGGCTTCCAAT
AAGCTGGCCGACGAACAAGACGTCGATGAAGATGCCTTTGACCAATACCCAATTGACGAGGAAGTCATCTACGAC
TCCGAAGATGCCAACCCTCAAGCTTACGGGAAAAGCCGTCATTCAATTCAAGGACAAACCGAAGAAGACGAAGAA
GACATCGAGCATCAAAACCCCCATCGTCACAAATGGCTCCTCCACCCTGGCATGTCCAAATCCGAAGCCCAAAAA
ACTCCCGTCCCCCGTTTACCTCGTCGCCTCCGCCGTCTCCACCAACCACCGGCCCCCATCGTCCTCGACCTCTCG
CAGCCGTCCGTCAAGCCATTCCTCCTGGCAGCCGGCGGCATCGGCGGGCTAGGAAACCCGCACTTTGTGTCGCGC
GATTACCCTCGTCCCCTCTTCGCGACAAAGGGCGACGACGCCATCTCCATGACCATCTCTCTCGAGCTCAAGCTC
TTGGCAGACGTCGGTCTCGTCGGCCTCCCCAACGCAGGGAAAAGCACCCTCCTACGAGCCATAACCAACAGCCGC
ACCCGCGTCGGCGCCTGGGCCTTCACCACTCTCCAACCCAACATCGGCACCGTCATCCTCGACCGCTACTCCGGC
AGACCCATCTTCCGCCCTCGCTCTTCCGATCCAAACGCAGAGGCCCGCACGCGCTTTACCGTCGCCGACATCCCA
GGCCTCGTTCAAGGCGCTCATCTAGACCGCGGCCTCGGCATCGCCTTCTTACGCCACGTCGAACGCGCAGGCCTC
CTAGCCTTCGTCGTCGACCTCTCTGCCGGCAACGCCGTGCAAGCCCTCAACGCCCTCTGGAGCGAAGTTGCCCTC
TACGCCCAGATGCGCAGCGACGAAGACCGCCGTCGACGCGAAGCCGACGGTCCCGCCGACTGCAGCATCGTTACG
GATATCCCCGGCGCAACCATCAACCTCATGGACGCAATGGATCAGATTCCCGCTCCGCTGGACGCTCCCTCTCCC
GCCGCCGACATCGCCGCCAAGCCCTGGTTCGTCGTCGCCACAAAGGCGGATCTGCCCGGTACGCAGGCCAACTTT
GCAGAGCTCAAGGCCTATCTCGATGCCATCACCGCCGGCAAGGCTCCGCATCCGAGCCGGCTCGACGGGGCATGG
ACCGGCAGGTGCGCCGCCATCCCGGTCAGCGCCATCAACGGCCAGGGCGTCGATCGCATCGTTCACTGGACAGTT
GCCCTGCTTGAAGACTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail